Our database now contains whois records of 554 Million (554,493,987) domain names.
Login / Password / Signup

Domain: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM
Registrar: GoDaddy.com, LLC (146 million domains)
Query Time: 27 Apr 2024 - 10:35 AM UTC  [12 DAYS BACK] [REFRESH]


Registered: 9th August 2007  [16 years, 9 months back]
Updated: 10th August 2023  [8 months, 29 days back]
Expiry: 9th August 2024  [2 months, 30 days left]


DOMAIN STATUS

clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited


NAME SERVERS

ns53.domaincontrol.com
ns54.domaincontrol.com


REGISTRANT CONTACT

Name: Registration Private (145 million domains)
Company: Domains By Proxy, LLC (210 million domains)
Address: DomainsByProxy.com, 2155 E Warner Rd
City: Tempe
State: Arizona
ZIP Code: 85284
Country: United States (231 million domains from United States for $6,250)
Phone: +1.4806242599


ADMINISTRATIVE CONTACT

Name: Registration Private (145 million domains)
Company: Domains By Proxy, LLC (210 million domains)
Address: DomainsByProxy.com, 2155 E Warner Rd
City: Tempe
State: Arizona
ZIP Code: 85284
Country: United States (231 million domains from United States for $6,250)
Phone: +1.4806242599


TECHNICAL CONTACT

Name: Registration Private (145 million domains)
Company: Domains By Proxy, LLC (210 million domains)
Address: DomainsByProxy.com, 2155 E Warner Rd
City: Tempe
State: Arizona
ZIP Code: 85284
Country: United States (231 million domains from United States for $6,250)
Phone: +1.4806242599


SHARE THIS PAGE

Short URL: whoxy.com/philadelphiacriminaldefenselawyerblog.com
Permalink: https://www.whoxy.com/philadelphiacriminaldefenselawyerblog.com

Facebook Twitter Google+ LinkedIn Email

--------------------------------------------------
Generator: x1.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Sat, 27 Apr 2024 10:35:01 +0000
--------------------------------------------------

Domain Name: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM
Registry Domain ID: 1141372440_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2023-08-10T14:56:48Z
Creation Date: 2007-08-09T07:40:55Z
Registry Expiry Date: 2024-08-09T07:40:55Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS53.DOMAINCONTROL.COM
Name Server: NS54.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2024-04-27T10:34:51Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability.  VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

--------------------------------------------------
Registrar WHOIS: whois.godaddy.com
Query Time: Sat, 27 Apr 2024 10:35:02 +0000
--------------------------------------------------

Domain Name: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM
Registry Domain ID: 1141372440_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: https://www.godaddy.com
Updated Date: 2023-08-10T09:56:47Z
Creation Date: 2007-08-09T02:40:55Z
Registrar Registration Expiration Date: 2024-08-09T02:40:55Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 2155 E Warner Rd
Registrant City: Tempe
Registrant State/Province: Arizona
Registrant Postal Code: 85284
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 2155 E Warner Rd
Admin City: Tempe
Admin State/Province: Arizona
Admin Postal Code: 85284
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: 
Admin Fax Ext:
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 2155 E Warner Rd
Tech City: Tempe
Tech State/Province: Arizona
Tech Postal Code: 85284
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: 
Tech Fax Ext:
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM
Name Server: NS53.DOMAINCONTROL.COM
Name Server: NS54.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-04-27T10:35:04Z <<<
For more information on Whois status codes, please visit https://icann.org/epp

