Domain: PHILADELPHIACRIMINALDEFENSELAWYERSBLOG.COM
Registrar: GoDaddy.com, LLC (146 million domains)
Query Time: 27 Apr 2024 - 10:38 AM UTC  [12 DAYS BACK] [REFRESH]

Registered: 5^th October 2012  [11 years, 7 months, 4 days back]
Updated: 6^th October 2023  [7 months, 3 days back]
Expiry: 5^th October 2024  [4 months, 26 days left]

DOMAIN STATUS

clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

NAME SERVERS

ns1.westgroup.net
ns2.westgroup.net

REGISTRANT CONTACT

Name: FindLaw Domains (7,695 domains)
Company: FindLaw, Thomson Reuters (18,773 domains)
Address: 610 Opperman Drive
City: Eagan
State: Minnesota
ZIP Code: 55123
Country: United States (231 million domains from United States for $6,250)
Email: [email protected] (7,346 domains)
Phone: +1.6516877000

ADMINISTRATIVE CONTACT

Name: FindLaw Domains (7,695 domains)
Company: FindLaw, Thomson Reuters (18,773 domains)
Address: 610 Opperman Drive
City: Eagan
State: Minnesota
ZIP Code: 55123
Country: United States (231 million domains from United States for $6,250)
Email: [email protected] (7,346 domains)
Phone: +1.6516877000

TECHNICAL CONTACT

Name: FindLaw Domains (7,695 domains)
Company: FindLaw, Thomson Reuters (18,773 domains)
Address: 610 Opperman Drive
City: Eagan
State: Minnesota
ZIP Code: 55123
Country: United States (231 million domains from United States for $6,250)
Email: [email protected] (7,346 domains)
Phone: +1.6516877000

SHARE THIS PAGE

Short URL: whoxy.com/philadelphiacriminaldefenselawyersblog.com
Permalink: https://www.whoxy.com/philadelphiacriminaldefenselawyersblog.com

--------------------------------------------------
Generator: x1.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Sat, 27 Apr 2024 10:38:12 +0000
--------------------------------------------------

Domain Name: PHILADELPHIACRIMINALDEFENSELAWYERSBLOG.COM
Registry Domain ID: 1750225804_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2023-10-06T17:00:44Z
Creation Date: 2012-10-06T04:37:28Z
Registry Expiry Date: 2024-10-06T04:37:28Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.WESTGROUP.NET
Name Server: NS2.WESTGROUP.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2024-04-27T10:37:52Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability.  VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

--------------------------------------------------
Registrar WHOIS: whois.godaddy.com
Query Time: Sat, 27 Apr 2024 10:38:12 +0000
--------------------------------------------------

Domain Name: philadelphiacriminaldefenselawyersblog.com
Registry Domain ID: 1750225804_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: https://www.godaddy.com
Updated Date: 2023-10-06T12:00:43Z
Creation Date: 2012-10-05T23:37:28Z
Registrar Registration Expiration Date: 2024-10-05T23:37:28Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: FindLaw Domains
Registrant Organization: FindLaw, Thomson Reuters
Registrant Street: 610 Opperman Drive
Registrant City: Eagan
Registrant State/Province: Minnesota
Registrant Postal Code: 55123
Registrant Country: US
Registrant Phone: +1.6516877000
Registrant Phone Ext:
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: [email protected]
Registry Admin ID: Not Available From Registry
Admin Name: FindLaw Domains
Admin Organization: FindLaw, Thomson Reuters
Admin Street: 610 Opperman Drive
Admin City: Eagan
Admin State/Province: Minnesota
Admin Postal Code: 55123
Admin Country: US
Admin Phone: +1.6516877000
Admin Phone Ext:
Admin Fax: 
Admin Fax Ext:
Admin Email: [email protected]
Registry Tech ID: Not Available From Registry
Tech Name: FindLaw Domains
Tech Organization: FindLaw, Thomson Reuters
Tech Street: 610 Opperman Drive
Tech City: Eagan
Tech State/Province: Minnesota
Tech Postal Code: 55123
Tech Country: US
Tech Phone: +1.6516877000
Tech Phone Ext:
Tech Fax: 
Tech Fax Ext:
Tech Email: [email protected]
Name Server: NS1.WESTGROUP.NET
Name Server: NS2.WESTGROUP.NET
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-04-27T10:38:13Z <<<
For more information on Whois status codes, please visit https://icann.org/epp

TERMS OF USE: The data contained in this registrar's Whois database, while believed by the
registrar to be reliable, is provided "as is" with no guarantee or warranties regarding its
accuracy. This information is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of this data for any other purpose
is expressly forbidden without the prior written permission of this registrar. By submitting
an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not
to use this data to allow, enable, or otherwise support the dissemination or collection of this
data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,
postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations
of any kind, including spam. You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data for any purpose, including
mining this data for your own personal or commercial purposes. Failure to comply with these terms
may result in termination of access to the Whois database. These terms may be subject to modification
at any time without notice.

{
    "status": 1,
    "domain_name": "philadelphiacriminaldefenselawyersblog.com",
    "query_time": "2024-04-27 10:38:12",
    "whois_server": "whois.godaddy.com",
    "domain_registered": "yes",
    "create_date": "2012-10-05",
    "update_date": "2023-10-06",
    "expiry_date": "2024-10-05",
    "domain_registrar": {
        "iana_id": 146,
        "registrar_name": "GoDaddy.com, LLC",
        "whois_server": "whois.godaddy.com",
        "website_url": "https://www.godaddy.com",
        "email_address": "[email protected]",
        "phone_number": "+1.4806242505"
    },
    "registrant_contact": {
        "full_name": "FindLaw Domains",
        "company_name": "FindLaw, Thomson Reuters",
        "mailing_address": "610 Opperman Drive",
        "city_name": "Eagan",
        "state_name": "Minnesota",
        "zip_code": "55123",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "[email protected]",
        "phone_number": "+1.6516877000"
    },
    "administrative_contact": {
        "full_name": "FindLaw Domains",
        "company_name": "FindLaw, Thomson Reuters",
        "mailing_address": "610 Opperman Drive",
        "city_name": "Eagan",
        "state_name": "Minnesota",
        "zip_code": "55123",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "[email protected]",
        "phone_number": "+1.6516877000"
    },
    "technical_contact": {
        "full_name": "FindLaw Domains",
        "company_name": "FindLaw, Thomson Reuters",
        "mailing_address": "610 Opperman Drive",
        "city_name": "Eagan",
        "state_name": "Minnesota",
        "zip_code": "55123",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "[email protected]",
        "phone_number": "+1.6516877000"
    },
    "name_servers": [
        "ns1.westgroup.net",
        "ns2.westgroup.net"
    ],
    "domain_status": [
        "clientDeleteProhibited",
        "clientRenewProhibited",
        "clientTransferProhibited",
        "clientUpdateProhibited"
    ],
    "raw_whois": "--------------------------------------------------\nGenerator: x1.autowhois.com\nRegistry WHOIS: whois.verisign-grs.com\nQuery Time: Sat, 27 Apr 2024 10:38:12 +0000\n--------------------------------------------------\n\nDomain Name: PHILADELPHIACRIMINALDEFENSELAWYERSBLOG.COM\r\nRegistry Domain ID: 1750225804_DOMAIN_COM-VRSN\r\nRegistrar WHOIS Server: whois.godaddy.com\r\nRegistrar URL: http://www.godaddy.com\r\nUpdated Date: 2023-10-06T17:00:44Z\r\nCreation Date: 2012-10-06T04:37:28Z\r\nRegistry Expiry Date: 2024-10-06T04:37:28Z\r\nRegistrar: GoDaddy.com, LLC\r\nRegistrar IANA ID: 146\r\nRegistrar Abuse Contact Email: [email protected]\r\nRegistrar Abuse Contact Phone: 480-624-2505\r\nDomain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited\r\nDomain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited\r\nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\r\nDomain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited\r\nName Server: NS1.WESTGROUP.NET\r\nName Server: NS2.WESTGROUP.NET\r\nDNSSEC: unsigned\r\nURL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/\r\n>>> Last update of whois database: 2024-04-27T10:37:52Z <<<\r\n\r\nFor more information on Whois status codes, please visit https://icann.org/epp\r\n\r\nNOTICE: The expiration date displayed in this record is the date the\r\nregistrar's sponsorship of the domain name registration in the registry is\r\ncurrently set to expire. This date does not necessarily reflect the expiration\r\ndate of the domain name registrant's agreement with the sponsoring\r\nregistrar.  Users may consult the sponsoring registrar's Whois database to\r\nview the registrar's reported date of expiration for this registration.\r\n\r\nTERMS OF USE: You are not authorized to access or query our Whois\r\ndatabase through the use of electronic processes that are high-volume and\r\nautomated except as reasonably necessary to register domain names or\r\nmodify existing registrations; the Data in VeriSign Global Registry\r\nServices' (\"VeriSign\") Whois database is provided by VeriSign for\r\ninformation purposes only, and to assist persons in obtaining information\r\nabout or related to a domain name registration record. VeriSign does not\r\nguarantee its accuracy. By submitting a Whois query, you agree to abide\r\nby the following terms of use: You agree that you may use this Data only\r\nfor lawful purposes and that under no circumstances will you use this Data\r\nto: (1) allow, enable, or otherwise support the transmission of mass\r\nunsolicited, commercial advertising or solicitations via e-mail, telephone,\r\nor facsimile; or (2) enable high volume, automated, electronic processes\r\nthat apply to VeriSign (or its computer systems). The compilation,\r\nrepackaging, dissemination or other use of this Data is expressly\r\nprohibited without the prior written consent of VeriSign. You agree not to\r\nuse electronic processes that are automated and high-volume to access or\r\nquery the Whois database except as reasonably necessary to register\r\ndomain names or modify existing registrations. VeriSign reserves the right\r\nto restrict your access to the Whois database in its sole discretion to ensure\r\noperational stability.  VeriSign may restrict or terminate your access to the\r\nWhois database for failure to abide by these terms of use. VeriSign\r\nreserves the right to modify these terms at any time.\r\n\r\nThe Registry database contains ONLY .COM, .NET, .EDU domains and\r\nRegistrars.\n\n--------------------------------------------------\nRegistrar WHOIS: whois.godaddy.com\nQuery Time: Sat, 27 Apr 2024 10:38:12 +0000\n--------------------------------------------------\n\nDomain Name: philadelphiacriminaldefenselawyersblog.com\r\nRegistry Domain ID: 1750225804_DOMAIN_COM-VRSN\r\nRegistrar WHOIS Server: whois.godaddy.com\r\nRegistrar URL: https://www.godaddy.com\r\nUpdated Date: 2023-10-06T12:00:43Z\r\nCreation Date: 2012-10-05T23:37:28Z\r\nRegistrar Registration Expiration Date: 2024-10-05T23:37:28Z\r\nRegistrar: GoDaddy.com, LLC\r\nRegistrar IANA ID: 146\r\nRegistrar Abuse Contact Email: [email protected]\r\nRegistrar Abuse Contact Phone: +1.4806242505\r\nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\r\nDomain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited\r\nDomain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited\r\nDomain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited\r\nRegistry Registrant ID: Not Available From Registry\r\nRegistrant Name: FindLaw Domains\r\nRegistrant Organization: FindLaw, Thomson Reuters\r\nRegistrant Street: 610 Opperman Drive\r\nRegistrant City: Eagan\r\nRegistrant State/Province: Minnesota\r\nRegistrant Postal Code: 55123\r\nRegistrant Country: US\r\nRegistrant Phone: +1.6516877000\r\nRegistrant Phone Ext:\r\nRegistrant Fax: \r\nRegistrant Fax Ext:\r\nRegistrant Email: [email protected]\r\nRegistry Admin ID: Not Available From Registry\r\nAdmin Name: FindLaw Domains\r\nAdmin Organization: FindLaw, Thomson Reuters\r\nAdmin Street: 610 Opperman Drive\r\nAdmin City: Eagan\r\nAdmin State/Province: Minnesota\r\nAdmin Postal Code: 55123\r\nAdmin Country: US\r\nAdmin Phone: +1.6516877000\r\nAdmin Phone Ext:\r\nAdmin Fax: \r\nAdmin Fax Ext:\r\nAdmin Email: [email protected]\r\nRegistry Tech ID: Not Available From Registry\r\nTech Name: FindLaw Domains\r\nTech Organization: FindLaw, Thomson Reuters\r\nTech Street: 610 Opperman Drive\r\nTech City: Eagan\r\nTech State/Province: Minnesota\r\nTech Postal Code: 55123\r\nTech Country: US\r\nTech Phone: +1.6516877000\r\nTech Phone Ext:\r\nTech Fax: \r\nTech Fax Ext:\r\nTech Email: [email protected]\r\nName Server: NS1.WESTGROUP.NET\r\nName Server: NS2.WESTGROUP.NET\r\nDNSSEC: unsigned\r\nURL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/\r\n>>> Last update of WHOIS database: 2024-04-27T10:38:13Z <<<\r\nFor more information on Whois status codes, please visit https://icann.org/epp\r\n\r\nTERMS OF USE: The data contained in this registrar's Whois database, while believed by the\r\nregistrar to be reliable, is provided \"as is\" with no guarantee or warranties regarding its\r\naccuracy. This information is provided for the sole purpose of assisting you in obtaining\r\ninformation about domain name registration records. Any use of this data for any other purpose\r\nis expressly forbidden without the prior written permission of this registrar. By submitting\r\nan inquiry, you agree to these terms and limitations of warranty. In particular, you agree not\r\nto use this data to allow, enable, or otherwise support the dissemination or collection of this\r\ndata, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,\r\npostal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations\r\nof any kind, including spam. You further agree not to use this data to enable high volume, automated\r\nor robotic electronic processes designed to collect or compile this data for any purpose, including\r\nmining this data for your own personal or commercial purposes. Failure to comply with these terms\r\nmay result in termination of access to the Whois database. These terms may be subject to modification\r\nat any time without notice."
}

