Keyword: PHILADELPHIACRIMINALDEFENSELAWYER
Reverse Whois » KEYWORD [philadelphiacriminaldefenselawyer ] { 5 domain names }
Num | Domain Name | Registrar | Created | Updated | Expiry |
---|---|---|---|---|---|
1 | philadelphiacriminaldefenselawyer.work | 101domain, Inc. | 30 Jul 2015 | - | 30 Jul 2016 |
2 | philadelphiacriminaldefenselawyer.com | Epik Inc. | 18 Mar 2005 | 30 Apr 2024 | 18 Mar 2024 |
3 | philadelphiacriminaldefenselawyersblog.com | GoDaddy.com, LLC | 5 Oct 2012 | 6 Oct 2023 | 5 Oct 2024 |
4 | philadelphiacriminaldefenselawyerblog.com | GoDaddy.com, LLC | 9 Aug 2007 | 10 Aug 2023 | 9 Aug 2024 |
5 | philadelphiacriminaldefenselawyers.com | GoDaddy.com, LLC | 17 Jun 2005 | 17 Jun 2023 | 17 Jun 2024 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=philadelphiacriminaldefenselawyer
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
---|---|---|---|---|
200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |