Domain: PHILADELPHIACRIMINALDEFENSELAWYER.COM (5 similar domains)
Registrar: Epik LLC (1.07 million domains)
Query Time: 27 Apr 2024 - 10:21 AM UTC [12 DAYS BACK] [REFRESH]
Registered: 18th March 2005 [19 years, 1 month, 21 days back]
Updated: 18th April 2024 [21 days back]
Expiry: 18th March 2024 [1 month, 21 days back]
DOMAIN STATUS
clientTransferProhibited
NAME SERVERS
ns3.epik.com
ns4.epik.com
REGISTRANT CONTACT
Name: Privacy Administrator (2.07 million domains)
Company: Anonymize LLC (319,294 domains)
Address: 30 N Gould St STE E
City: Sheridan
State: WY
ZIP Code: 82801
Country: United States (231 million domains from United States for $6,250)
Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Phone: +1.7373015923
ADMINISTRATIVE CONTACT
Name: Privacy Administrator (2.07 million domains)
Company: Anonymize LLC (319,294 domains)
Address: 30 N Gould St STE E
City: Sheridan
State: WY
ZIP Code: 82801
Country: United States (231 million domains from United States for $6,250)
Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Phone: +1.7373015923
TECHNICAL CONTACT
Name: Privacy Administrator (2.07 million domains)
Company: Anonymize LLC (319,294 domains)
Address: 30 N Gould St STE E
City: Sheridan
State: WY
ZIP Code: 82801
Country: United States (231 million domains from United States for $6,250)
Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Phone: +1.7373015923
SHARE THIS PAGE
Short URL: whoxy.com/philadelphiacriminaldefenselawyer.com
Permalink: https://www.whoxy.com/philadelphiacriminaldefenselawyer.com
--------------------------------------------------
Generator: x3.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Sat, 27 Apr 2024 10:21:15 +0000
--------------------------------------------------
Domain Name: PHILADELPHIACRIMINALDEFENSELAWYER.COM
Registry Domain ID: 146841245_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.epik.com
Registrar URL: http://www.epik.com
Updated Date: 2024-04-18T03:24:19Z
Creation Date: 2005-03-18T22:49:37Z
Registry Expiry Date: 2025-03-18T21:49:37Z
Registrar: Epik LLC
Registrar IANA ID: 617
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.7373015923
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS3.EPIK.COM
Name Server: NS4.EPIK.COM
DNSSEC: signedDelegation
DNSSEC DS Data: 54113 13 2 654AFD7F53277CD94A0F61683C5E0AEDCEF4E08B762D8B58C0DCC7662F411A10
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2024-04-27T10:21:02Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
--------------------------------------------------
Registrar WHOIS: whois.epik.com
Query Time: Sat, 27 Apr 2024 10:21:17 +0000
--------------------------------------------------
Domain Name: PHILADELPHIACRIMINALDEFENSELAWYER.COM
Registry Domain ID: 146841245_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.epik.com
Registrar URL: https://www.epik.com
Updated Date: 2024-04-18T03:24:19Z
Creation Date: 2005-03-18T22:49:37Z
Registrar Registration Expiration Date: 2024-03-18T21:49:37Z
Registrar: Epik LLC
Registrar IANA ID: 617
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.7373015923
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Privacy Administrator
Registrant Organization: Anonymize LLC
Registrant Street: 30 N Gould St STE E
Registrant City: Sheridan
Registrant State/Province: WY
Registrant Postal Code: 82801
Registrant Country: US
Registrant Phone: +1.7373015923
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Registry Admin ID:
Admin Name: Privacy Administrator
Admin Organization: Anonymize LLC
Admin Street: 30 N Gould St STE E
Admin City: Sheridan
Admin State/Province: WY
Admin Postal Code: 82801
Admin Country: US
Admin Phone: +1.7373015923
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Registry Tech ID:
Tech Name: Privacy Administrator
Tech Organization: Anonymize LLC
Tech Street: 30 N Gould St STE E
Tech City: Sheridan
Tech State/Province: WY
Tech Postal Code: 82801
Tech Country: US
Tech Phone: +1.7373015923
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Name Server: NS3.EPIK.COM
Name Server: NS4.EPIK.COM
DNSSEC: signedDelegation
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-03-12T15:02:16Z <<<
All registrar data, including registrant WHOIS data, is provided for public, non-commerical use only. Any information made available by Epik LLC and its affiliate registrars shall not be collected, distributed or used for any commercial activity. Third parties to agree not to use the data to allow, enable, or otherwise support any marketing activities, regardless of the medium used. Such media include but are not limited to e-mail, telephone, facsimile, postal mail, SMS, and wireless alerts.