<?xml version="1.0" encoding="UTF-8"?>
<root>
 <status>1</status>
 <domain_name>philadelphiacriminaldefenselawyersblog.com</domain_name>
 <query_time>2024-04-27 10:38:12</query_time>
 <whois_server>whois.godaddy.com</whois_server>
 <domain_registered>yes</domain_registered>
 <create_date>2012-10-05</create_date>
 <update_date>2023-10-06</update_date>
 <expiry_date>2024-10-05</expiry_date>
 <domain_registrar>
  <iana_id>146</iana_id>
  <registrar_name>GoDaddy.com, LLC</registrar_name>
  <whois_server>whois.godaddy.com</whois_server>
  <website_url>https://www.godaddy.com</website_url>
  <email_address>[email protected]</email_address>
  <phone_number>+1.4806242505</phone_number>
 </domain_registrar>
 <registrant_contact>
  <full_name>FindLaw Domains</full_name>
  <company_name>FindLaw, Thomson Reuters</company_name>
  <mailing_address>610 Opperman Drive</mailing_address>
  <city_name>Eagan</city_name>
  <state_name>Minnesota</state_name>
  <zip_code>55123</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>[email protected]</email_address>
  <phone_number>+1.6516877000</phone_number>
 </registrant_contact>
 <administrative_contact>
  <full_name>FindLaw Domains</full_name>
  <company_name>FindLaw, Thomson Reuters</company_name>
  <mailing_address>610 Opperman Drive</mailing_address>
  <city_name>Eagan</city_name>
  <state_name>Minnesota</state_name>
  <zip_code>55123</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>[email protected]</email_address>
  <phone_number>+1.6516877000</phone_number>
 </administrative_contact>
 <technical_contact>
  <full_name>FindLaw Domains</full_name>
  <company_name>FindLaw, Thomson Reuters</company_name>
  <mailing_address>610 Opperman Drive</mailing_address>
  <city_name>Eagan</city_name>
  <state_name>Minnesota</state_name>
  <zip_code>55123</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>[email protected]</email_address>
  <phone_number>+1.6516877000</phone_number>
 </technical_contact>
 <name_servers>
  <value>ns1.westgroup.net</value>
  <value>ns2.westgroup.net</value>
 </name_servers>
 <domain_status>
  <value>clientDeleteProhibited</value>
  <value>clientRenewProhibited</value>
  <value>clientTransferProhibited</value>
  <value>clientUpdateProhibited</value>
 </domain_status>
 <raw_whois>--------------------------------------------------
Generator: x1.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Sat, 27 Apr 2024 10:38:12 +0000
--------------------------------------------------

