With support for 
Keyword: YASH
Reverse Whois » KEYWORD [yash ] { 20,886 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | yash.com | GoDaddy.com, LLC | 12 Aug 1996 | 30 Oct 2022 | 11 Aug 2030 |
| 2 | yash.info | - | 22 Dec 2003 | 29 Apr 2025 | 22 Dec 2025 |
| 3 | yash.biz | GoDaddy.com, LLC | 10 Dec 2015 | 25 Nov 2024 | 9 Dec 2025 |
| 4 | yash.xyz | NameCheap, Inc. | 23 Nov 2015 | 25 Nov 2024 | 23 Nov 2026 |
| 5 | yash.tools | GoDaddy.com, LLC | 3 Aug 2022 | 14 Sep 2024 | 3 Aug 2024 |
| 6 | yash.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jun 2018 | 13 Aug 2018 | 13 Jun 2019 |
| 7 | yash.global | GoDaddy.com, LLC | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 8 | yash.wales | 1&1 Internet AG | 6 Mar 2015 | 6 Mar 2017 | 6 Mar 2018 |
| 9 | yash.cymru | 1&1 Internet AG | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 10 | yash.science | NameCheap, Inc. | 8 Mar 2024 | 23 Mar 2025 | 8 Mar 2025 |
| 11 | yash.work | NameCheap, Inc. | 30 Jul 2025 | 30 Jul 2025 | 30 Jul 2026 |
| 12 | yash.one | NameCheap, Inc. | 25 May 2020 | 9 Jun 2025 | 25 May 2025 |
| 13 | yash.rocks | - | 19 Oct 2024 | - | 19 Oct 2025 |
| 14 | yash.club | GoDaddy.com, LLC | 2 Jun 2018 | 14 Jul 2024 | 2 Jun 2024 |
| 15 | yash.party | Alpnames Limited | 7 May 2015 | - | 6 May 2016 |
| 16 | yash.us | Google, Inc. | 23 May 2015 | 11 Mar 2017 | 22 May 2018 |
| 17 | yash.events | GoDaddy.com, LLC | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 18 | yash.pics | united-domains AG | 11 Dec 2015 | 7 Aug 2025 | 11 Dec 2025 |
| 19 | yash.properties | GoDaddy.com, LLC | 29 Feb 2024 | 11 Apr 2025 | 28 Feb 2025 |
| 20 | yash.date | Porkbun, LLC | 17 Aug 2025 | 17 Aug 2025 | 17 Aug 2026 |
| 21 | yash.associates | GoDaddy.com, LLC | 8 Feb 2016 | 8 Feb 2016 | 8 Feb 2017 |
| 22 | yash.tech | GoDaddy.com, LLC | 9 Feb 2016 | 9 Feb 2016 | 9 Feb 2017 |
| 23 | yash.top | NameCheap, Inc. | 18 Oct 2022 | 18 Oct 2022 | 18 Oct 2025 |
| 24 | yash.red | West263 International Limited | 23 Feb 2016 | - | 23 Feb 2017 |
| 25 | yash.bid | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Feb 2016 | - | 22 Feb 2017 |
| 26 | yash.enterprises | GoDaddy.com, LLC | 10 May 2024 | 13 May 2025 | 10 May 2026 |
| 27 | yash.kim | Alpnames Limited | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 28 | yash.vip | - | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 29 | yash.design | Google, Inc. | 8 Apr 2022 | 26 Jun 2025 | 8 Apr 2026 |
| 30 | yash.in | - | 16 Feb 2005 | 19 Feb 2025 | 16 Feb 2026 |
| 31 | yash.guru | NameKing.com Inc. | 18 Oct 2024 | 28 Feb 2025 | 18 Oct 2025 |
| 32 | yash.photography | BigRock Solutions Ltd. | 27 Feb 2014 | 3 Feb 2025 | 27 Feb 2026 |
| 33 | yash.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 22 Oct 2015 | - | 22 Oct 2016 |
| 34 | yash.tel | Name.com, Inc. | 10 Sep 2021 | 14 Sep 2024 | 10 Sep 2026 |
| 35 | yash.accountant | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Oct 2016 | 10 Oct 2017 | 9 Oct 2017 |
| 36 | yash.net | NameCheap, Inc. | 10 Dec 2001 | 31 Jul 2024 | 10 Dec 2029 |
| 37 | yash.org | eNom, Inc. | 7 Jan 2000 | 19 Aug 2024 | 7 Jan 2026 |
| 38 | yash.consulting | One.com A/S | 28 Jan 2025 | 2 Feb 2025 | 28 Jan 2026 |
| 39 | yash.it | - | 15 Apr 2015 | 16 May 2025 | 30 Apr 2026 |
| 40 | yash.business | Hostinger, UAB | 8 Jan 2025 | 31 May 2025 | 8 Jan 2026 |
| 41 | yash.world | CommuniGal Communication Ltd. | - | - | 26 Sep 2025 |
| 42 | yash.pro | DomainPeople, Inc. | 20 Apr 2009 | 13 Jun 2025 | - |
| 43 | yash.news | GoDaddy.com, LLC | 6 Aug 2017 | 6 Aug 2017 | 6 Aug 2019 |
| 44 | yash.money | Wild West Domains, LLC | 21 Aug 2017 | 21 Aug 2017 | 21 Aug 2018 |
| 45 | yash.ltd | GoDaddy.com, LLC | 22 May 2024 | 2 Aug 2025 | 22 May 2025 |
| 46 | yash.solutions | GoDaddy.com, LLC | 21 Jun 2023 | 2 Aug 2024 | 21 Jun 2024 |
| 47 | yash.coach | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Dec 2017 | 2 Dec 2017 | 2 Dec 2018 |
| 48 | yash.co.uk | - | 22 Apr 2010 | 23 May 2025 | 22 Apr 2026 |
| 49 | yash.ca | - | 8 May 2018 | 13 May 2018 | 8 May 2019 |
| 50 | yash.ma | - | 7 Nov 2014 | 10 Oct 2017 | 7 Nov 2018 |
| 51 | yash.media | NameKing.com Inc. | 21 Oct 2024 | 28 Feb 2025 | 21 Oct 2025 |
| 52 | yash.dev | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Feb 2019 | 4 Feb 2025 | 28 Feb 2026 |
| 53 | yash.cloud | Nimzo 98, LLC | 10 Aug 2019 | 10 Aug 2019 | 10 Aug 2020 |
| 54 | yash.land | Nimzo 98, LLC | 1 Jun 2022 | 1 Jun 2022 | 1 Jun 2023 |
| 55 | yash.email | Name.com, Inc. | 5 Sep 2025 | 5 Sep 2025 | 5 Sep 2026 |
| 56 | yash.fitness | BigRock Solutions Ltd. | 16 Dec 2019 | 1 Jan 2020 | 16 Dec 2020 |
| 57 | yash.codes | GoDaddy.com, LLC | 28 Sep 2024 | 3 Oct 2024 | 28 Sep 2025 |
| 58 | yash.tatar | Limited Liability Company "Registrar of domain nam… | 12 Dec 2018 | 10 Oct 2021 | 12 Dec 2025 |
| 59 | yash.life | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Dec 2022 | 19 Apr 2024 | 10 Dec 2025 |
| 60 | yash.works | Google, Inc. | 21 May 2020 | 3 Jun 2025 | 21 May 2026 |
| 61 | yash.wtf | - | 21 Dec 2023 | 19 Dec 2024 | 21 Dec 2024 |
| 62 | yash.gold | NameCheap, Inc. | 30 Oct 2021 | 30 Oct 2021 | 30 Oct 2022 |
| 63 | yash.host | Hostinger, UAB | 11 Nov 2023 | 25 Dec 2024 | 11 Nov 2024 |
| 64 | yash.team | 1&1 Internet AG | 11 Feb 2025 | 12 Apr 2025 | 11 Feb 2026 |
| 65 | yash.co | GoDaddy.com, LLC | 30 Jul 2010 | 27 Jun 2025 | 29 Jul 2026 |
| 66 | yash.win | Porkbun, LLC | 15 Mar 2021 | 17 Dec 2021 | 15 Mar 2031 |
| 67 | yash.study | Porkbun, LLC | 3 Apr 2021 | 3 Apr 2021 | 3 Apr 2022 |
| 68 | yash.store | - | 6 Dec 2024 | 25 Dec 2024 | 6 Dec 2025 |
| 69 | yash.digital | GoDaddy.com, LLC | 31 Jul 2025 | 31 Jul 2025 | 31 Jul 2026 |
| 70 | yash.network | 1&1 Internet AG | 11 Feb 2025 | 12 Apr 2025 | 11 Feb 2026 |
| 71 | yash.chat | Google, Inc. | 2 Feb 2022 | 4 Feb 2022 | 2 Feb 2023 |
| 72 | yash.run | NameCheap, Inc. | 9 Feb 2022 | 9 Feb 2022 | 9 Feb 2023 |
| 73 | yash.gifts | NameCheap, Inc. | 24 Apr 2022 | 5 Jul 2023 | 24 Apr 2023 |
| 74 | yash.fans | NameCheap, Inc. | 24 Apr 2022 | 5 Jul 2023 | 24 Apr 2023 |
| 75 | yash.or.id | - | 23 Oct 2018 | 7 Dec 2021 | 23 Oct 2022 |
| 76 | yash.services | GoDaddy.com, LLC | 8 Aug 2023 | 19 Oct 2024 | 8 Aug 2024 |
| 77 | yash.ws | GoDaddy.com, LLC | 31 Oct 2022 | 30 Oct 2023 | 31 Oct 2024 |
| 78 | yash.org.in | - | 11 Aug 2023 | 13 Aug 2025 | 11 Aug 2026 |
| 79 | yash.group | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Oct 2023 | 12 Sep 2024 | 26 Oct 2025 |
| 80 | yash.vc | NameCheap, Inc. | 30 Oct 2020 | 11 Dec 2024 | 30 Oct 2024 |
| 81 | yash.fyi | Google, Inc. | 21 Nov 2022 | 3 Jun 2025 | 21 Nov 2025 |
| 82 | yash.today | Tucows Domains Inc. | 29 Jun 2025 | 29 Jun 2025 | 29 Jun 2026 |
| 83 | yash.engineer | Google, Inc. | 1 Jul 2025 | 1 Jul 2025 | 1 Jul 2028 |
| 84 | yash.technology | GoDaddy.com, LLC | 3 Oct 2024 | 8 Oct 2024 | 3 Oct 2025 |
| 85 | yash.agency | GoDaddy.com, LLC | 4 Jan 2023 | 6 Mar 2024 | 4 Jan 2024 |
| 86 | yash.app | 1API GmbH | 22 Oct 2020 | 10 Jul 2024 | 22 Oct 2025 |
| 87 | yash.best | NameCheap, Inc. | 18 Oct 2022 | 12 Nov 2024 | 18 Oct 2025 |
| 88 | yash.bio | CommuniGal Communication Ltd. | 11 May 2025 | 16 May 2025 | 11 May 2026 |
| 89 | yash.actor | NameCheap, Inc. | 24 Apr 2022 | 5 Jul 2023 | 24 Apr 2023 |
| 90 | yash.systems | Name.com, Inc. | 26 Jan 2023 | 9 Mar 2024 | 26 Jan 2024 |
| 91 | yash.cash | Google, Inc. | 21 Jun 2017 | 21 Jun 2023 | 21 Jun 2024 |
| 92 | yash.click | Amazon Registrar, Inc. | 25 Jun 2025 | 25 Jun 2025 | 25 Jun 2026 |
| 93 | yash.za.com | NameKing.com Inc. | 3 Aug 2022 | 8 Aug 2022 | 3 Aug 2024 |
| 94 | yash.ai | - | - | - | - |
| 95 | yash.page | Porkbun, LLC | 26 Mar 2023 | 9 Feb 2025 | 26 Mar 2026 |
| 96 | yash.xin | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 Aug 2017 | 30 Aug 2023 | 29 Aug 2024 |
| 97 | yash.fun | Hostinger, UAB | 24 Oct 2024 | 29 Oct 2024 | 24 Oct 2025 |
| 98 | yash.games | GoDaddy.com, LLC | 27 Jun 2017 | 2 Jul 2025 | 27 Jun 2026 |
| 99 | yash.im | - | - | - | 4 Nov 2026 |
| 100 | yash.co.in | - | 16 Feb 2005 | 19 Feb 2025 | 16 Feb 2026 |
| 101 | yash.io | NameCheap, Inc. | 13 Mar 2019 | 27 Apr 2025 | 13 Mar 2026 |
| 102 | yash.live | NameCheap, Inc. | 24 Apr 2022 | 9 May 2023 | 24 Apr 2024 |
| 103 | yash.link | Hostinger, UAB | 12 May 2022 | 21 Apr 2025 | 12 May 2026 |
| 104 | yash.co.jp | - | 24 Mar 1999 | 1 Apr 2025 | - |
| 105 | yash.ninja | Name.com, Inc. | 21 Jun 2022 | 2 Sep 2023 | 21 Jun 2023 |
| 106 | yash.nl | - | 18 Feb 2011 | 24 Apr 2023 | - |
| 107 | yash.ink | NameCheap, Inc. | 24 Apr 2023 | 9 May 2025 | 24 Apr 2025 |
| 108 | yash.uk | - | 23 Oct 2024 | 5 Nov 2024 | 23 Oct 2025 |
| 109 | yash.social | Hostinger, UAB | 22 Oct 2024 | 27 Oct 2024 | 22 Oct 2025 |
| 110 | yash.lol | Porkbun, LLC | 8 Apr 2025 | 12 May 2025 | 8 Apr 2026 |
| 111 | yash.studio | NameCheap, Inc. | 13 May 2022 | 5 May 2025 | 13 May 2026 |
| 112 | yash.beauty | GoDaddy.com, LLC | 12 Oct 2023 | 23 Dec 2024 | 12 Oct 2024 |
| 113 | yash.wiki | NameCheap, Inc. | 26 Aug 2025 | 26 Aug 2025 | 26 Aug 2026 |
| 114 | yash.homes | Google, Inc. | 18 Oct 2023 | 29 May 2025 | 18 Oct 2025 |
| 115 | yash.boo | GoDaddy.com, LLC | 27 Oct 2023 | 7 Jan 2025 | 27 Oct 2024 |
| 116 | yash.asia | 1&1 Internet AG | 11 Feb 2025 | 12 Apr 2025 | 11 Feb 2026 |
| 117 | yash.cool | NameCheap, Inc. | 3 Dec 2023 | 15 Jan 2025 | 3 Dec 2024 |
| 118 | yash.ing | GoDaddy.com, LLC | 6 Dec 2023 | 20 Jan 2025 | 6 Dec 2025 |
| 119 | yash.box | Namesilo, LLC | 24 Jan 2024 | 29 Mar 2025 | 24 Jan 2025 |
| 120 | yash.software | NameCheap, Inc. | 3 Mar 2024 | 17 Apr 2025 | 3 Mar 2026 |
| 121 | yash.shop | NameKing.com Inc. | 10 Jul 2023 | 24 Aug 2024 | 10 Jul 2024 |
| 122 | yash.fr | - | 17 Feb 2023 | 11 Feb 2025 | 17 Feb 2026 |