TERMS OF USE: The data contained in this registrar's Whois database, while believed by the
registrar to be reliable, is provided "as is" with no guarantee or warranties regarding its
accuracy. This information is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of this data for any other purpose
is expressly forbidden without the prior written permission of this registrar. By submitting
an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not
to use this data to allow, enable, or otherwise support the dissemination or collection of this
data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,
postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations
of any kind, including spam. You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data for any purpose, including
mining this data for your own personal or commercial purposes. Failure to comply with these terms
may result in termination of access to the Whois database. These terms may be subject to modification
at any time without notice.
{
    "status": 1,
    "domain_name": "philadelphiacriminaldefenselawyerblog.com",
    "query_time": "2024-04-27 10:35:01",
    "whois_server": "whois.godaddy.com",
    "domain_registered": "yes",
    "create_date": "2007-08-09",
    "update_date": "2023-08-10",
    "expiry_date": "2024-08-09",
    "domain_registrar": {
        "iana_id": 146,
        "registrar_name": "GoDaddy.com, LLC",
        "whois_server": "whois.godaddy.com",
        "website_url": "https://www.godaddy.com",
        "email_address": "[email protected]",
        "phone_number": "+1.4806242505"
    },
    "registrant_contact": {
        "full_name": "Registration Private",
        "company_name": "Domains By Proxy, LLC",
        "mailing_address": "DomainsByProxy.com, 2155 E Warner Rd",
        "city_name": "Tempe",
        "state_name": "Arizona",
        "zip_code": "85284",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM",
        "phone_number": "+1.4806242599"
    },
    "administrative_contact": {
        "full_name": "Registration Private",
        "company_name": "Domains By Proxy, LLC",
        "mailing_address": "DomainsByProxy.com, 2155 E Warner Rd",
        "city_name": "Tempe",
        "state_name": "Arizona",
        "zip_code": "85284",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM",
        "phone_number": "+1.4806242599"
    },
    "technical_contact": {
        "full_name": "Registration Private",
        "company_name": "Domains By Proxy, LLC",
        "mailing_address": "DomainsByProxy.com, 2155 E Warner Rd",
        "city_name": "Tempe",
        "state_name": "Arizona",
        "zip_code": "85284",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM",
        "phone_number": "+1.4806242599"
    },
    "name_servers": [
        "ns53.domaincontrol.com",
        "ns54.domaincontrol.com"
    ],
    "domain_status": [
        "clientDeleteProhibited",
        "clientRenewProhibited",
        "clientTransferProhibited",
        "clientUpdateProhibited"
    ],
    "raw_whois": "--------------------------------------------------\nGenerator: x1.autowhois.com\nRegistry WHOIS: whois.verisign-grs.com\nQuery Time: Sat, 27 Apr 2024 10:35:01 +0000\n--------------------------------------------------\n\nDomain Name: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM\r\nRegistry Domain ID: 1141372440_DOMAIN_COM-VRSN\r\nRegistrar WHOIS Server: whois.godaddy.com\r\nRegistrar URL: http://www.godaddy.com\r\nUpdated Date: 2023-08-10T14:56:48Z\r\nCreation Date: 2007-08-09T07:40:55Z\r\nRegistry Expiry Date: 2024-08-09T07:40:55Z\r\nRegistrar: GoDaddy.com, LLC\r\nRegistrar IANA ID: 146\r\nRegistrar Abuse Contact Email: [email protected]\r\nRegistrar Abuse Contact Phone: 480-624-2505\r\nDomain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited\r\nDomain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited\r\nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\r\nDomain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited\r\nName Server: NS53.DOMAINCONTROL.COM\r\nName Server: NS54.DOMAINCONTROL.COM\r\nDNSSEC: unsigned\r\nURL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/\r\n>>> Last update of whois database: 2024-04-27T10:34:51Z <<<\r\n\r\nFor more information on Whois status codes, please visit https://icann.org/epp\r\n\r\nNOTICE: The expiration date displayed in this record is the date the\r\nregistrar's sponsorship of the domain name registration in the registry is\r\ncurrently set to expire. This date does not necessarily reflect the expiration\r\ndate of the domain name registrant's agreement with the sponsoring\r\nregistrar.  Users may consult the sponsoring registrar's Whois database to\r\nview the registrar's reported date of expiration for this registration.\r\n\r\nTERMS OF USE: You are not authorized to access or query our Whois\r\ndatabase through the use of electronic processes that are high-volume and\r\nautomated except as reasonably necessary to register domain names or\r\nmodify existing registrations; the Data in VeriSign Global Registry\r\nServices' (\"VeriSign\") Whois database is provided by VeriSign for\r\ninformation purposes only, and to assist persons in obtaining information\r\nabout or related to a domain name registration record. VeriSign does not\r\nguarantee its accuracy. By submitting a Whois query, you agree to abide\r\nby the following terms of use: You agree that you may use this Data only\r\nfor lawful purposes and that under no circumstances will you use this Data\r\nto: (1) allow, enable, or otherwise support the transmission of mass\r\nunsolicited, commercial advertising or solicitations via e-mail, telephone,\r\nor facsimile; or (2) enable high volume, automated, electronic processes\r\nthat apply to VeriSign (or its computer systems). The compilation,\r\nrepackaging, dissemination or other use of this Data is expressly\r\nprohibited without the prior written consent of VeriSign. You agree not to\r\nuse electronic processes that are automated and high-volume to access or\r\nquery the Whois database except as reasonably necessary to register\r\ndomain names or modify existing registrations. VeriSign reserves the right\r\nto restrict your access to the Whois database in its sole discretion to ensure\r\noperational stability.  VeriSign may restrict or terminate your access to the\r\nWhois database for failure to abide by these terms of use. VeriSign\r\nreserves the right to modify these terms at any time.