{
"status": 1,
"domain_name": "philadelphiacriminaldefenselawyer.com",
"query_time": "2024-04-27 10:21:15",
"whois_server": "whois.epik.com",
"domain_registered": "yes",
"create_date": "2005-03-18",
"update_date": "2024-04-18",
"expiry_date": "2024-03-18",
"domain_registrar": {
"iana_id": 617,
"registrar_name": "Epik LLC",
"whois_server": "whois.epik.com",
"website_url": "https://www.epik.com",
"email_address": "[email protected]",
"phone_number": "+1.7373015923"
},
"registrant_contact": {
"full_name": "Privacy Administrator",
"company_name": "Anonymize LLC",
"mailing_address": "30 N Gould St STE E",
"city_name": "Sheridan",
"state_name": "WY",
"zip_code": "82801",
"country_name": "United States",
"country_code": "US",
"email_address": "philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com",
"phone_number": "+1.7373015923"
},
"administrative_contact": {
"full_name": "Privacy Administrator",
"company_name": "Anonymize LLC",
"mailing_address": "30 N Gould St STE E",
"city_name": "Sheridan",
"state_name": "WY",
"zip_code": "82801",
"country_name": "United States",
"country_code": "US",
"email_address": "philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com",
"phone_number": "+1.7373015923"
},
"technical_contact": {
"full_name": "Privacy Administrator",
"company_name": "Anonymize LLC",
"mailing_address": "30 N Gould St STE E",
"city_name": "Sheridan",
"state_name": "WY",
"zip_code": "82801",
"country_name": "United States",
"country_code": "US",
"email_address": "philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com",
"phone_number": "+1.7373015923"
},
"name_servers": [
"ns3.epik.com",
"ns4.epik.com"
],
"domain_status": [
"clientTransferProhibited"
],
"raw_whois": "--------------------------------------------------\nGenerator: x3.autowhois.com\nRegistry WHOIS: whois.verisign-grs.com\nQuery Time: Sat, 27 Apr 2024 10:21:15 +0000\n--------------------------------------------------\n\nDomain Name: PHILADELPHIACRIMINALDEFENSELAWYER.COM\r\nRegistry Domain ID: 146841245_DOMAIN_COM-VRSN\r\nRegistrar WHOIS Server: whois.epik.com\r\nRegistrar URL: http://www.epik.com\r\nUpdated Date: 2024-04-18T03:24:19Z\r\nCreation Date: 2005-03-18T22:49:37Z\r\nRegistry Expiry Date: 2025-03-18T21:49:37Z\r\nRegistrar: Epik LLC\r\nRegistrar IANA ID: 617\r\nRegistrar Abuse Contact Email: [email protected]\r\nRegistrar Abuse Contact Phone: +1.7373015923\r\nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\r\nName Server: NS3.EPIK.COM\r\nName Server: NS4.EPIK.COM\r\nDNSSEC: signedDelegation\r\nDNSSEC DS Data: 54113 13 2 654AFD7F53277CD94A0F61683C5E0AEDCEF4E08B762D8B58C0DCC7662F411A10\r\nURL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/\r\n>>> Last update of whois database: 2024-04-27T10:21:02Z <<<\r\n\r\nFor more information on Whois status codes, please visit https://icann.org/epp\r\n\r\nNOTICE: The expiration date displayed in this record is the date the\r\nregistrar's sponsorship of the domain name registration in the registry is\r\ncurrently set to expire. This date does not necessarily reflect the expiration\r\ndate of the domain name registrant's agreement with the sponsoring\r\nregistrar. Users may consult the sponsoring registrar's Whois database to\r\nview the registrar's reported date of expiration for this registration.\r\n\r\nTERMS OF USE: You are not authorized to access or query our Whois\r\ndatabase through the use of electronic processes that are high-volume and\r\nautomated except as reasonably necessary to register domain names or\r\nmodify existing registrations; the Data in VeriSign Global Registry\r\nServices' (\"VeriSign\") Whois database is provided by VeriSign for\r\ninformation purposes only, and to assist persons in obtaining information\r\nabout or related to a domain name registration record. VeriSign does not\r\nguarantee its accuracy. By submitting a Whois query, you agree to abide\r\nby the following terms of use: You agree that you may use this Data only\r\nfor lawful purposes and that under no circumstances will you use this Data\r\nto: (1) allow, enable, or otherwise support the transmission of mass\r\nunsolicited, commercial advertising or solicitations via e-mail, telephone,\r\nor facsimile; or (2) enable high volume, automated, electronic processes\r\nthat apply to VeriSign (or its computer systems). The compilation,\r\nrepackaging, dissemination or other use of this Data is expressly\r\nprohibited without the prior written consent of VeriSign. You agree not to\r\nuse electronic processes that are automated and high-volume to access or\r\nquery the Whois database except as reasonably necessary to register\r\ndomain names or modify existing registrations. VeriSign reserves the right\r\nto restrict your access to the Whois database in its sole discretion to ensure\r\noperational stability. VeriSign may restrict or terminate your access to the\r\nWhois database for failure to abide by these terms of use. VeriSign\r\nreserves the right to modify these terms at any time.\r\n\r\nThe Registry database contains ONLY .COM, .NET, .EDU domains and\r\nRegistrars.\n\n--------------------------------------------------\nRegistrar WHOIS: whois.epik.com\nQuery Time: Sat, 27 Apr 2024 10:21:17 +0000\n--------------------------------------------------\n\nDomain Name: PHILADELPHIACRIMINALDEFENSELAWYER.COM\nRegistry Domain ID: 146841245_DOMAIN_COM-VRSN\nRegistrar WHOIS Server: whois.epik.com\nRegistrar URL: https://www.epik.com\nUpdated Date: 2024-04-18T03:24:19Z\nCreation Date: 2005-03-18T22:49:37Z\nRegistrar Registration Expiration Date: 2024-03-18T21:49:37Z\nRegistrar: Epik LLC\nRegistrar IANA ID: 617\nRegistrar Abuse Contact Email: [email protected]\nRegistrar Abuse Contact Phone: +1.7373015923\nReseller: \nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\nRegistry Registrant ID: \nRegistrant Name: Privacy Administrator\nRegistrant Organization: Anonymize LLC\nRegistrant Street: 30 N Gould St STE E\nRegistrant City: Sheridan\nRegistrant State/Province: WY\nRegistrant Postal Code: 82801\nRegistrant Country: US\nRegistrant Phone: +1.7373015923\nRegistrant Phone Ext: \nRegistrant Fax: \nRegistrant Fax Ext: \nRegistrant Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com\nRegistry Admin ID: \nAdmin Name: Privacy Administrator\nAdmin Organization: Anonymize LLC\nAdmin Street: 30 N Gould St STE E\nAdmin City: Sheridan\nAdmin State/Province: WY\nAdmin Postal Code: 82801\nAdmin Country: US\nAdmin Phone: +1.7373015923\nAdmin Phone Ext: \nAdmin Fax: \nAdmin Fax Ext: \nAdmin Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com\nRegistry Tech ID: \nTech Name: Privacy Administrator\nTech Organization: Anonymize LLC\nTech Street: 30 N Gould St STE E\nTech City: Sheridan\nTech State/Province: WY\nTech Postal Code: 82801\nTech Country: US\nTech Phone: +1.7373015923\nTech Phone Ext: \nTech Fax: \nTech Fax Ext: \nTech Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com\nName Server: NS3.EPIK.COM\nName Server: NS4.EPIK.COM\nDNSSEC: signedDelegation\nURL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/\n>>> Last update of WHOIS database: 2021-03-12T15:02:16Z <<<\n\nAll registrar data, including registrant WHOIS data, is provided for public, non-commerical use only. Any information made available by Epik LLC and its affiliate registrars shall not be collected, distributed or used for any commercial activity. Third parties to agree not to use the data to allow, enable, or otherwise support any marketing activities, regardless of the medium used. Such media include but are not limited to e-mail, telephone, facsimile, postal mail, SMS, and wireless alerts."
}
<?xml version="1.0" encoding="UTF-8"?>
<root>
<status>1</status>
<domain_name>philadelphiacriminaldefenselawyer.com</domain_name>
<query_time>2024-04-27 10:21:15</query_time>
<whois_server>whois.epik.com</whois_server>
<domain_registered>yes</domain_registered>
<create_date>2005-03-18</create_date>
<update_date>2024-04-18</update_date>
<expiry_date>2024-03-18</expiry_date>
<domain_registrar>
<iana_id>617</iana_id>
<registrar_name>Epik LLC</registrar_name>
<whois_server>whois.epik.com</whois_server>
<website_url>https://www.epik.com</website_url>
<email_address>[email protected]</email_address>
<phone_number>+1.7373015923</phone_number>
</domain_registrar>
<registrant_contact>
<full_name>Privacy Administrator</full_name>
<company_name>Anonymize LLC</company_name>
<mailing_address>30 N Gould St STE E</mailing_address>
<city_name>Sheridan</city_name>
<state_name>WY</state_name>
<zip_code>82801</zip_code>
<country_name>United States</country_name>
<country_code>US</country_code>
<email_address>philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com</email_address>
<phone_number>+1.7373015923</phone_number>
</registrant_contact>
<administrative_contact>
<full_name>Privacy Administrator</full_name>
<company_name>Anonymize LLC</company_name>
<mailing_address>30 N Gould St STE E</mailing_address>
<city_name>Sheridan</city_name>
<state_name>WY</state_name>
<zip_code>82801</zip_code>
<country_name>United States</country_name>
<country_code>US</country_code>
<email_address>philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com</email_address>
<phone_number>+1.7373015923</phone_number>
</administrative_contact>
<technical_contact>
<full_name>Privacy Administrator</full_name>
<company_name>Anonymize LLC</company_name>
<mailing_address>30 N Gould St STE E</mailing_address>
<city_name>Sheridan</city_name>
<state_name>WY</state_name>
<zip_code>82801</zip_code>
<country_name>United States</country_name>
<country_code>US</country_code>
<email_address>philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com</email_address>
<phone_number>+1.7373015923</phone_number>
</technical_contact>
<name_servers>
<value>ns3.epik.com</value>
<value>ns4.epik.com</value>
</name_servers>
<domain_status>
<value>clientTransferProhibited</value>
</domain_status>
<raw_whois>--------------------------------------------------
Generator: x3.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Sat, 27 Apr 2024 10:21:15 +0000
--------------------------------------------------
Domain Name: PHILADELPHIACRIMINALDEFENSELAWYER.COM
Registry Domain ID: 146841245_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.epik.com
Registrar URL: http://www.epik.com
Updated Date: 2024-04-18T03:24:19Z
Creation Date: 2005-03-18T22:49:37Z
Registry Expiry Date: 2025-03-18T21:49:37Z
Registrar: Epik LLC
Registrar IANA ID: 617
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.7373015923
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS3.EPIK.COM
Name Server: NS4.EPIK.COM
DNSSEC: signedDelegation
DNSSEC DS Data: 54113 13 2 654AFD7F53277CD94A0F61683C5E0AEDCEF4E08B762D8B58C0DCC7662F411A10
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2024-04-27T10:21:02Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
--------------------------------------------------
Registrar WHOIS: whois.epik.com
Query Time: Sat, 27 Apr 2024 10:21:17 +0000
--------------------------------------------------
Domain Name: PHILADELPHIACRIMINALDEFENSELAWYER.COM
Registry Domain ID: 146841245_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.epik.com
Registrar URL: https://www.epik.com
Updated Date: 2024-04-18T03:24:19Z
Creation Date: 2005-03-18T22:49:37Z
Registrar Registration Expiration Date: 2024-03-18T21:49:37Z
Registrar: Epik LLC
Registrar IANA ID: 617
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.7373015923
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Privacy Administrator
Registrant Organization: Anonymize LLC
Registrant Street: 30 N Gould St STE E
Registrant City: Sheridan
Registrant State/Province: WY
Registrant Postal Code: 82801
Registrant Country: US
Registrant Phone: +1.7373015923
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Registry Admin ID:
Admin Name: Privacy Administrator
Admin Organization: Anonymize LLC
Admin Street: 30 N Gould St STE E
Admin City: Sheridan
Admin State/Province: WY
Admin Postal Code: 82801
Admin Country: US
Admin Phone: +1.7373015923
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Registry Tech ID:
Tech Name: Privacy Administrator
Tech Organization: Anonymize LLC
Tech Street: 30 N Gould St STE E
Tech City: Sheridan
Tech State/Province: WY
Tech Postal Code: 82801
Tech Country: US
Tech Phone: +1.7373015923
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com
Name Server: NS3.EPIK.COM
Name Server: NS4.EPIK.COM
DNSSEC: signedDelegation
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-03-12T15:02:16Z <<<
All registrar data, including registrant WHOIS data, is provided for public, non-commerical use only. Any information made available by Epik LLC and its affiliate registrars shall not be collected, distributed or used for any commercial activity. Third parties to agree not to use the data to allow, enable, or otherwise support any marketing activities, regardless of the medium used. Such media include but are not limited to e-mail, telephone, facsimile, postal mail, SMS, and wireless alerts.</raw_whois>
</root>
Whois Lookup API
You can fetch the above results using our Whois Lookup API.