| 123 | yash.ru | - | 30 May 2006 | - | 30 May 2026 |
| 124 | yash.press | Hostinger, UAB | 7 May 2024 | 8 May 2025 | 7 May 2026 |
| 125 | yash.support | GoDaddy.com, LLC | 23 May 2024 | 3 Aug 2025 | 23 May 2025 |
| 126 | yash.de | - | - | 26 Sep 2023 | - |
| 127 | yash.realtor | Name Share, Inc. | 11 Jul 2024 | 11 Jul 2024 | 11 Jul 2025 |
| 128 | yash.ag | Name.com, Inc. | 5 Jan 2021 | 19 Feb 2025 | 5 Jan 2026 |
| 129 | yash.so | NameCheap, Inc. | 13 Jul 2022 | 17 Jul 2025 | 13 Jul 2026 |
| 130 | yash.skin | GoDaddy.com, LLC | 23 Oct 2024 | 25 Nov 2024 | 23 Oct 2025 |
| 131 | yash.se | - | 12 Oct 2016 | 10 Oct 2024 | 12 Oct 2025 |
| 132 | yash.nyc | NameCheap, Inc. | 1 Feb 2025 | 6 Feb 2025 | 1 Feb 2026 |
| 133 | yash.community | 1&1 Internet AG | 11 Feb 2025 | 12 Apr 2025 | 11 Feb 2026 |
| 134 | yash.gallery | 1&1 Internet AG | 11 Feb 2025 | 12 Apr 2025 | 11 Feb 2026 |
| 135 | yash.contact | Name.com, Inc. | 5 Mar 2025 | 10 Mar 2025 | 5 Mar 2026 |
| 136 | yash.zip | - | 17 Mar 2025 | 5 May 2025 | 17 Mar 2026 |
| 137 | yash.blog | NameCheap, Inc. | 19 May 2025 | 18 Jul 2025 | 19 May 2026 |
| 138 | yash.pl | - | 14 Mar 2011 | 22 Feb 2025 | 14 Mar 2026 |
| 139 | yash.build | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jun 2025 | 24 Jul 2025 | 16 Jun 2026 |
| 140 | yash.careers | Name.com, Inc. | 9 Jul 2025 | 9 Jul 2025 | 9 Jul 2026 |
| 141 | yash.diy | GoDaddy.com, LLC | 16 Aug 2025 | 16 Aug 2025 | 16 Aug 2026 |
| 142 | yash.industries | GoDaddy.com, LLC | 18 Aug 2025 | 18 Aug 2025 | 18 Aug 2027 |
| 143 | yash.help | Hostinger, UAB | 6 Sep 2025 | 6 Sep 2025 | 6 Sep 2026 |
| 144 | yashodahospitals.com | Google, Inc. | 22 Mar 2000 | 23 Mar 2025 | 22 Mar 2026 |
| 145 | yashrajfilms.com | GoDaddy.com, LLC | 28 May 1997 | 5 Mar 2025 | 27 May 2026 |
| 146 | yashesaplama.com | CloudFlare, Inc. | 29 Oct 2007 | 28 Nov 2024 | 29 Oct 2025 |
| 147 | yashili.com | Beijing Guoxu Network Technology Co., Ltd. | 10 Mar 2000 | 22 Oct 2024 | 10 Mar 2026 |
| 148 | yashoku-ramen.jp | - | 24 Dec 2009 | 3 Apr 2012 | 31 Dec 2012 |
| 149 | yashamm.com | Eranet International Limited | 31 Oct 2018 | 6 Oct 2024 | 31 Oct 2025 |
| 150 | yashanet.com | DNC Holdings, Inc. | 20 Nov 1995 | 29 Oct 2024 | 19 Nov 2026 |
| 151 | yashilongcn.com | Web Commerce Communications Limited dba WebNic.cc | 4 Aug 2019 | 4 Aug 2019 | 4 Aug 2020 |
| 152 | yashinquesada.com | GoDaddy.com, LLC | 17 Feb 2009 | 19 Jan 2025 | 17 Feb 2026 |
| 153 | yashvinblogs.com | NameCheap, Inc. | 28 Sep 2008 | 14 Aug 2023 | 28 Sep 2025 |
| 154 | yashtechlabs.com | GoDaddy.com, LLC | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 155 | yashiqiluoliao.com | Xin Net Technology Corporation | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 156 | yashhshah.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 157 | yashima-artvillage.info | GMO Internet Inc. | 19 Oct 2014 | 21 Aug 2023 | 19 Oct 2026 |
| 158 | yashilchat.com | Realtime Register B.V. | 22 Oct 2014 | 23 Oct 2015 | 22 Oct 2016 |
| 159 | yashanyang.com | Xin Net Technology Corporation | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 160 | yashi.com | CSC Corporate Domains, Inc. | 18 Jan 1996 | 29 Mar 2025 | 2 Apr 2026 |
| 161 | yashima.ac.jp | Japan Registry Services Co., Ltd. | 8 May 1997 | 1 Jun 2014 | - |
| 162 | yashimasangyo.com | GMO Internet Inc. | 19 Apr 2000 | 24 Mar 2025 | 19 Apr 2026 |
| 163 | yashirleumi.co.il | - | - | 29 Jul 2014 | 16 Apr 2019 |
| 164 | yashodahospital.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2008 | 27 May 2025 | 27 May 2026 |
| 165 | yashodharalal.com | GoDaddy.com, LLC | 27 Feb 2012 | 28 Feb 2024 | 27 Feb 2029 |
| 166 | yashry.com | Amazon Registrar, Inc. | 16 Jul 2013 | 11 Jun 2025 | 16 Jul 2026 |
| 167 | yashtel.in | - | 27 Dec 2007 | 3 Mar 2025 | 27 Dec 2026 |
| 168 | yashwantnaik.com | Nordreg AB | 22 Aug 2025 | 22 Aug 2025 | 22 Aug 2026 |
| 169 | yashilvatan.ir | - | - | - | - |
| 170 | yashio.lg.jp | - | - | - | - |
| 171 | yashiweb.com | Register.it SPA | 24 Dec 2009 | 30 Jan 2025 | 28 Dec 2025 |
| 172 | yashop.ru | - | 28 Sep 2021 | - | 28 Sep 2025 |
| 173 | yashoid.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 22 Oct 2012 | 24 Oct 2019 | 22 Oct 2020 |
| 174 | yashilinaifen.com | HiChina Zhicheng Technology Limited | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 175 | yashilimilk.com | HiChina Zhicheng Technology Limited | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 176 | yashiika.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2016 |
| 177 | yashengjt.com | GoDaddy.com, LLC | 20 Feb 2019 | 20 Feb 2019 | 20 Feb 2020 |
| 178 | yashbirlagroup.com | GoDaddy.com, LLC | 28 Dec 1999 | 3 Jan 2023 | 28 Dec 2025 |
| 179 | yashowin.com | GoDaddy.com, LLC | 19 May 2015 | 19 May 2015 | 19 May 2016 |
| 180 | yashilanxiang.com | GoDaddy.com, LLC | 4 Nov 2019 | 4 Nov 2019 | 4 Nov 2020 |
| 181 | yashashree.com | NameCheap, Inc. | 19 Feb 2020 | 20 Jan 2025 | 19 Feb 2026 |
| 182 | yashik.tv | Dynadot, LLC | 2 Feb 2023 | 20 Jan 2025 | 2 Feb 2026 |
| 183 | yashikera.com | BigRock Solutions Ltd. | 6 Jun 2015 | 6 Jun 2015 | 6 Jun 2016 |
| 184 | yashmazoloto.com | DROPCATCH.COM 762 LLC | 9 May 2022 | 11 Apr 2025 | 9 May 2026 |
| 185 | yashnaescorts.com | - | 11 Sep 2024 | 30 Oct 2024 | 11 Sep 2025 |
| 186 | yashmodels.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2024 | 20 Aug 2025 |
| 187 | yashretail.com | Google, Inc. | 4 Jul 2012 | 4 Jun 2024 | 4 Jul 2029 |
| 188 | yashao.net | GoDaddy.com, LLC | 27 Apr 2020 | 7 Jun 2025 | 27 Apr 2025 |
| 189 | yashla.com | GoDaddy.com, LLC | 15 May 2025 | 15 May 2025 | 15 May 2026 |
| 190 | yashsurpur.com | Network Solutions, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 191 | yashionzhn.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2016 |
| 192 | yashimitation.com | GoDaddy.com, LLC | 4 Sep 2019 | 4 Sep 2019 | 4 Sep 2020 |
| 193 | yasha.me | Key-Systems GmbH | 27 Jul 2025 | 1 Aug 2025 | 27 Jul 2026 |
| 194 | yasheducation.com | TurnCommerce, Inc. DBA NameBright.com | 8 Feb 2022 | 24 Aug 2022 | 8 Feb 2026 |
| 195 | yashviprojects.com | GoDaddy.com, LLC | 30 May 2014 | 31 May 2015 | 30 May 2016 |
| 196 | yasharfakhari.com | GoDaddy.com, LLC | 30 May 2013 | 31 May 2015 | 30 May 2016 |
| 197 | yashsurpur.net | BigRock Solutions Ltd. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 198 | yashrajtravelsonline.net | BigRock Solutions Ltd. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 199 | yashitong.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 Oct 2009 | 9 Sep 2024 | 23 Oct 2025 |
| 200 | yashinstitute.com | GoDaddy.com, LLC | 9 Apr 2024 | 29 Sep 2024 | 9 Apr 2027 |
| 201 | yashengmm.com | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 202 | yashashrriclasses.com | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2017 |
| 203 | yashboutique.com | Hostinger, UAB | 5 Apr 2025 | 5 Jun 2025 | 5 Apr 2026 |
| 204 | yashyyldyrym.com | GoDaddy.com, LLC | 2 Jun 2013 | 3 Jun 2015 | 2 Jun 2016 |
| 205 | yashica.info | GoDaddy.com, LLC | 21 Nov 2023 | 27 Apr 2025 | 21 Nov 2025 |
| 206 | yashoday.com | Hostinger, UAB | 17 Aug 2025 | 17 Aug 2025 | 17 Aug 2027 |
| 207 | yashashgaurav.com | NameCheap, Inc. | 29 Dec 2021 | 29 Nov 2024 | 29 Dec 2025 |
| 208 | yashphotoshop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jan 2016 | 20 Jan 2016 | 20 Jan 2017 |
| 209 | yashoswal.com | GoDaddy.com, LLC | 25 Mar 2019 | 25 Mar 2019 | 25 Mar 2020 |
| 210 | yashitz.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 9 Jun 2025 | 11 Jun 2025 | 9 Jun 2026 |
| 211 | yashal.com | DropCatch.com 494 LLC | 21 Jul 2025 | 21 Jul 2025 | 21 Jul 2026 |
| 212 | yashexpeditions.com | GoDaddy.com, LLC | 31 Dec 2020 | 31 Dec 2020 | 31 Dec 2021 |
| 213 | yashhrajtowers.com | GoDaddy.com, LLC | 23 May 2014 | 24 May 2015 | 23 May 2016 |
| 214 | yashudan.com | eName Technology Co., Ltd. | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 215 | yashpal91.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 216 | yashkuratova.com | CJSC Registrar R01 | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 217 | yashitianxia.com | Xin Net Technology Corporation | 24 Oct 2013 | 28 Oct 2014 | 24 Oct 2015 |
| 218 | yashilyo.com | Vautron Rechenzentrum AG | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 219 | yashikaenterprises.com | GoDaddy.com, LLC | 18 Apr 2025 | 18 Apr 2025 | 18 Apr 2028 |
| 220 | yashikaclasses.com | GoDaddy.com, LLC | 10 Feb 2016 | 10 Feb 2016 | 10 Feb 2017 |
| 221 | yashholidayz.com | GoDaddy.com, LLC | 13 Jun 2016 | 13 Jun 2016 | 13 Jun 2017 |
| 222 | yashgfx.com | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 25 Mar 2022 | 5 Jun 2023 | 25 Mar 2023 |
| 223 | yashgarments.com | GoDaddy.com, LLC | 24 Jan 2023 | 5 Feb 2024 | 24 Jan 2025 |
| 224 | yashfinconbpo.com | Jiangsu Bangning Science and technology Co. Ltd. | 16 Jan 2022 | 16 Jan 2022 | 16 Jan 2023 |
| 225 | yashawantghaisas.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 226 | yashas.com | eNom, Inc. | 17 May 2009 | 26 May 2025 | 17 May 2026 |
| 227 | yashry.net | GoDaddy.com, LLC | 8 May 2025 | 8 May 2025 | 8 May 2028 |
| 228 | yashuedu.com | TurnCommerce, Inc. DBA NameBright.com | 25 Feb 2019 | 9 Apr 2019 | 24 Feb 2020 |
| 229 | yashpaints.com | Tucows Domains Inc. | 5 Feb 2020 | 5 Feb 2020 | 5 Feb 2021 |
| 230 | yashilitc.com | HiChina Zhicheng Technology Limited | 30 Oct 2014 | 15 Jan 2018 | 30 Oct 2018 |
| 231 | yashglass.com | GoDaddy.com, LLC | 24 Oct 2024 | 25 Mar 2025 | 24 Oct 2025 |
| 232 | yashasviinfra.com | Hostinger, UAB | 9 Jun 2022 | 19 Aug 2023 | 9 Jun 2023 |
| 233 | yashop.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Jan 2010 | 30 May 2025 | 30 Jan 2027 |
| 234 | yashir.org | GoDaddy.com, LLC | 9 Dec 2022 | 19 Feb 2024 | 9 Dec 2023 |
| 235 | yashrajakashi.com | NameCheap, Inc. | 19 Aug 2020 | 19 Aug 2020 | 19 Aug 2030 |
| 236 | yashinfosystems.com | GoDaddy.com, LLC | 30 Oct 2014 | 17 Oct 2024 | 30 Oct 2025 |
| 237 | yashifeng.com | GoDaddy.com, LLC | 14 Jan 2019 | 14 Jan 2019 | 14 Jan 2020 |
| 238 | yashidiy.com | Tucows Domains Inc. | 10 Jan 2021 | 6 Jan 2024 | 10 Jan 2026 |
| 239 | yashphotofilms.net | BigRock Solutions Ltd. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 240 | yashobhumi.com | Wild West Domains, LLC | 14 Sep 2012 | 25 Aug 2024 | 14 Sep 2025 |
| 241 | yashuafinancial.com | GoDaddy.com, LLC | 11 Oct 2009 | 21 May 2025 | 11 Oct 2025 |
| 242 | yashwardhn.com | eNom, Inc. | 31 Oct 2014 | 20 Nov 2017 | 31 Oct 2018 |
| 243 | yashilandaibbshuang.com | Xin Net Technology Corporation | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 244 | yashgirdhar.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 245 | yashasa.com | Hostinger, UAB | 9 Dec 2022 | 13 Dec 2022 | 9 Dec 2025 |
| 246 | yashangvip.com | Jiangsu Bangning Science and technology Co. Ltd. | 16 Jan 2016 | 10 Feb 2020 | 16 Jan 2021 |
| 247 | yashmin.com | GoDaddy.com, LLC | 24 Jun 2008 | 16 Apr 2025 | 24 Jun 2031 |
| 248 | yashplus.com | Domain.com, LLC | 15 Mar 2017 | 15 Mar 2017 | 15 Mar 2018 |
| 249 | yashbirla.com | GoDaddy.com, LLC | 30 Jul 2002 | 29 Jul 2025 | 30 Jul 2026 |
| 250 | yashmedia.biz | GoDaddy.com, LLC | 1 Nov 2014 | 1 Nov 2014 | 31 Oct 2015 |
| 251 | yashtv.com | GoDaddy.com, LLC | 10 Oct 2023 | 8 Oct 2024 | 10 Oct 2025 |
| 252 | yashradio.com | Amazon Registrar, Inc. | 9 Feb 2022 | 25 Apr 2023 | 9 Feb 2023 |
| 253 | yashilongshoes.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 May 2021 | 5 May 2023 | 4 May 2024 |
| 254 | yashashop.com | GMO Internet Inc. | 5 Aug 2025 | 5 Aug 2025 | 5 Aug 2026 |
| 255 | yash-kothari.com | GoDaddy.com, LLC | 1 Nov 2014 | 2 Nov 2024 | 1 Nov 2025 |
| 256 | yashaking.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Oct 2021 | 6 Oct 2023 | 5 Oct 2024 |
| 257 | yashmith.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Oct 2014 | 6 Dec 2016 | 30 Oct 2017 |
| 258 | yashmedia.info | GoDaddy.com, LLC | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 259 | yashinozdemir.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Jun 2014 | 11 Jun 2015 | 10 Jun 2016 |
| 260 | yashmincharnetabler.com | Tucows Domains Inc. | 20 Aug 2025 | 20 Aug 2025 | 20 Aug 2026 |
| 261 | yashdeals.com | Tucows Domains Inc. | 19 May 2020 | 23 May 2021 | 19 May 2021 |
| 262 | yashjobs.com | GoDaddy.com, LLC | 25 Dec 2019 | 27 Dec 2024 | 25 Dec 2026 |
| 263 | yashtentandcaterers.com | Name.com, Inc. | 11 Jun 2013 | 6 Jul 2015 | 11 Jun 2016 |
| 264 | yashwaapatternsanddies.net | Name.com, Inc. | 11 Jun 2013 | 6 Jul 2015 | 11 Jun 2016 |
| 265 | yashenzhen.com | - | 29 Jun 2021 | 30 Jun 2021 | 29 Jun 2022 |
| 266 | yashicainfotech.com | GoDaddy.com, LLC | 7 Jun 2013 | 8 Jun 2015 | 7 Jun 2016 |
| 267 | yashodhra.com | GoDaddy.com, LLC | 9 Jun 2014 | 10 Jun 2015 | 9 Jun 2016 |
| 268 | yashmedia.net | eNom, Inc. | 20 Nov 2018 | 29 Apr 2019 | 20 Nov 2020 |
| 269 | yashkedia.com | NameCheap, Inc. | 28 Aug 2020 | 30 Apr 2024 | 28 Aug 2025 |
| 270 | yashikavideovision.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 271 | yasherbalcosmetic.com | OnlineNIC, Inc. | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 272 | yashengan.com | eName Technology Co., Ltd. | 16 Aug 2019 | 16 Aug 2019 | 16 Aug 2020 |
| 273 | yasheng-lsys.com | - | 17 Sep 2021 | 17 Sep 2021 | 17 Sep 2022 |
| 274 | yasheji.com | HiChina Zhicheng Technology Limited | 3 Nov 2014 | 5 Nov 2023 | 3 Nov 2025 |
| 275 | yashdaha.com | NameCheap, Inc. | 6 Nov 2022 | 17 Jan 2024 | 6 Nov 2023 |
| 276 | yashashvirealty.com | Web Werks India Pvt. Ltd d/b/a ZenRegistry.com | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 277 | yashwanthvanam.com | GoDaddy.com, LLC | 11 Jun 2014 | 12 Jun 2015 | 11 Jun 2016 |
| 278 | yashenggroup.com | Tucows Domains Inc. | 19 Jul 2004 | 4 Jul 2025 | 19 Jul 2026 |
| 279 | yashasswitchgears.com | GoDaddy.com, LLC | 2 Sep 2015 | 3 Sep 2015 | 2 Sep 2016 |
| 280 | yashhitech.in | GoDaddy.com, LLC | 27 Jul 2023 | 1 Aug 2025 | 27 Jul 2026 |
| 281 | yashsharma.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 4 Nov 2014 | 3 Nov 2015 |
| 282 | yashivideo.com | Beijing Lanhai Jiye Technology Co., Ltd | 24 Oct 2024 | 16 Aug 2025 | 24 Oct 2025 |
| 283 | yashio-shaken.com | GMO Internet Inc. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 284 | yashimprints.com | BigRock Solutions Ltd. | 4 Nov 2014 | 9 Nov 2017 | 4 Nov 2018 |
| 285 | yashaguo.com | HiChina Zhicheng Technology Limited | 25 Jun 2019 | 26 Jun 2019 | 25 Jun 2020 |
| 286 | yashrealtor.com | GoDaddy.com, LLC | 21 Sep 2024 | 21 Sep 2024 | 21 Sep 2025 |
| 287 | yashasvirealtor.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2019 |
| 288 | yashil.net | Amazon Registrar, Inc. | 20 Mar 2021 | 3 Jun 2023 | 20 Mar 2023 |
| 289 | yashuawang.com | Hangzhou AiMing Network Co., LTD | 25 Nov 2019 | 25 Nov 2019 | 25 Nov 2020 |
| 290 | yashankit.info | GoDaddy.com, LLC | 15 Jun 2014 | 15 Jun 2015 | 15 Jun 2016 |
| 291 | yashaswihandlooms.com | GoDaddy.com, LLC | 14 May 2016 | 14 May 2016 | 14 May 2017 |
| 292 | yashkulkarni.com | Google, Inc. | 6 Jan 2019 | 22 Dec 2024 | 6 Jan 2026 |
| 293 | yashanis.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2017 |
| 294 | yashiya168.com | HiChina Zhicheng Technology Limited | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 295 | yashveer.com | TurnCommerce, Inc. DBA NameBright.com | 5 Nov 2015 | 31 May 2025 | 5 Nov 2025 |
| 296 | yashodeepmachinary.net | GoDaddy.com, LLC | 19 Jun 2014 | 20 Jun 2015 | 19 Jun 2016 |
| 297 | yashodhangroupindia.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 5 Nov 2014 | 4 Nov 2015 |
| 298 | yashbabumatrimony.com | - | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2017 |
| 299 | yashenmen.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 9 Dec 2022 | 14 Dec 2023 | 9 Dec 2023 |
| 300 | yashibai.com | eName Technology Co., Ltd. | 19 Aug 2014 | 2 Aug 2017 | 19 Aug 2018 |
| 301 | yashm-factory.net | OnlineNIC, Inc. | 26 Nov 2006 | 26 Nov 2006 | 25 Nov 2025 |
| 302 | yashm.net | OnlineNIC, Inc. | 26 Nov 2006 | 26 Nov 2006 | 25 Nov 2025 |
| 303 | yashtamp.com | Acens Technologies, S.L.U. | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 304 | yashun-silicone.com | - | 6 Apr 2025 | 9 Apr 2025 | 6 Apr 2026 |
| 305 | yashdesigns.com | GoDaddy.com, LLC | 16 Jun 2024 | 15 Aug 2025 | 16 Jun 2026 |
| 306 | yashawnbright.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 307 | yashaswihimalayas.com | GoDaddy.com, LLC | 7 Nov 2014 | 5 Nov 2024 | 7 Nov 2025 |
| 308 | yashanascookingkitchen.com | 1&1 Internet AG | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 309 | yashansway.com | eNom, Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 310 | yashington.com | Netowl, Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 311 | yashkino.com | TurnCommerce, Inc. DBA NameBright.com | 20 Aug 2014 | 14 Aug 2020 | 20 Aug 2025 |
| 312 | yashinfotechpune.com | 1API GmbH | 1 Dec 2021 | 1 Dec 2021 | 1 Dec 2022 |
| 313 | yashinlaw.com | Limited Liability Company "Registrar of domain nam… | 9 Aug 2023 | 17 Jul 2024 | 9 Aug 2026 |
| 314 | yashuju.com | Beijing Lanhai Jiye Technology Co., Ltd | 28 May 2024 | 30 Jul 2025 | 28 May 2026 |
| 315 | yashir-mushlam.net | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 316 | yashbuilders.net | Domainshype.com, Inc. | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 317 | yashuahouse.org | GoDaddy.com, LLC | 6 Feb 2015 | 20 Mar 2025 | 6 Feb 2025 |
| 318 | yashagoro.net | 1&1 Internet AG | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 319 | yashary.com | GoDaddy.com, LLC | 25 Nov 2022 | 25 Nov 2022 | 25 Nov 2023 |
| 320 | yashiaiche.com | GoDaddy.com, LLC | 16 Jan 2017 | 16 Jan 2017 | 16 Jan 2018 |
| 321 | yashiduhotelshanghai.com | Xin Net Technology Corporation | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 322 | yashioengei.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 14 Oct 2021 | 14 Oct 2021 | 14 Oct 2022 |
| 323 | yashishop.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 May 2025 | 2 Jun 2025 | 29 May 2026 |
| 324 | yashite.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 21 Aug 2014 | 18 Aug 2024 | 21 Aug 2025 |
| 325 | yashodharahospital.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jun 2017 | 12 Jun 2019 | 20 Jun 2020 |
| 326 | yashuang.net | DropCatch.com 1235 LLC | 19 Jun 2022 | 30 Aug 2024 | 19 Jun 2024 |
| 327 | yashspices.com | GoDaddy.com, LLC | 25 Oct 2020 | 6 Jan 2024 | 25 Oct 2023 |
| 328 | yashmediaservices.com | Network Solutions, LLC | 28 Dec 2017 | 28 Dec 2017 | 28 Dec 2018 |
| 329 | yashcohomes.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2017 |
| 330 | yashafa.com | GoDaddy.com, LLC | 29 Dec 2018 | 29 Dec 2018 | 29 Dec 2019 |
| 331 | yashwantcharitabletrust.com | GoDaddy.com, LLC | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 332 | yashuiqi.com | HiChina Zhicheng Technology Limited | 23 Aug 2014 | 2 Aug 2017 | 23 Aug 2018 |
| 333 | yashan.net | Eranet International Limited | 22 Sep 2017 | 30 Sep 2024 | 22 Sep 2025 |
| 334 | yashca.com | GoDaddy.com, LLC | 11 Aug 2022 | 18 Aug 2025 | 11 Aug 2027 |
| 335 | yashengpr.com | Xin Net Technology Corporation | 3 Jul 2019 | 9 Jan 2020 | 3 Jul 2020 |
| 336 | yashcomputerpub.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 337 | yashengdi.com | Beijing Lanhai Jiye Technology Co., Ltd | 22 Mar 2022 | 24 May 2024 | 22 Mar 2024 |
| 338 | yashfen.com | GoDaddy.com, LLC | 6 Jan 2024 | 6 Jan 2024 | 6 Jan 2026 |
| 339 | yashuojidian.com | Guangdong JinWanBang Technology Investment Co., Lt… | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2019 |
| 340 | yashwanthadapsar.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Jun 2020 | 5 Jun 2020 | 5 Jun 2021 |
| 341 | yashacreations.com | BigRock Solutions Ltd. | 23 Aug 2014 | 24 Aug 2014 | 23 Aug 2015 |
| 342 | yashglistings.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2017 |
| 343 | yashsmsmarketing.com | Marcaria.com International, Inc. | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 344 | yashuba.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 May 2022 | 17 May 2023 | 16 May 2024 |
| 345 | yashuasword.com | Wild West Domains, LLC | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 346 | yasha-yasha.com | Tucows Domains Inc. | 5 Nov 2012 | 9 Nov 2014 | 5 Nov 2015 |
| 347 | yashikalacefab.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2016 |
| 348 | yashpackagingmachines.com | Infocom Network Ltd. | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 349 | yashpcsolution.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 350 | yashagroup.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 12 Nov 2024 | 12 Nov 2024 | 12 Nov 2025 |
| 351 | yashaswinicollection.com | GoDaddy.com, LLC | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 352 | yashijiamt.com | Hangzhou AiMing Network Co., LTD | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 353 | yashpays.net | BigRock Solutions Ltd. | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 354 | yashufu.com | Beijing Lanhai Jiye Technology Co., Ltd | 9 Nov 2014 | 8 Dec 2024 | 9 Nov 2025 |
| 355 | yashtra.com | GoDaddy.com, LLC | 8 Sep 2020 | 2 Oct 2023 | 8 Sep 2026 |
| 356 | yasherp.com | GoDaddy.com, LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 357 | yashangyc.com | Xin Net Technology Corporation | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 358 | yashanda.com | Beijing Lanhai Jiye Technology Co., Ltd | 9 Aug 2021 | 24 Aug 2025 | 9 Aug 2026 |
| 359 | yashee.com | GoDaddy.com, LLC | 13 May 2017 | 15 Apr 2024 | 13 May 2026 |
| 360 | yashinteriorworld.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 361 | yashpg.com | Soldierofonedomains.com | 9 Feb 2025 | 9 Feb 2025 | 9 Feb 2026 |
| 362 | yaships.net | DropCatch.com 1494 LLC | 11 Apr 2017 | 8 Jan 2018 | 11 Apr 2019 |
| 363 | yashapparels.net | GoDaddy.com, LLC | 7 Mar 2014 | 7 Mar 2017 | 7 Mar 2018 |
| 364 | yashbhargava.com | GoDaddy.com, LLC | 17 Jun 2024 | 17 Jun 2024 | 17 Jun 2027 |
| 365 | yashengshafa.com | eName Technology Co., Ltd. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 366 | yashengtai.com | HiChina Zhicheng Technology Limited | 30 Oct 2017 | 27 Nov 2024 | 30 Oct 2025 |
| 367 | yashirokitakodomo.com | GMO Internet Inc. | 26 Aug 2014 | 22 Aug 2024 | 26 Aug 2025 |
| 368 | yashshree.com | NameCheap, Inc. | 26 May 2025 | 26 May 2025 | 26 May 2026 |
| 369 | yashtheslushie.com | Tucows Domains Inc. | 22 Aug 2010 | 26 Aug 2014 | 22 Aug 2015 |
| 370 | yashunsilicones.com | Bizcn.com, Inc. | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 371 | yashtechnotainments.com | GoDaddy.com, LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 372 | yashmac.com | Porkbun, LLC | 27 Jan 2025 | 27 Jan 2025 | 27 Jan 2026 |
| 373 | yashawantarts.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 374 | yash-desai.com | Google, Inc. | 15 Mar 2020 | 15 Mar 2020 | 15 Mar 2021 |
| 375 | yashaswigems.com | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2016 |
| 376 | yashaswitech.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2014 | 26 Aug 2024 | 27 Aug 2025 |
| 377 | yashayoo.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 378 | yashayou.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 379 | yashrk.com | Hostinger, UAB | 10 Jan 2023 | 19 Feb 2024 | 10 Jan 2024 |
| 380 | yashitong.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 24 Aug 2013 | 27 Aug 2015 | 24 Aug 2016 |
| 381 | yashclothing.com | - | 12 Jan 2025 | 12 Jan 2025 | 12 Jan 2026 |
| 382 | yashdalfthegray.com | Google, Inc. | 15 Aug 2014 | 1 Aug 2024 | 15 Aug 2025 |
| 383 | yashecehua.com | Beijing Lanhai Jiye Technology Co., Ltd | 31 Oct 2015 | 24 Jul 2025 | 31 Oct 2026 |
| 384 | yashenmenye.com | EUTurbo.com LLC | 20 Feb 2022 | 5 Apr 2023 | 20 Feb 2023 |
| 385 | yashgarg.com | 1&1 Internet AG | 8 Mar 2018 | 17 Feb 2022 | 8 Mar 2026 |
| 386 | yashio-kotsubankyousei.com | GMO Internet Inc. | 15 Aug 2014 | 15 Mar 2016 | 15 Aug 2018 |
| 387 | yashvant.com | GoDaddy.com, LLC | 17 Jun 2023 | 29 Aug 2024 | 17 Jun 2024 |
| 388 | yashanlvyou.com | Xin Net Technology Corporation | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 389 | yashe168.com | Xin Net Technology Corporation | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 390 | yashelanly.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 391 | yashisjb.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Apr 2022 | 6 Jun 2024 | 4 Apr 2024 |
| 392 | yashre.com | Hostinger, UAB | 29 Jan 2025 | 31 Mar 2025 | 29 Jan 2026 |
| 393 | yashoppe.com | Tucows Domains Inc. | 11 Oct 2024 | 21 Mar 2025 | 11 Oct 2025 |
| 394 | yashrecharge.biz | BigRock Solutions Ltd. | 12 Nov 2014 | 12 Nov 2014 | 11 Nov 2015 |
| 395 | yashiyuanyi.com | Xin Net Technology Corporation | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 396 | yashimeiju.com | Xin Net Technology Corporation | 9 Nov 2013 | 13 Nov 2014 | 9 Nov 2015 |
| 397 | yashimaclarkson.com | Wild West Domains, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 398 | yashams.com | Hosting Concepts B.V. dba Openprovider | 13 Nov 2014 | 11 Nov 2024 | 13 Nov 2027 |
| 399 | yashammad.com | register.com, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 400 | yashkov.com | GoDaddy.com, LLC | 28 Aug 2014 | 20 Aug 2024 | 28 Aug 2025 |
| 401 | yashnms.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Nov 2022 | 16 Nov 2024 | 15 Nov 2025 |
| 402 | yasharlift.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 21 Dec 2022 | 18 Dec 2024 | 21 Dec 2025 |
| 403 | yashilou.com | TurnCommerce, Inc. DBA NameBright.com | 29 Nov 2020 | 8 Jan 2025 | 29 Nov 2024 |
| 404 | yashilou.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Sep 2014 | 12 Sep 2019 | 11 Sep 2020 |
| 405 | yashilou.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 406 | yashitang.net | Jiangsu Bangning Science and technology Co. Ltd. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 407 | yashstudioworks.com | BigRock Solutions Ltd. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 408 | yashallied.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 409 | yashawantconsultancy.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 410 | yashengjiancai.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Aug 2014 | 25 Aug 2025 | 29 Aug 2026 |
| 411 | yasheschool.com | - | 26 Aug 2016 | 26 Aug 2016 | 26 Aug 2017 |
| 412 | yashfabrics.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 413 | yashthakkar.com | Google, Inc. | 11 Jun 2022 | 10 Jun 2025 | 11 Jun 2026 |
| 414 | yashuji888.com | HiChina Zhicheng Technology Limited | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 415 | yashwantmauli.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 416 | yashgems.com | GoDaddy.com, LLC | 4 May 2016 | 5 May 2025 | 4 May 2026 |
| 417 | yashijiajiaju.com | 35 Technology Co., Ltd. | 5 May 2021 | 6 May 2021 | 6 May 2022 |
| 418 | yashraajkapill.com | GoDaddy.com, LLC | 12 Sep 2014 | 10 Sep 2015 | 12 Sep 2017 |
| 419 | yashrajkapil.com | GoDaddy.com, LLC | 12 Sep 2014 | 10 Sep 2015 | 12 Sep 2017 |
| 420 | yashsanghvi.com | BigRock Solutions Ltd. | 22 Jan 2016 | 19 Jan 2017 | 22 Jan 2018 |
| 421 | yashihotel.com | Metaregistrar BV Applications | 27 Dec 2024 | 5 Jan 2025 | 27 Dec 2025 |
| 422 | yashdevtyagi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2014 | 15 Nov 2016 | 14 Nov 2017 |
| 423 | yashchin.com | Google, Inc. | 18 Jul 2022 | 19 Jul 2023 | 18 Jul 2024 |
| 424 | yashil.org | Gransy s.r.o. d/b/a subreg.cz | 27 Jan 2023 | 27 Jan 2025 | 27 Jan 2026 |
| 425 | yashlathemachine.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Aug 2014 | 16 Jul 2025 | 30 Aug 2030 |
| 426 | yashmodelling.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 427 | yashtoursandtravels.com | GoDaddy.com, LLC | 16 Sep 2019 | 1 Oct 2024 | 16 Sep 2025 |
| 428 | yashidajp.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 22 Jun 2025 | 22 Jun 2025 | 22 Jun 2026 |
| 429 | yashikalace.com | BigRock Solutions Ltd. | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 430 | yashizunweiyu.com | Xin Net Technology Corporation | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 431 | yashomatitaithakur.com | BigRock Solutions Ltd. | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 432 | yashik.net | NameCheap, Inc. | 13 Sep 2014 | 19 Nov 2024 | 13 Sep 2026 |
| 433 | yashdiq-dev.com | eNom, Inc. | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 434 | yashengzhiku.com | HiChina Zhicheng Technology Limited | 1 Sep 2014 | 26 Aug 2024 | 1 Sep 2025 |
| 435 | yashmediaservice.com | BigRock Solutions Ltd. | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 436 | yashn.com | TurnCommerce, Inc. DBA NameBright.com | 19 Nov 2019 | 13 Nov 2020 | 19 Nov 2025 |
| 437 | yashoesj.com | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 438 | yashrajvakil.com | BigRock Solutions Ltd. | 6 Mar 2025 | 6 May 2025 | 6 Mar 2026 |
| 439 | yasharya.com | GoDaddy.com, LLC | 14 Sep 2014 | 15 Sep 2024 | 14 Sep 2025 |
| 440 | yashchhedda.com | BigRock Solutions Ltd. | 14 Sep 2014 | 13 Sep 2017 | 14 Sep 2018 |
| 441 | yashnamaya.com | Mfro Inc. | 3 Jul 2021 | 3 Jul 2021 | 3 Jul 2026 |