\r\n\r\nThe Registry database contains ONLY .COM, .NET, .EDU domains and\r\nRegistrars.\n\n--------------------------------------------------\nRegistrar WHOIS: whois.godaddy.com\nQuery Time: Sat, 27 Apr 2024 10:35:02 +0000\n--------------------------------------------------\n\nDomain Name: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM\r\nRegistry Domain ID: 1141372440_DOMAIN_COM-VRSN\r\nRegistrar WHOIS Server: whois.godaddy.com\r\nRegistrar URL: https://www.godaddy.com\r\nUpdated Date: 2023-08-10T09:56:47Z\r\nCreation Date: 2007-08-09T02:40:55Z\r\nRegistrar Registration Expiration Date: 2024-08-09T02:40:55Z\r\nRegistrar: GoDaddy.com, LLC\r\nRegistrar IANA ID: 146\r\nRegistrar Abuse Contact Email: [email protected]\r\nRegistrar Abuse Contact Phone: +1.4806242505\r\nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\r\nDomain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited\r\nDomain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited\r\nDomain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited\r\nRegistry Registrant ID: Not Available From Registry\r\nRegistrant Name: Registration Private\r\nRegistrant Organization: Domains By Proxy, LLC\r\nRegistrant Street: DomainsByProxy.com\r\nRegistrant Street: 2155 E Warner Rd\r\nRegistrant City: Tempe\r\nRegistrant State/Province: Arizona\r\nRegistrant Postal Code: 85284\r\nRegistrant Country: US\r\nRegistrant Phone: +1.4806242599\r\nRegistrant Phone Ext:\r\nRegistrant Fax: \r\nRegistrant Fax Ext:\r\nRegistrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM\r\nRegistry Admin ID: Not Available From Registry\r\nAdmin Name: Registration Private\r\nAdmin Organization: Domains By Proxy, LLC\r\nAdmin Street: DomainsByProxy.com\r\nAdmin Street: 2155 E Warner Rd\r\nAdmin City: Tempe\r\nAdmin State/Province: Arizona\r\nAdmin Postal Code: 85284\r\nAdmin Country: US\r\nAdmin Phone: +1.4806242599\r\nAdmin Phone Ext:\r\nAdmin Fax: \r\nAdmin Fax Ext:\r\nAdmin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM\r\nRegistry Tech ID: Not Available From Registry\r\nTech Name: Registration Private\r\nTech Organization: Domains By Proxy, LLC\r\nTech Street: DomainsByProxy.com\r\nTech Street: 2155 E Warner Rd\r\nTech City: Tempe\r\nTech State/Province: Arizona\r\nTech Postal Code: 85284\r\nTech Country: US\r\nTech Phone: +1.4806242599\r\nTech Phone Ext:\r\nTech Fax: \r\nTech Fax Ext:\r\nTech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM\r\nName Server: NS53.DOMAINCONTROL.COM\r\nName Server: NS54.DOMAINCONTROL.COM\r\nDNSSEC: unsigned\r\nURL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/\r\n>>> Last update of WHOIS database: 2024-04-27T10:35:04Z <<<\r\nFor more information on Whois status codes, please visit https://icann.org/epp\r\n\r\nTERMS OF USE: The data contained in this registrar's Whois database, while believed by the\r\nregistrar to be reliable, is provided \"as is\" with no guarantee or warranties regarding its\r\naccuracy. This information is provided for the sole purpose of assisting you in obtaining\r\ninformation about domain name registration records. Any use of this data for any other purpose\r\nis expressly forbidden without the prior written permission of this registrar. By submitting\r\nan inquiry, you agree to these terms and limitations of warranty. In particular, you agree not\r\nto use this data to allow, enable, or otherwise support the dissemination or collection of this\r\ndata, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,\r\npostal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations\r\nof any kind, including spam. You further agree not to use this data to enable high volume, automated\r\nor robotic electronic processes designed to collect or compile this data for any purpose, including\r\nmining this data for your own personal or commercial purposes. Failure to comply with these terms\r\nmay result in termination of access to the Whois database. These terms may be subject to modification\r\nat any time without notice."
}
<?xml version="1.0" encoding="UTF-8"?>
<root>
 <status>1</status>
 <domain_name>philadelphiacriminaldefenselawyerblog.com</domain_name>
 <query_time>2024-04-27 10:35:01</query_time>
 <whois_server>whois.godaddy.com</whois_server>
 <domain_registered>yes</domain_registered>
 <create_date>2007-08-09</create_date>
 <update_date>2023-08-10</update_date>
 <expiry_date>2024-08-09</expiry_date>
 <domain_registrar>
  <iana_id>146</iana_id>
  <registrar_name>GoDaddy.com, LLC</registrar_name>
  <whois_server>whois.godaddy.com</whois_server>
  <website_url>https://www.godaddy.com</website_url>
  <email_address>[email protected]</email_address>
  <phone_number>+1.4806242505</phone_number>
 </domain_registrar>
 <registrant_contact>
  <full_name>Registration Private</full_name>
  <company_name>Domains By Proxy, LLC</company_name>
  <mailing_address>DomainsByProxy.com, 2155 E Warner Rd</mailing_address>
  <city_name>Tempe</city_name>
  <state_name>Arizona</state_name>
  <zip_code>85284</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM</email_address>
  <phone_number>+1.4806242599</phone_number>
 </registrant_contact>
 <administrative_contact>
  <full_name>Registration Private</full_name>
  <company_name>Domains By Proxy, LLC</company_name>
  <mailing_address>DomainsByProxy.com, 2155 E Warner Rd</mailing_address>
  <city_name>Tempe</city_name>
  <state_name>Arizona</state_name>
  <zip_code>85284</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM</email_address>
  <phone_number>+1.4806242599</phone_number>
 </administrative_contact>
 <technical_contact>
  <full_name>Registration Private</full_name>
  <company_name>Domains By Proxy, LLC</company_name>
  <mailing_address>DomainsByProxy.com, 2155 E Warner Rd</mailing_address>
  <city_name>Tempe</city_name>
  <state_name>Arizona</state_name>
  <zip_code>85284</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM</email_address>
  <phone_number>+1.4806242599</phone_number>
 </technical_contact>
 <name_servers>
  <value>ns53.domaincontrol.com</value>
  <value>ns54.domaincontrol.com</value>
 </name_servers>
 <domain_status>
  <value>clientDeleteProhibited</value>
  <value>clientRenewProhibited</value>
  <value>clientTransferProhibited</value>
  <value>clientUpdateProhibited</value>
 </domain_status>
 <raw_whois>--------------------------------------------------
Generator: x1.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Sat, 27 Apr 2024 10:35:01 +0000
--------------------------------------------------

Domain Name: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM&#13;
Registry Domain ID: 1141372440_DOMAIN_COM-VRSN&#13;
Registrar WHOIS Server: whois.godaddy.com&#13;
Registrar URL: http://www.godaddy.com&#13;
Updated Date: 2023-08-10T14:56:48Z&#13;
Creation Date: 2007-08-09T07:40:55Z&#13;
Registry Expiry Date: 2024-08-09T07:40:55Z&#13;
Registrar: GoDaddy.com, LLC&#13;
Registrar IANA ID: 146&#13;
Registrar Abuse Contact Email: [email protected]&#13;
Registrar Abuse Contact Phone: 480-624-2505&#13;
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited&#13;
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited&#13;
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited&#13;
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited&#13;
Name Server: NS53.DOMAINCONTROL.COM&#13;
Name Server: NS54.DOMAINCONTROL.COM&#13;
DNSSEC: unsigned&#13;
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/&#13;
&gt;&gt;&gt; Last update of whois database: 2024-04-27T10:34:51Z &lt;&lt;&lt;&#13;
&#13;
For more information on Whois status codes, please visit https://icann.org/epp&#13;
&#13;
NOTICE: The expiration date displayed in this record is the date the&#13;
registrar's sponsorship of the domain name registration in the registry is&#13;
currently set to expire. This date does not necessarily reflect the expiration&#13;
date of the domain name registrant's agreement with the sponsoring&#13;
registrar.  Users may consult the sponsoring registrar's Whois database to&#13;
view the registrar's reported date of expiration for this registration.&#13;
&#13;
TERMS OF USE: You are not authorized to access or query our Whois&#13;
database through the use of electronic processes that are high-volume and&#13;
automated except as reasonably necessary to register domain names or&#13;
modify existing registrations; the Data in VeriSign Global Registry&#13;
Services' (&quot;VeriSign&quot;) Whois database is provided by VeriSign for&#13;
information purposes only, and to assist persons in obtaining information&#13;
about or related to a domain name registration record. VeriSign does not&#13;
guarantee its accuracy. By submitting a Whois query, you agree to abide&#13;
by the following terms of use: You agree that you may use this Data only&#13;
for lawful purposes and that under no circumstances will you use this Data&#13;
to: (1) allow, enable, or otherwise support the transmission of mass&#13;
unsolicited, commercial advertising or solicitations via e-mail, telephone,&#13;
or facsimile; or (2) enable high volume, automated, electronic processes&#13;
that apply to VeriSign (or its computer systems). The compilation,&#13;
repackaging, dissemination or other use of this Data is expressly&#13;
prohibited without the prior written consent of VeriSign. You agree not to&#13;
use electronic processes that are automated and high-volume to access or&#13;
query the Whois database except as reasonably necessary to register&#13;
domain names or modify existing registrations. VeriSign reserves the right&#13;
to restrict your access to the Whois database in its sole discretion to ensure&#13;
operational stability.  VeriSign may restrict or terminate your access to the&#13;
Whois database for failure to abide by these terms of use. VeriSign&#13;
reserves the right to modify these terms at any time.&#13;
&#13;
The Registry database contains ONLY .COM, .NET, .EDU domains and&#13;
Registrars.