Domain Name: PHILADELPHIACRIMINALDEFENSELAWYERSBLOG.COM&#13;
Registry Domain ID: 1750225804_DOMAIN_COM-VRSN&#13;
Registrar WHOIS Server: whois.godaddy.com&#13;
Registrar URL: http://www.godaddy.com&#13;
Updated Date: 2023-10-06T17:00:44Z&#13;
Creation Date: 2012-10-06T04:37:28Z&#13;
Registry Expiry Date: 2024-10-06T04:37:28Z&#13;
Registrar: GoDaddy.com, LLC&#13;
Registrar IANA ID: 146&#13;
Registrar Abuse Contact Email: [email protected]&#13;
Registrar Abuse Contact Phone: 480-624-2505&#13;
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited&#13;
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited&#13;
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited&#13;
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited&#13;
Name Server: NS1.WESTGROUP.NET&#13;
Name Server: NS2.WESTGROUP.NET&#13;
DNSSEC: unsigned&#13;
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/&#13;
&gt;&gt;&gt; Last update of whois database: 2024-04-27T10:37:52Z &lt;&lt;&lt;&#13;
&#13;
For more information on Whois status codes, please visit https://icann.org/epp&#13;
&#13;
NOTICE: The expiration date displayed in this record is the date the&#13;
registrar's sponsorship of the domain name registration in the registry is&#13;
currently set to expire. This date does not necessarily reflect the expiration&#13;
date of the domain name registrant's agreement with the sponsoring&#13;
registrar.  Users may consult the sponsoring registrar's Whois database to&#13;
view the registrar's reported date of expiration for this registration.&#13;
&#13;
TERMS OF USE: You are not authorized to access or query our Whois&#13;
database through the use of electronic processes that are high-volume and&#13;
automated except as reasonably necessary to register domain names or&#13;
modify existing registrations; the Data in VeriSign Global Registry&#13;
Services' (&quot;VeriSign&quot;) Whois database is provided by VeriSign for&#13;
information purposes only, and to assist persons in obtaining information&#13;
about or related to a domain name registration record. VeriSign does not&#13;
guarantee its accuracy. By submitting a Whois query, you agree to abide&#13;
by the following terms of use: You agree that you may use this Data only&#13;
for lawful purposes and that under no circumstances will you use this Data&#13;
to: (1) allow, enable, or otherwise support the transmission of mass&#13;
unsolicited, commercial advertising or solicitations via e-mail, telephone,&#13;
or facsimile; or (2) enable high volume, automated, electronic processes&#13;
that apply to VeriSign (or its computer systems). The compilation,&#13;
repackaging, dissemination or other use of this Data is expressly&#13;
prohibited without the prior written consent of VeriSign. You agree not to&#13;
use electronic processes that are automated and high-volume to access or&#13;
query the Whois database except as reasonably necessary to register&#13;
domain names or modify existing registrations. VeriSign reserves the right&#13;
to restrict your access to the Whois database in its sole discretion to ensure&#13;
operational stability.  VeriSign may restrict or terminate your access to the&#13;
Whois database for failure to abide by these terms of use. VeriSign&#13;
reserves the right to modify these terms at any time.&#13;
&#13;
The Registry database contains ONLY .COM, .NET, .EDU domains and&#13;
Registrars.