| 442 | yashenwl.com | TurnCommerce, Inc. DBA NameBright.com | 7 Feb 2020 | 5 May 2025 | 7 Feb 2026 |
| 443 | yashenwl.net | Beijing Lanhai Jiye Technology Co., Ltd | 18 Mar 2017 | 20 Jul 2025 | 18 Mar 2026 |
| 444 | yashamrapali.com | Wild West Domains, LLC | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 445 | yashtechnologies.org | GoDaddy.com, LLC | 6 May 2024 | 11 May 2025 | 6 May 2026 |
| 446 | yashtravelpoints.com | GoDaddy.com, LLC | 3 Sep 2014 | 16 Dec 2015 | 3 Sep 2017 |
| 447 | yashrazz.com | GoDaddy.com, LLC | 15 Nov 2014 | 11 Nov 2024 | 15 Nov 2025 |
| 448 | yashow.com | Hangzhou AiMing Network Co., LTD | 15 Nov 2014 | 23 Oct 2024 | 15 Nov 2025 |
| 449 | yashcopvtltd.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Jun 2022 | 18 Jun 2024 | 17 Jun 2025 |
| 450 | yashfeenpharma.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Sep 2014 | 15 Sep 2024 | 16 Sep 2025 |
| 451 | yashiya.org | eNom, Inc. | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 452 | yashsales.com | GoDaddy.com, LLC | 15 Jan 2018 | 17 Jan 2025 | 15 Jan 2026 |
| 453 | yashtuitions.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 454 | yashibuy.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Apr 2022 | 16 Apr 2024 | 15 Apr 2025 |
| 455 | yashengedu.com | Web Commerce Communications Limited dba WebNic.cc | 28 May 2021 | 8 Mar 2023 | 28 May 2024 |
| 456 | yashdesign.com | TurnCommerce, Inc. DBA NameBright.com | 3 Feb 2016 | 17 Apr 2025 | 3 Feb 2026 |
| 457 | yashgurditta.com | NameCheap, Inc. | 31 Dec 2017 | 1 Dec 2024 | 31 Dec 2025 |
| 458 | yashfapharma.com | eNom, Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 459 | yashfishingflots.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 460 | yashgroupe.com | Internet.bs Corp. | 1 Aug 2014 | 4 Sep 2014 | 1 Aug 2015 |
| 461 | yashiinfotech.com | TurnCommerce, Inc. DBA NameBright.com | 29 Apr 2017 | 11 Jul 2024 | 29 Apr 2024 |
| 462 | yashms.com | Jiangsu Bangning Science and technology Co. Ltd. | 23 Nov 2019 | 25 Nov 2019 | 23 Nov 2020 |
| 463 | yashomes.com | GoDaddy.com, LLC | 12 Mar 2017 | 12 Mar 2025 | 12 Mar 2027 |
| 464 | yashta.net | Wild West Domains, LLC | 4 Sep 2014 | 16 Sep 2016 | 4 Sep 2017 |
| 465 | yashaswinigruha.net | Domainshype.com, Inc. | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 466 | yashvempati.com | Amazon Registrar, Inc. | 26 Aug 2020 | 22 Jul 2025 | 26 Aug 2026 |
| 467 | yashwee.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 468 | yashprint.com | GoDaddy.com, LLC | 20 May 2025 | 20 May 2025 | 20 May 2026 |
| 469 | yashpradhan.com | Tucows Domains Inc. | 1 Feb 2019 | 3 Feb 2025 | 1 Feb 2026 |
| 470 | yashijx.com | Name.com, Inc. | 1 Dec 2024 | 26 May 2025 | 1 Dec 2025 |
| 471 | yashcontrol.com | Infocom Network Ltd. | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 472 | yashaswisms.com | Tucows Domains Inc. | 29 Feb 2016 | 29 Feb 2016 | 28 Feb 2017 |
| 473 | yashasviwedsaditya.com | BigRock Solutions Ltd. | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 474 | yashneesh.com | BigRock Solutions Ltd. | 3 Oct 2018 | 3 Oct 2018 | 3 Oct 2019 |
| 475 | yashodhanindia.com | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 476 | yashwantnow.com | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2016 |
| 477 | yashprints.net | Wild West Domains, LLC | 19 Sep 2014 | 29 Aug 2019 | 19 Sep 2020 |
| 478 | yasheng-glass.com | GMO Internet Inc. | 16 Apr 2019 | - | 16 Apr 2020 |
| 479 | yashmedicalfoundation.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 27 Oct 2018 | 17 Oct 2024 | 27 Oct 2025 |
| 480 | yashraajindustries.com | Acens Technologies, S.L.U. | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 481 | yashilandai.info | Google, Inc. | 3 Sep 2024 | 3 Jun 2025 | 3 Sep 2025 |
| 482 | yashimishra.com | Nordreg AB | 6 Jul 2025 | 7 Jul 2025 | 6 Jul 2026 |
| 483 | yashshaadi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2015 |
| 484 | yashodadevelopers.org | In2net Network, Inc. | 20 Sep 2014 | 16 Oct 2015 | 20 Sep 2016 |
| 485 | yashinsky.com | Wild West Domains, LLC | 7 Sep 2014 | 7 Aug 2024 | 7 Sep 2025 |
| 486 | yashrajtranslines.biz | BigRock Solutions Ltd. | 7 Sep 2014 | 11 Sep 2019 | 6 Sep 2020 |
| 487 | yashwantgrampanchayatthikekarwadi.com | Net 4 India Limited | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2016 |
| 488 | yashinuofushi.com | Xin Net Technology Corporation | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 489 | yashsecurityservice.com | Tucows Domains Inc. | 29 Oct 2020 | 2 Nov 2021 | 29 Oct 2021 |
| 490 | yashubao.com | DNSPod, Inc. | 19 Oct 2018 | - | 19 Oct 2019 |
| 491 | yashwantsingh.com | - | 5 Jun 2024 | 13 May 2025 | 5 Jun 2026 |
| 492 | yashadacon.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Sep 2014 | 29 Sep 2017 | 29 Sep 2018 |
| 493 | yashrent.com | GoDaddy.com, LLC | 30 Sep 2014 | 30 Sep 2014 | 30 Sep 2015 |
| 494 | yashegy.com | - | 7 Aug 2024 | 12 Aug 2025 | 7 Aug 2025 |
| 495 | yashnanavati.com | Tucows Domains Inc. | 8 Sep 2014 | 12 Sep 2019 | 8 Sep 2019 |
| 496 | yashzone21.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 497 | yashilyapraghco.com | Realtime Register B.V. | 28 Sep 2013 | 1 Oct 2014 | 28 Sep 2015 |
| 498 | yashtesttube.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Oct 2014 | 12 Mar 2025 | 1 Oct 2026 |
| 499 | yashikacollege.com | Crazy Domains FZ-LLC | 9 Sep 2014 | 2 Sep 2024 | 9 Sep 2025 |
| 500 | yashio-shounishika.com | Japan Registry Services Co., Ltd. | 9 Sep 2014 | 7 Sep 2017 | 9 Sep 2018 |
| 501 | yashuma.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Dec 2021 | 12 Aug 2025 | 15 Dec 2025 |
| 502 | yasharkiani.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Oct 2014 | 19 Sep 2024 | 3 Oct 2026 |
| 503 | yashthakkarphotography.com | Hostinger, UAB | 3 Oct 2014 | 7 Dec 2024 | 3 Oct 2025 |
| 504 | yashaswionline.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Oct 2014 | 4 Oct 2016 | 3 Oct 2017 |
| 505 | yashibo.com | - | 16 Dec 2024 | 16 Dec 2024 | 17 Dec 2025 |
| 506 | yashu3.com | GMO Internet Inc. | 3 Oct 2014 | 14 Jan 2017 | 3 Oct 2017 |
| 507 | yashangjewelry.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 508 | yashasekhavat.com | Tucows Domains Inc. | 7 Sep 2010 | 2 Sep 2024 | 7 Sep 2025 |
| 509 | yashi-hk.com | Bizcn.com, Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 510 | yashi007.com | GoDaddy.com, LLC | 19 May 2022 | 20 May 2023 | 19 May 2024 |
| 511 | yashiel.com | GoDaddy.com, LLC | 26 Aug 2016 | 31 Aug 2023 | 26 Aug 2025 |
| 512 | yashilnet.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Apr 2023 | 29 May 2025 | 27 Apr 2025 |
| 513 | yash-infra.com | GoDaddy.com, LLC | 18 Jul 2025 | 18 Jul 2025 | 18 Jul 2035 |
| 514 | yashesolutions.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 515 | yashpolymers.org | Tucows Domains Inc. | 18 Nov 2014 | 22 Nov 2015 | 18 Nov 2016 |
| 516 | yashicm.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Mar 2025 | 21 Jul 2025 | 15 Mar 2027 |
| 517 | yashvasininternational.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 518 | yashuahamashia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 519 | yashpalmehrasons.com | GoDaddy.com, LLC | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 520 | yashly.com | Name.com, Inc. | 29 Nov 2024 | 13 Jul 2025 | 29 Nov 2025 |
| 521 | yashiquan.com | Jiangsu Bangning Science and technology Co. Ltd. | 2 Jul 2021 | 2 Jul 2021 | 2 Jul 2022 |
| 522 | yashimpexengg.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Nov 2014 | 2 Nov 2017 | 20 Nov 2018 |
| 523 | yashilchat.org | Realtime Register B.V. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 524 | yashilchat.net | Realtime Register B.V. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 525 | yashiguoji.com | Xin Net Technology Corporation | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 526 | yashi-usa.com | Xin Net Technology Corporation | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 527 | yashi-cn.com | Xin Net Technology Corporation | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 528 | yashasavikhanna.com | GoDaddy.com, LLC | 21 Nov 2014 | 28 Feb 2025 | 21 Nov 2025 |
| 529 | yashio.mobi | GMO Internet Inc. | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 530 | yashvee.com | GoDaddy.com, LLC | 7 Mar 2017 | 19 May 2024 | 7 Mar 2024 |
| 531 | yashengzs.com | Cosmotown, Inc. | 23 Oct 2024 | 30 Jul 2025 | 23 Oct 2025 |
| 532 | yashworks.com | GoDaddy.com, LLC | 23 Mar 2019 | 23 Mar 2019 | 23 Mar 2021 |
| 533 | yashichina.com | Dynadot, LLC | 19 Sep 2006 | 21 Aug 2024 | 19 Sep 2025 |
| 534 | yashidipx.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 23 Jun 2021 | 23 Jun 2021 | 23 Jun 2022 |
| 535 | yashacouture.com | GoDaddy.com, LLC | 17 Jul 2018 | 7 Sep 2020 | 17 Jul 2021 |
| 536 | yashiro-manga.com | Tucows Domains Inc. | 28 Feb 2017 | 28 Feb 2017 | 28 Feb 2018 |
| 537 | yashnafoods.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 538 | yashu-edu.com | Beijing Lanhai Jiye Technology Co., Ltd | 23 Sep 2014 | 24 Sep 2023 | 23 Sep 2024 |
| 539 | yashiwic.com | Bizcn.com, Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 540 | yashpackersmover.com | BigRock Solutions Ltd. | 14 Jan 2021 | 15 Jan 2021 | 14 Jan 2022 |
| 541 | yashinuo.com | Beijing Lanhai Jiye Technology Co., Ltd | 28 Mar 2021 | 15 Aug 2025 | 28 Mar 2026 |
| 542 | yashengzuche.com | Dynadot14 LLC | 10 Sep 2021 | 11 Sep 2021 | 10 Sep 2022 |
| 543 | yashanglife.com | GoDaddy.com, LLC | 22 Apr 2020 | 4 Aug 2025 | 22 Apr 2026 |
| 544 | yashimay.com | - | 25 Mar 2023 | 27 May 2024 | 25 Mar 2024 |
| 545 | yashima-labo.com | Japan Registry Services Co., Ltd. | 7 Oct 2014 | 27 Oct 2016 | 7 Oct 2018 |
| 546 | yashodamemorialtrust.com | BigRock Solutions Ltd. | 28 Nov 2016 | 28 Nov 2017 | 28 Nov 2017 |