--------------------------------------------------
Registrar WHOIS: whois.godaddy.com
Query Time: Sat, 27 Apr 2024 10:35:02 +0000
--------------------------------------------------

Domain Name: PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM&#13;
Registry Domain ID: 1141372440_DOMAIN_COM-VRSN&#13;
Registrar WHOIS Server: whois.godaddy.com&#13;
Registrar URL: https://www.godaddy.com&#13;
Updated Date: 2023-08-10T09:56:47Z&#13;
Creation Date: 2007-08-09T02:40:55Z&#13;
Registrar Registration Expiration Date: 2024-08-09T02:40:55Z&#13;
Registrar: GoDaddy.com, LLC&#13;
Registrar IANA ID: 146&#13;
Registrar Abuse Contact Email: [email protected]&#13;
Registrar Abuse Contact Phone: +1.4806242505&#13;
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited&#13;
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited&#13;
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited&#13;
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited&#13;
Registry Registrant ID: Not Available From Registry&#13;
Registrant Name: Registration Private&#13;
Registrant Organization: Domains By Proxy, LLC&#13;
Registrant Street: DomainsByProxy.com&#13;
Registrant Street: 2155 E Warner Rd&#13;
Registrant City: Tempe&#13;
Registrant State/Province: Arizona&#13;
Registrant Postal Code: 85284&#13;
Registrant Country: US&#13;
Registrant Phone: +1.4806242599&#13;
Registrant Phone Ext:&#13;
Registrant Fax: &#13;
Registrant Fax Ext:&#13;
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM&#13;
Registry Admin ID: Not Available From Registry&#13;
Admin Name: Registration Private&#13;
Admin Organization: Domains By Proxy, LLC&#13;
Admin Street: DomainsByProxy.com&#13;
Admin Street: 2155 E Warner Rd&#13;
Admin City: Tempe&#13;
Admin State/Province: Arizona&#13;
Admin Postal Code: 85284&#13;
Admin Country: US&#13;
Admin Phone: +1.4806242599&#13;
Admin Phone Ext:&#13;
Admin Fax: &#13;
Admin Fax Ext:&#13;
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM&#13;
Registry Tech ID: Not Available From Registry&#13;
Tech Name: Registration Private&#13;
Tech Organization: Domains By Proxy, LLC&#13;
Tech Street: DomainsByProxy.com&#13;
Tech Street: 2155 E Warner Rd&#13;
Tech City: Tempe&#13;
Tech State/Province: Arizona&#13;
Tech Postal Code: 85284&#13;
Tech Country: US&#13;
Tech Phone: +1.4806242599&#13;
Tech Phone Ext:&#13;
Tech Fax: &#13;
Tech Fax Ext:&#13;
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=PHILADELPHIACRIMINALDEFENSELAWYERBLOG.COM&#13;
Name Server: NS53.DOMAINCONTROL.COM&#13;
Name Server: NS54.DOMAINCONTROL.COM&#13;
DNSSEC: unsigned&#13;
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/&#13;
&gt;&gt;&gt; Last update of WHOIS database: 2024-04-27T10:35:04Z &lt;&lt;&lt;&#13;
For more information on Whois status codes, please visit https://icann.org/epp&#13;
&#13;
TERMS OF USE: The data contained in this registrar's Whois database, while believed by the&#13;
registrar to be reliable, is provided &quot;as is&quot; with no guarantee or warranties regarding its&#13;
accuracy. This information is provided for the sole purpose of assisting you in obtaining&#13;
information about domain name registration records. Any use of this data for any other purpose&#13;
is expressly forbidden without the prior written permission of this registrar. By submitting&#13;
an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not&#13;
to use this data to allow, enable, or otherwise support the dissemination or collection of this&#13;
data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,&#13;
postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations&#13;
of any kind, including spam. You further agree not to use this data to enable high volume, automated&#13;
or robotic electronic processes designed to collect or compile this data for any purpose, including&#13;
mining this data for your own personal or commercial purposes. Failure to comply with these terms&#13;
may result in termination of access to the Whois database. These terms may be subject to modification&#13;
at any time without notice.</raw_whois>
</root>