https://api.whoxy.com/?key=xxxxx&whois=philadelphiacriminaldefenselawyer.com
Whois API digs into WHOIS registry referral chains until the correct WHOIS servers are found, for the most complete WHOIS data.
Our WHOIS parser converts WHOIS data into well-structured fields (XML & JSON), which can easily be read by your application.
Whois API supports a total of 2026 Domain Extensions (gTLDs, ccTLDs & new gTLDs), ensuring all domains are supported.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
Whois Lookup Pricing | Total API Calls | Price | CPM | Purchase |
---|---|---|---|---|
1,000 Whois Lookup API Queries | 1,000 | $2 | $2.00 | Order Now |
10,000 Whois Lookup API Queries | 10,000 | $20 | $2.00 | Order Now |
50,000 Whois Lookup API Queries | 50,000 | $75 | $1.50 | Order Now |
250,000 Whois Lookup API Queries | 250,000 | $300 | $1.20 | Order Now |
1 Million Whois Lookup API Queries | 1,000,000 | $1,000 | $1.00 | Order Now |
10 Million Whois Lookup API Queries | 10,000,000 | $5,000 | $0.50 | Order Now |
25 Million Whois Lookup API Queries | 25,000,000 | $10,000 | $0.40 | Order Now |
Who owned philadelphiacriminaldefenselawyer.com in the past? (6 records)
Name: Braden Pollock (22,903 domains)
Company: Legal Brand Domains, LLC (5,946 domains)
Email: [email protected] (20,929 domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: buy.internettraffic.com, sell.internettraffic.com
Status: clientTransferProhibited
Name: Braden Pollock (22,903 domains)
Company: Legal Brand Domains, LLC (5,946 domains)
Email: [email protected] (20,929 domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: buy.internettraffic.com, sell.internettraffic.com
Status: OK UPDATED
Name: Braden Pollock (22,903 domains)
Company: Legal Brand Domains (12,790 domains) UPDATED
Email: [email protected] (20,929 domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: buy.internettraffic.com, sell.internettraffic.com
Status: clientTransferProhibited UPDATED
Name: Braden Pollock (22,903 domains)
Company: Legal Brand Domains (12,790 domains)
Email: [email protected] (20,929 domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns1.dan.com, ns2.dan.com UPDATED
Status: clientTransferProhibited
Name: Braden Pollock (22,903 domains)
Company: Legal Brand Domains (12,790 domains)
Email: [email protected] (20,929 domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns3.epik.com, ns4.epik.com UPDATED
Status: clientTransferProhibited
Name: Privacy Administrator (2.07 million domains) UPDATED
Company: Anonymize LLC (319,294 domains) UPDATED
Email: philadelphiacriminaldefenselawyer.com-1ib8s7etj74ft@anonymize.com UPDATED
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns3.epik.com, ns4.epik.com
Status: clientTransferProhibited
Whois History API returns all the historical WHOIS records of a domain name. For more details, please visit https://www.whoxy.com/whois-history/