| 547 | yashtag.com | Tucows Domains Inc. | 20 Feb 2023 | 20 Feb 2023 | 20 Feb 2028 |
| 548 | yashopper.com | GMO Internet Inc. | 5 Oct 2021 | 8 Oct 2021 | 5 Oct 2022 |
| 549 | yashodhara.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 550 | yashunkang.com | Foshan YiDong Network Co., LTD | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 551 | yashengdianzi.com | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 552 | yashengjs.com | Hongkong Domain Name Information Management Co., L… | 7 Mar 2019 | 7 Mar 2019 | 7 Mar 2020 |
| 553 | yashiweimei.com | Chengdu West Dimension Digital Technology Co., Ltd… | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 554 | yashop.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Apr 2025 | 19 Jun 2025 | 19 Apr 2026 |
| 555 | yashsejwalhairenterprises.com | Infocom Network Ltd. | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2016 |
| 556 | yashowmarket.com | Hefei Juming Network Technology Co., Ltd | 8 Feb 2022 | 14 Aug 2025 | 8 Feb 2026 |
| 557 | yashinyt.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 17 Dec 2022 | 10 Feb 2024 | 17 Dec 2023 |
| 558 | yashkindom.com | GoDaddy.com, LLC | 28 Sep 2014 | 29 Sep 2016 | 28 Sep 2017 |
| 559 | yashmaternityhospital.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 560 | yashvi-viral.com | BigRock Solutions Ltd. | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 561 | yashvinlogistic.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 562 | yashyagroup.com | BigRock Solutions Ltd. | 23 Nov 2014 | 24 Nov 2014 | 23 Nov 2015 |
| 563 | yashtelescopic.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 564 | yashiteng.com | Chengdu West Dimension Digital Technology Co., Ltd… | 7 Jun 2019 | 7 Jun 2019 | 7 Jun 2020 |
| 565 | yashengok.com | - | 25 Feb 2024 | 26 Feb 2025 | 25 Feb 2026 |
| 566 | yashdhar.com | GoDaddy.com, LLC | 24 Nov 2014 | 28 Nov 2023 | 24 Nov 2025 |
| 567 | yashashreehospital.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Aug 2012 | 24 Nov 2014 | 7 Aug 2015 |
| 568 | yashwanthmuvva.com | GoDaddy.com, LLC | 13 Oct 2014 | 14 Oct 2024 | 13 Oct 2025 |
| 569 | yashunjiaodai.com | Key-Systems GmbH | 10 Feb 2025 | 20 Feb 2025 | 10 Feb 2026 |
| 570 | yashuafashion.com | HiChina Zhicheng Technology Limited | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 571 | yashodavatika.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Oct 2014 | 16 Nov 2017 | 14 Oct 2018 |
| 572 | yashmoulds.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Oct 2014 | 11 Oct 2017 | 13 Oct 2018 |
| 573 | yashicakid.com | Megazone Corp., dba HOSTING.KR | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 574 | yashuiji.com | Eranet International Limited | 30 May 2022 | 6 Jul 2023 | 30 May 2023 |
| 575 | yashtradingcompany.com | GoDaddy.com, LLC | 21 Jan 2025 | 10 Feb 2025 | 21 Jan 2028 |
| 576 | yashremedy.com | GMO Internet Inc. | 9 Jan 2018 | - | 9 Jan 2019 |
| 577 | yashodic.com | DropCatch.com 411 LLC | 16 Oct 2014 | 17 Oct 2017 | 16 Oct 2018 |
| 578 | yashiming.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Oct 2014 | 13 Aug 2025 | 16 Oct 2025 |
| 579 | yashifs.com | Hangzhou AiMing Network Co., LTD | 16 Oct 2014 | 17 Oct 2014 | 16 Oct 2015 |
| 580 | yashidasports.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 581 | yashangkm.com | GMO Internet Inc. | 29 Jun 2023 | 5 Aug 2024 | 29 Jun 2024 |
| 582 | yasharsite.com | Tucows Domains Inc. | 8 Oct 2009 | 11 Oct 2014 | 8 Oct 2015 |
| 583 | yashaswiniproperties.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 584 | yashdiamonds.com | GoDaddy.com, LLC | 22 Sep 2024 | 22 Sep 2024 | 22 Sep 2027 |
| 585 | yashentclinic.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 10 Oct 2014 | 22 Jun 2017 | 10 Oct 2017 |
| 586 | yashyxzjj.com | - | 5 May 2025 | 7 May 2025 | 5 May 2026 |
| 587 | yashvirsinghranainld.com | Name.com, Inc. | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 588 | yashua818.com | Xin Net Technology Corporation | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 589 | yashpics.com | Tucows Domains Inc. | 25 Sep 2014 | 24 Apr 2025 | 25 Sep 2025 |
| 590 | yashopportunities.com | GoDaddy.com, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2016 |
| 591 | yashinoyasushi.com | GoDaddy.com, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 592 | yashicaonline.com | DomainCraze LLC | 26 Sep 2014 | 27 Sep 2017 | 26 Sep 2018 |
| 593 | yashflowmeters.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Sep 2014 | 11 Sep 2023 | 25 Sep 2025 |
| 594 | yashar-mobile.com | Realtime Register B.V. | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 595 | yashadarealty.com | GoDaddy.com, LLC | 11 Oct 2014 | 7 Oct 2022 | 11 Oct 2027 |
| 596 | yashenggy.com | Bizcn.com, Inc. | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 597 | yashmijuris.com | Domain.com, LLC | 10 Feb 2016 | 26 Jan 2017 | 10 Feb 2018 |
| 598 | yashrajsurveyors.com | GoDaddy.com, LLC | 12 Oct 2014 | 7 Oct 2016 | 12 Oct 2017 |
| 599 | yashrajsurveyors.info | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 600 | yashrajsurveyors.net | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 601 | yashevents.net | Wild West Domains, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 602 | yashvijain.com | Wix.com Ltd. | 12 Jan 2023 | 20 Dec 2024 | 12 Jan 2026 |
| 603 | yashouldaseenthisbynow.com | GoDaddy.com, LLC | 25 Nov 2014 | 6 Feb 2024 | 25 Nov 2023 |
| 604 | yashilibz.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 19 Apr 2021 | 20 Apr 2023 | 19 Apr 2023 |
| 605 | yashikaintech.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 606 | yashengjidian.com | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 607 | yashasvi108.com | eNom, Inc. | 24 Nov 2014 | 29 Oct 2017 | 24 Nov 2018 |
| 608 | yashanhei.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Nov 2013 | 24 Nov 2014 | 21 Nov 2015 |
| 609 | yashahouse.com | Alethia Domains, LLC | 10 Aug 2021 | 11 Aug 2021 | 10 Aug 2022 |
| 610 | yashetc.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 9 Oct 2013 | 12 Oct 2014 | 9 Oct 2015 |
| 611 | yashikamalpani.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2024 | 13 Oct 2025 |
| 612 | yashlar.biz | GoDaddy.com, LLC | 22 Feb 2019 | 22 Feb 2019 | 22 Feb 2020 |
| 613 | yashodipsahakari.com | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 614 | yashrajsurveyors.org | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 615 | yasheel.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 May 2017 | 10 Jul 2017 | 10 May 2018 |
| 616 | yashkitchenware.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jul 2017 | 20 Jul 2017 | 20 Jul 2018 |
| 617 | yashenjiaju.com | Namesilo, LLC | 9 Apr 2020 | 10 Apr 2024 | 9 Apr 2025 |
| 618 | yashasvidevelopers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Oct 2014 | 22 May 2025 | 18 Oct 2025 |
| 619 | yashahid.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 13 Oct 2012 | 16 Oct 2024 | 13 Oct 2025 |
| 620 | yasharseyyedi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 621 | yashasorthopaedic.com | Infocom Network Ltd. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 622 | yashengsm.com | Bizcn.com, Inc. | 15 Oct 2014 | 22 Jun 2025 | 15 Oct 2025 |
| 623 | yashiofactory.com | Webfusion Ltd. | 26 Mar 2021 | 26 Mar 2025 | 26 Mar 2027 |
| 624 | yashared.com | Key-Systems GmbH | 14 Sep 2012 | 19 Oct 2014 | 14 Sep 2015 |
| 625 | yashlightsolutions.net | Domainshype.com, Inc. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 626 | yashik.org | Center of Ukrainian Internet Names dba UKRNAMES | 25 Nov 2014 | - | 25 Nov 2015 |
| 627 | yashvrundavan.com | BigRock Solutions Ltd. | 26 Nov 2014 | 27 Nov 2014 | 26 Nov 2015 |
| 628 | yashowmarketbeijing.com | HiChina Zhicheng Technology Limited | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 629 | yashitinc.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Nov 2014 | 19 Nov 2024 | 25 Nov 2025 |
| 630 | yashij.com | HiChina Zhicheng Technology Limited | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2017 |
| 631 | yashidai.com | TurnCommerce, Inc. DBA NameBright.com | 24 Apr 2022 | 23 Aug 2022 | 24 Apr 2026 |
| 632 | yasharsecurity.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 26 Nov 2014 | 10 Sep 2024 | 26 Nov 2025 |
| 633 | yashbalaji.com | GoDaddy.com, LLC | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2017 |
| 634 | yashasvibhav.com | Google, Inc. | 9 Jan 2023 | 25 Dec 2024 | 9 Jan 2026 |
| 635 | yashitian.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Aug 2021 | 22 Aug 2023 | 21 Aug 2024 |
| 636 | yashpatelonline.net | BigRock Solutions Ltd. | 28 Nov 2014 | 6 Mar 2015 | 28 Nov 2015 |
| 637 | yashpalk.info | NameCheap, Inc. | 10 Jun 2018 | 10 Jun 2018 | 10 Jun 2019 |
| 638 | yashhrealtors.com | GoDaddy.com, LLC | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 639 | yashdavastu.com | GoDaddy.com, LLC | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 640 | yashlaboratories.net | Domainshype.com, Inc. | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 641 | yashfeen.org | NameKing.com Inc. | 8 Oct 2017 | 12 Jun 2024 | 8 Oct 2025 |
| 642 | yashengcn.com | - | 7 Dec 2022 | 8 Dec 2023 | 7 Dec 2024 |
| 643 | yashdeepenterprises.com | GoDaddy.com, LLC | 25 May 2020 | 25 May 2020 | 25 May 2022 |
| 644 | yashcollections.com | DropCatch.com 1489 LLC | 16 May 2022 | 27 Jul 2023 | 16 May 2023 |
| 645 | yashih.com | - | 27 Mar 2023 | 29 May 2024 | 27 Mar 2024 |
| 646 | yashesapla.com | Tucows Domains Inc. | 2 Dec 2014 | 7 Dec 2024 | 2 Dec 2025 |
| 647 | yashelexue.com | eName Technology Co., Ltd. | 18 Nov 2019 | 18 Nov 2019 | 18 Nov 2020 |
| 648 | yashanacouture.com | GoDaddy.com, LLC | 2 Dec 2014 | 3 Dec 2024 | 2 Dec 2026 |