Whois API Demo

Whois Lookup API

You can fetch the above results using our Whois Lookup API.

https://api.whoxy.com/?key=xxxxx&whois=philadelphiacriminaldefenselawyerblog.com

Whois API digs into WHOIS registry referral chains until the correct WHOIS servers are found, for the most complete WHOIS data.
Our WHOIS parser converts WHOIS data into well-structured fields (XML & JSON), which can easily be read by your application.
Whois API supports a total of 2026 Domain Extensions (gTLDs, ccTLDs & new gTLDs), ensuring all domains are supported.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Whois Lookup Pricing Total API Calls Price CPM Purchase
1,000 Whois Lookup API Queries 1,000 $2 $2.00 Order Now
10,000 Whois Lookup API Queries 10,000 $20 $2.00 Order Now
50,000 Whois Lookup API Queries 50,000 $75 $1.50 Order Now
250,000 Whois Lookup API Queries 250,000 $300 $1.20 Order Now
1 Million Whois Lookup API Queries 1,000,000 $1,000 $1.00 Order Now
10 Million Whois Lookup API Queries 10,000,000 $5,000 $0.50 Order Now
25 Million Whois Lookup API Queries 25,000,000 $10,000 $0.40 Order Now

Who owned philadelphiacriminaldefenselawyerblog.com in the past? (2 records)

21 SEP 2016

Name: Registration Private (145 million domains)
Company: Domains By Proxy, LLC (210 million domains)
Email: [email protected]
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns53.domaincontrol.com, ns54.domaincontrol.com
Status: clientDeleteProhibited, clientRenewProhibited, clientTransferProhibited, clientUpdateProhibited

18 OCT 2022

Name: Registration Private (145 million domains)
Company: Domains By Proxy, LLC (210 million domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns53.domaincontrol.com, ns54.domaincontrol.com
Status: clientDeleteProhibited, clientRenewProhibited, clientTransferProhibited, clientUpdateProhibited

Whois History API returns all the historical WHOIS records of a domain name. For more details, please visit https://www.whoxy.com/whois-history/