--------------------------------------------------
Registrar WHOIS: whois.godaddy.com
Query Time: Sat, 27 Apr 2024 10:38:12 +0000
--------------------------------------------------

Domain Name: philadelphiacriminaldefenselawyersblog.com&#13;
Registry Domain ID: 1750225804_DOMAIN_COM-VRSN&#13;
Registrar WHOIS Server: whois.godaddy.com&#13;
Registrar URL: https://www.godaddy.com&#13;
Updated Date: 2023-10-06T12:00:43Z&#13;
Creation Date: 2012-10-05T23:37:28Z&#13;
Registrar Registration Expiration Date: 2024-10-05T23:37:28Z&#13;
Registrar: GoDaddy.com, LLC&#13;
Registrar IANA ID: 146&#13;
Registrar Abuse Contact Email: [email protected]&#13;
Registrar Abuse Contact Phone: +1.4806242505&#13;
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited&#13;
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited&#13;
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited&#13;
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited&#13;
Registry Registrant ID: Not Available From Registry&#13;
Registrant Name: FindLaw Domains&#13;
Registrant Organization: FindLaw, Thomson Reuters&#13;
Registrant Street: 610 Opperman Drive&#13;
Registrant City: Eagan&#13;
Registrant State/Province: Minnesota&#13;
Registrant Postal Code: 55123&#13;
Registrant Country: US&#13;
Registrant Phone: +1.6516877000&#13;
Registrant Phone Ext:&#13;
Registrant Fax: &#13;
Registrant Fax Ext:&#13;
Registrant Email: [email protected]&#13;
Registry Admin ID: Not Available From Registry&#13;
Admin Name: FindLaw Domains&#13;
Admin Organization: FindLaw, Thomson Reuters&#13;
Admin Street: 610 Opperman Drive&#13;
Admin City: Eagan&#13;
Admin State/Province: Minnesota&#13;
Admin Postal Code: 55123&#13;
Admin Country: US&#13;
Admin Phone: +1.6516877000&#13;
Admin Phone Ext:&#13;
Admin Fax: &#13;
Admin Fax Ext:&#13;
Admin Email: [email protected]&#13;
Registry Tech ID: Not Available From Registry&#13;
Tech Name: FindLaw Domains&#13;
Tech Organization: FindLaw, Thomson Reuters&#13;
Tech Street: 610 Opperman Drive&#13;
Tech City: Eagan&#13;
Tech State/Province: Minnesota&#13;
Tech Postal Code: 55123&#13;
Tech Country: US&#13;
Tech Phone: +1.6516877000&#13;
Tech Phone Ext:&#13;
Tech Fax: &#13;
Tech Fax Ext:&#13;
Tech Email: [email protected]&#13;
Name Server: NS1.WESTGROUP.NET&#13;
Name Server: NS2.WESTGROUP.NET&#13;
DNSSEC: unsigned&#13;
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/&#13;
&gt;&gt;&gt; Last update of WHOIS database: 2024-04-27T10:38:13Z &lt;&lt;&lt;&#13;
For more information on Whois status codes, please visit https://icann.org/epp&#13;
&#13;
TERMS OF USE: The data contained in this registrar's Whois database, while believed by the&#13;
registrar to be reliable, is provided &quot;as is&quot; with no guarantee or warranties regarding its&#13;
accuracy. This information is provided for the sole purpose of assisting you in obtaining&#13;
information about domain name registration records. Any use of this data for any other purpose&#13;
is expressly forbidden without the prior written permission of this registrar. By submitting&#13;
an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not&#13;
to use this data to allow, enable, or otherwise support the dissemination or collection of this&#13;
data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,&#13;
postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations&#13;
of any kind, including spam. You further agree not to use this data to enable high volume, automated&#13;
or robotic electronic processes designed to collect or compile this data for any purpose, including&#13;
mining this data for your own personal or commercial purposes. Failure to comply with these terms&#13;
may result in termination of access to the Whois database. These terms may be subject to modification&#13;
at any time without notice.</raw_whois>
</root>