| 649 | yashiralizguidini.com | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2024 | 4 Dec 2029 |
| 650 | yashiraguidini.com | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2024 | 4 Dec 2029 |
| 651 | yashcosolutions.com | GoDaddy.com, LLC | 4 Dec 2014 | 12 Dec 2024 | 4 Dec 2025 |
| 652 | yashbhumi.com | Tucows Domains Inc. | 3 Dec 2014 | 7 Dec 2022 | 3 Dec 2023 |
| 653 | yashiralizguidini.net | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2024 | 4 Dec 2029 |
| 654 | yashiralizguidini.info | GoDaddy.com, LLC | 4 Dec 2014 | 18 Jan 2025 | 4 Dec 2029 |
| 655 | yashiraguidini.net | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2024 | 4 Dec 2029 |
| 656 | yashiraguidini.info | GoDaddy.com, LLC | 4 Dec 2014 | 18 Jan 2025 | 4 Dec 2029 |
| 657 | yashuotouzi.com | Nordreg AB | 18 Feb 2025 | 19 Apr 2025 | 18 Feb 2026 |
| 658 | yashtjx.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Dec 2014 | 24 Jul 2025 | 4 Dec 2026 |
| 659 | yashicastore.com | eNom, Inc. | 20 Apr 2020 | 20 Apr 2020 | 20 Apr 2021 |
| 660 | yashicaindia.com | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2016 |
| 661 | yashiralizguidini.org | GoDaddy.com, LLC | 4 Dec 2014 | 18 Jan 2025 | 4 Dec 2029 |
| 662 | yashiraguidini.org | GoDaddy.com, LLC | 4 Dec 2014 | 18 Jan 2025 | 4 Dec 2029 |
| 663 | yashwantdainik.com | GoDaddy.com, LLC | 5 Dec 2014 | 5 Dec 2014 | 5 Dec 2015 |
| 664 | yashvikas.com | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Feb 2019 | 19 Feb 2019 | 19 Feb 2020 |
| 665 | yashtirgopee.com | Tucows Domains Inc. | 5 Dec 2014 | 9 Dec 2015 | 5 Dec 2016 |
| 666 | yashclinic.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Jun 2025 | 6 Dec 2025 |
| 667 | yasharaliyev.com | GoDaddy.com, LLC | 12 Sep 2023 | 13 Sep 2024 | 12 Sep 2025 |
| 668 | yashijaolan.com | HiChina Zhicheng Technology Limited | 8 Dec 2014 | 21 Mar 2025 | 8 Dec 2025 |
| 669 | yashihome.com | Squarespace Domains LLC | 24 Feb 2025 | 24 Feb 2025 | 24 Feb 2030 |
| 670 | yashuss.com | GoDaddy.com, LLC | 18 May 2013 | 26 May 2024 | 18 May 2031 |
| 671 | yashlaxmilogistics.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 672 | yashode.net | Tucows Domains Inc. | 4 Dec 2013 | 8 Dec 2014 | 4 Dec 2015 |
| 673 | yashijaolan.net | Beijing Lanhai Jiye Technology Co., Ltd | 8 Dec 2014 | 11 Apr 2024 | 8 Dec 2025 |
| 674 | yashaautos.com | register.com, Inc. | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 675 | yashgumplast.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 676 | yasharseo.com | eNom, Inc. | 10 Dec 2014 | 11 Dec 2014 | 10 Dec 2015 |
| 677 | yashnasaiohri.com | GoDaddy.com, LLC | 8 Jan 2021 | 11 Jan 2023 | 8 Jan 2028 |
| 678 | yashlaxmi.com | GoDaddy.com, LLC | 31 May 2024 | 10 Jun 2025 | 31 May 2026 |
| 679 | yashio-rekinavi.com | Japan Registry Services Co., Ltd. | 11 Dec 2014 | 15 Jul 2025 | 11 Dec 2026 |
| 680 | yashikajain.com | GoDaddy.com, LLC | 12 Dec 2014 | 1 Dec 2024 | 12 Dec 2026 |
| 681 | yashengfood.com | MAFF Inc. | 25 Apr 2021 | 4 Jul 2024 | 25 Apr 2024 |
| 682 | yashamoto.com | Lexsynergy Limited | 3 Mar 2023 | 12 Apr 2024 | 3 Mar 2024 |
| 683 | yashodharanursinginstitute.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Dec 2014 | 11 Dec 2014 | 10 Dec 2015 |
| 684 | yashodharaa.com | BigRock Solutions Ltd. | 12 Dec 2014 | 23 Jan 2025 | 12 Dec 2024 |
| 685 | yashendra.com | CloudFlare, Inc. | 11 Mar 2023 | 1 Mar 2025 | 11 Mar 2026 |
| 686 | yashchauhan.com | GoDaddy.com, LLC | 11 Jan 2018 | 16 Jan 2023 | 11 Jan 2026 |
| 687 | yashwantclassesvirar.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Dec 2021 | 12 Dec 2021 | 12 Dec 2022 |
| 688 | yashuzs.com | GoDaddy.com, LLC | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 689 | yashisrivastava.com | FastDomain Inc. | 6 May 2016 | 25 Jul 2025 | 6 May 2026 |
| 690 | yashenggongyi.com | GoDaddy.com, LLC | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 691 | yashasvifoundation.org | GoDaddy.com, LLC | 5 Dec 2024 | 16 Jan 2025 | 5 Dec 2025 |
| 692 | yashudas.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 693 | yashomangalam.com | Tucows Domains Inc. | 15 Dec 2014 | 16 Nov 2024 | 15 Dec 2025 |
| 694 | yashinpro.com | Everyones Internet, Ltd. dba SoftLayer | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 695 | yashrayfilms.com | Fabulous.com Pty Ltd. | 29 Nov 2005 | 4 Dec 2017 | 29 Nov 2018 |
| 696 | yashokithmini.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 697 | yashia.com | Annulet LLC | 3 Feb 2020 | 23 Mar 2025 | 3 Feb 2026 |
| 698 | yashengbj.com | Namesilo, LLC | 27 Jun 2018 | 21 Jun 2025 | 27 Jun 2026 |
| 699 | yashashwapandey.com | BigRock Solutions Ltd. | 15 Dec 2014 | 9 Dec 2016 | 15 Dec 2017 |
| 700 | yashangju.com | 1API GmbH | 17 Feb 2021 | 18 Feb 2021 | 17 Feb 2022 |
| 701 | yashrajconsulting.com | GoDaddy.com, LLC | 16 Dec 2014 | 17 Dec 2014 | 16 Dec 2015 |
| 702 | yashcorporation.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 31 Jul 2019 | 7 Jul 2025 | 31 Jul 2026 |
| 703 | yashasbatteries.com | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 704 | yashanisoverseas.com | GoDaddy.com, LLC | 17 Dec 2014 | 9 Dec 2024 | 17 Dec 2025 |
| 705 | yashalewis.com | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2019 |
| 706 | yashvaghela.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Dec 2014 | 17 Dec 2014 | 16 Dec 2015 |
| 707 | yashan520736124563.net | Foshan YiDong Network Co., LTD | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 708 | yashv.com | GoDaddy.com, LLC | 11 Dec 2019 | 14 Dec 2024 | 11 Dec 2025 |
| 709 | yashthakur.com | Google, Inc. | 31 Aug 2022 | 30 Oct 2024 | 31 Aug 2028 |
| 710 | yashinv.com | Beijing Lanhai Jiye Technology Co., Ltd | 18 Dec 2014 | 15 Aug 2025 | 18 Dec 2025 |
| 711 | yashilnic.com | NamePal.com #8024 | 16 Feb 2019 | 17 Feb 2019 | 16 Feb 2020 |
| 712 | yashaskaram.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2017 |
| 713 | yashoeconnect.com | Tucows Domains Inc. | 15 Dec 2013 | 19 Dec 2014 | 15 Dec 2015 |
| 714 | yashingquesada.com | Tucows Domains Inc. | 15 Dec 2013 | 19 Dec 2014 | 15 Dec 2015 |
| 715 | yasharnafisi.com | GoDaddy.com, LLC | 18 Dec 2014 | 16 Dec 2024 | 18 Dec 2025 |
| 716 | yasharlovesziba.com | Name.com, Inc. | 18 Dec 2014 | 26 Nov 2016 | 18 Dec 2017 |
| 717 | yashwantnagari.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Apr 2018 | 20 Apr 2018 | 20 Apr 2019 |
| 718 | yashavatsa.com | BigRock Solutions Ltd. | 19 Dec 2014 | 24 Apr 2020 | 19 Dec 2025 |
| 719 | yasharacareservices.com | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 720 | yashwantconsultancy.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 721 | yashpandya.net | BigRock Solutions Ltd. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 722 | yashmehta.net | GoDaddy.com, LLC | 9 Aug 2018 | 14 Aug 2025 | 9 Aug 2026 |
| 723 | yashidai.net | - | 18 Sep 2023 | 4 Oct 2024 | 18 Sep 2025 |
| 724 | yashfashionwatches.net | Domainshype.com, Inc. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 725 | yashwantnagar.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 726 | yashwantmehta.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 727 | yashveer.net | GoDaddy.com, LLC | 15 May 2020 | 15 May 2020 | 15 May 2021 |
| 728 | yashraheja.net | BigRock Solutions Ltd. | 19 Dec 2014 | 29 Dec 2014 | 19 Dec 2015 |
| 729 | yashuang.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 18 Dec 2006 | 12 May 2025 | 18 Dec 2026 |
| 730 | yashiofactory-eshop.com | Japan Registry Services Co., Ltd. | 22 Dec 2014 | 24 Nov 2016 | 22 Dec 2017 |
| 731 | yasheve.com | NameCheap, Inc. | 21 Dec 2014 | 10 Dec 2024 | 21 Dec 2025 |
| 732 | yashery.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2015 |
| 733 | yashyxswj.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Dec 2023 | 14 Aug 2025 | 26 Dec 2026 |
| 734 | yashrajexport.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2017 |
| 735 | yashpolyrub.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 736 | yashomaelectronics.com | Wild West Domains, LLC | 27 Oct 2007 | 28 Oct 2024 | 27 Oct 2025 |
| 737 | yashmit.biz | eNom, Inc. | 22 Dec 2014 | 22 Dec 2014 | 21 Dec 2015 |
| 738 | yashiquancn.com | - | 22 Apr 2022 | 24 Jun 2023 | 22 Apr 2023 |
| 739 | yashorg.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 740 | yashinnhotel.com | GoDaddy.com, LLC | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 741 | yashaswibharathagri.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 742 | yash-bearing.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 743 | yashuo2805.net | Foshan YiDong Network Co., LTD | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 744 | yashmit.net | eNom, Inc. | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 745 | yashinjp.net | Key-Systems GmbH | 22 Jul 2021 | 22 Jul 2021 | 22 Jul 2022 |
| 746 | yashprinting.com | GoDaddy.com, LLC | 18 Jan 2024 | 1 Mar 2025 | 18 Jan 2025 |
| 747 | yashioo.com | eName Technology Co., Ltd. | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 748 | yasharbar.com | GMO Internet Inc. | 13 Dec 2024 | 13 Dec 2024 | 13 Dec 2025 |
| 749 | yashangart.com | DROPCATCH.COM 762 LLC | 15 May 2023 | 15 Jun 2024 | 15 May 2024 |
| 750 | yashvilla.com | BigRock Solutions Ltd. | 25 Dec 2014 | 31 Dec 2024 | 25 Dec 2026 |
| 751 | yashuwang.com | TurnCommerce, Inc. DBA NameBright.com | 1 Sep 2018 | 11 Nov 2024 | 1 Sep 2024 |
| 752 | yashorganic.com | GoDaddy.com, LLC | 3 Aug 2025 | 4 Aug 2025 | 3 Aug 2026 |
| 753 | yashengjituan.com | GMO Internet Inc. | 2 Jun 2023 | 13 Jul 2024 | 2 Jun 2024 |
| 754 | yashtrader.com | Cloud Yuqu LLC | 23 Sep 2023 | 23 Sep 2023 | 23 Sep 2025 |
| 755 | yashodafashionmart.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 756 | yashilailaobi.com | Xin Net Technology Corporation | 22 Dec 2013 | 26 Dec 2014 | 22 Dec 2015 |
| 757 | yashidatechnologies.com | NameCheap, Inc. | 26 Dec 2014 | 17 Dec 2024 | 26 Dec 2025 |
| 758 | yashi.info | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Mar 2023 | 13 Feb 2025 | 9 Mar 2026 |
| 759 | yashidaaromatics.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Dec 2014 | 31 Dec 2024 | 27 Dec 2025 |
| 760 | yasheyishu.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 24 Dec 2013 | 27 Dec 2014 | 24 Dec 2015 |
| 761 | yashedesign.com | Beijing Lanhai Jiye Technology Co., Ltd | 9 Mar 2016 | 20 Jul 2025 | 9 Mar 2026 |
| 762 | yasha-overseas.com | Xin Net Technology Corporation | 23 Dec 2013 | 24 Dec 2016 | 23 Dec 2017 |
| 763 | yashcaterers.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Dec 2014 | 21 Dec 2019 | 27 Dec 2020 |
| 764 | yashcareermaker.net | Domainshype.com, Inc. | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 765 | yashu8.com | Eranet International Limited | 19 May 2022 | 25 Jul 2025 | 19 May 2025 |
| 766 | yashrajgandharv.com | - | - | - | - |
| 767 | yashproducts.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Dec 2018 | 9 Dec 2024 | 8 Dec 2025 |
| 768 | yashikatradelinks.com | - | - | - | - |
| 769 | yashaprabha.com | Tucows Domains Inc. | 25 Dec 2010 | 29 Dec 2014 | 25 Dec 2015 |
| 770 | yashtx.com | GoDaddy.com, LLC | 29 Dec 2014 | 30 Dec 2014 | 29 Dec 2015 |
| 771 | yashodacaterers.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2016 |
| 772 | yashikagroups.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2016 |
| 773 | yashodhanproperties.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 774 | yashiliao.com | Web Commerce Communications Limited dba WebNic.cc | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 775 | yashihuose.com | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 776 | yasha.info | Dynadot, LLC | 7 Aug 2025 | 7 Aug 2025 | 7 Aug 2026 |
| 777 | yashwedsvaishali.com | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 778 | yashworldprojects.com | GoDaddy.com, LLC | 8 Apr 2019 | 25 May 2020 | 8 Apr 2021 |
| 779 | yashodakidscare.com | Domainshype.com, Inc. | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 780 | yashvardhini.com | GoDaddy.com, LLC | 4 Dec 2019 | 4 Dec 2019 | 4 Dec 2021 |
| 781 | yashbhansali.com | GoDaddy.com, LLC | 2 Jan 2015 | 1 Feb 2023 | 2 Jan 2028 |
| 782 | yashinternationalpackers.com | Xin Net Technology Corporation | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 783 | yashihua.com | DOMAIN NAME NETWORK PTY LTD | 28 Nov 2024 | 29 Nov 2024 | 28 Nov 2025 |
| 784 | yashrajhospital.org | GoDaddy.com, LLC | 2 Jan 2015 | 4 Mar 2015 | 2 Jan 2020 |
| 785 | yashcomputers.net | NameCheap, Inc. | 17 Nov 2022 | 12 Dec 2024 | 17 Nov 2025 |
| 786 | yashitrading.com | DomainName Highway LLC | 28 Jul 2017 | 28 Jul 2017 | 28 Jul 2018 |
| 787 | yashikaautomation.com | BigRock Solutions Ltd. | 17 Jan 2025 | 17 Jan 2025 | 17 Jan 2026 |
| 788 | yashi.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Jul 2014 | 29 Jul 2017 | 10 Jul 2018 |
| 789 | yashpatel.xyz | NameCheap, Inc. | 7 Sep 2024 | 16 Sep 2024 | 7 Sep 2026 |
| 790 | yashu.wang | eName Technology Co., Ltd. | 19 Oct 2015 | 26 Apr 2017 | 19 Oct 2017 |
| 791 | yashqaraah.kitchen | GoDaddy.com, LLC | 19 Jul 2014 | 19 Jul 2014 | 19 Jul 2015 |
| 792 | yashe.wang | Xin Net Technology Corporation | 19 Jul 2014 | 18 Aug 2024 | 19 Jul 2024 |
| 793 | yashsolutions.xyz | Hostinger, UAB | 30 Dec 2016 | 8 Dec 2017 | 30 Dec 2018 |
| 794 | yashanet.xyz | Network Solutions, LLC | 10 Jul 2014 | 11 Jul 2014 | 10 Jul 2015 |
| 795 | yashafabric.xyz | Network Solutions, LLC | 29 Jul 2014 | 29 Jul 2014 | 29 Jul 2015 |
| 796 | yasha.xyz | NameCheap, Inc. | 7 Sep 2015 | 15 Nov 2024 | 7 Sep 2028 |
| 797 | yasha.tokyo | GMO Internet Inc. | 7 Aug 2014 | 7 Aug 2014 | 7 Aug 2015 |
| 798 | yashmith.actor | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Aug 2014 | 6 Aug 2014 | 6 Aug 2015 |
| 799 | yasheng.wang | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 15 Oct 2015 | 24 Jun 2017 | 15 Oct 2017 |
| 800 | yashua.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 5 Jan 2022 | 5 Jan 2022 | 5 Jan 2023 |
| 801 | yashiki.yokohama | GMO Internet Inc. | 10 Sep 2014 | 3 Oct 2023 | 10 Sep 2024 |
| 802 | yashiki.tokyo | GMO Internet Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 803 | yashwesdui.xyz | Xin Net Technology Corporation | 29 Sep 2014 | - | 29 Sep 2015 |
| 804 | yashhrui.xyz | Xin Net Technology Corporation | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 805 | yashoda.foundation | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 806 | yasha.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Sep 2014 | 9 Oct 2017 | 24 Sep 2018 |
| 807 | yashdoshi.photography | Porkbun, LLC | 3 Oct 2014 | 7 Oct 2024 | 3 Oct 2025 |
| 808 | yashilandai.wang | Foshan YiDong Network Co., LTD | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 809 | yashbook.today | GoDaddy.com, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 810 | yashang.wang | eName Technology Co., Ltd. | 22 Dec 2015 | 13 Apr 2017 | 22 Dec 2017 |
| 811 | yashili.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 5 Dec 2016 | 5 Dec 2016 | 5 Dec 2017 |
| 812 | yashiv.xyz | GoDaddy.com, LLC | 11 Aug 2015 | 12 Aug 2025 | 11 Aug 2026 |
| 813 | yashskincare.com | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 814 | yashiv.com | GoDaddy.com, LLC | 11 Aug 2015 | 12 Aug 2025 | 11 Aug 2026 |
| 815 | yashengxiang.com | - | 30 May 2022 | 1 Jul 2023 | 30 May 2023 |
| 816 | yashrajfilms.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 817 | yashiro.club | GMO Internet Inc. | 11 Nov 2014 | 15 Sep 2017 | 10 Nov 2018 |
| 818 | yashikraus.nyc | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 12 Nov 2015 |
| 819 | yashar.rocks | eNom, Inc. | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 820 | yashica.camera | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 821 | yashi.media | CSC Corporate Domains, Inc. | 16 Dec 2014 | - | 16 Dec 2025 |
| 822 | yashilandai.top | Namesilo, LLC | 21 Apr 2023 | 21 Apr 2023 | 21 Apr 2025 |
| 823 | yashili.xn--ses554g | Internet Domain Name System Beijing Engineering Re… | 5 Jan 2015 | - | 5 Feb 2017 |
| 824 | yashin.club | CommuniGal Communication Ltd. | 27 May 2022 | 6 May 2023 | 27 May 2023 |
| 825 | yashiki.red | GMO Internet Inc. | 12 Jan 2015 | 1 Jan 2025 | 12 Jan 2026 |
| 826 | yashodasolution.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 827 | yashi.date | Alpnames Limited | 12 Aug 2015 | - | 11 Aug 2016 |
| 828 | yashcomuter.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 829 | yashrajfilms.xyz | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 830 | yashiroyashiro.blue | GMO Internet Inc. | 31 Jan 2015 | - | 31 Jan 2016 |
| 831 | yashiro.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 832 | yashiro.tokyo | GMO Internet Inc. | 30 Jan 2015 | 28 Feb 2025 | 30 Jan 2026 |
| 833 | yashstarconsultancy.club | GoDaddy.com, LLC | 19 Feb 2015 | 19 Feb 2015 | 18 Feb 2017 |
| 834 | yashi.science | Alpnames Limited | 27 Feb 2015 | - | 26 Feb 2016 |
| 835 | yashidai.top | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Mar 2015 | - | 14 Mar 2016 |
| 836 | yashika.space | Hostinger, UAB | 16 Jan 2025 | 21 Jan 2025 | 16 Jan 2026 |
| 837 | yashraghav.science | Alpnames Limited | 26 Mar 2015 | - | 25 Mar 2016 |
| 838 | yashua.website | eNom, Inc. | 4 Apr 2015 | 5 Apr 2015 | 4 Apr 2016 |
| 839 | yashu123.com | - | 29 Mar 2022 | 1 Apr 2023 | 29 Mar 2023 |
| 840 | yashrao.com | GoDaddy.com, LLC | 15 Apr 2023 | 11 Apr 2025 | 15 Apr 2026 |
| 841 | yashmaniyar.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 842 | yashilandai1.com | - | 20 Jul 2022 | 21 Sep 2023 | 20 Jul 2023 |
| 843 | yashien.com | West263 International Limited | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2025 |
| 844 | yashengyiyao.com | Xin Net Technology Corporation | 27 Dec 2016 | 27 Dec 2016 | 27 Dec 2017 |
| 845 | yasharcapital.com | GoDaddy.com, LLC | 14 May 2019 | 15 May 2025 | 14 May 2026 |
| 846 | yashicastreet.ninja | eNom, Inc. | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 847 | yashica.ninja | eNom, Inc. | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 848 | yashixuan.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 3 Jul 2017 | 4 Jul 2017 | 3 Jul 2018 |
| 849 | yashio-shi.science | Alpnames Limited | 24 Feb 2015 | 30 Apr 2015 | 23 Feb 2016 |
| 850 | yashar.ninja | Name.com, Inc. | 5 May 2015 | 17 Jul 2017 | 5 May 2017 |
| 851 | yashshreecompany.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 852 | yashifayi.com | - | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 853 | yashw.com | GoDaddy.com, LLC | 26 Mar 2025 | 26 Mar 2025 | 26 Mar 2026 |
| 854 | yashsviandnandish.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 855 | yashoeshop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 856 | yashipioneers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 857 | yashicc.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 858 | yashakhandelwal02.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 859 | yashaicy.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 1 Oct 2024 | 1 Oct 2024 | 1 Oct 2025 |
| 860 | yash-choksi.com | Crazy Domains FZ-LLC | 6 Jan 2015 | 2 Dec 2016 | 6 Jan 2019 |
| 861 | yashautorepair.com | Domain.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 862 | yashvansinbillmart.com | GoDaddy.com, LLC | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 863 | yashtel.com | Name.com, Inc. | 31 May 2023 | 6 Jul 2025 | 31 May 2026 |
| 864 | yashojit.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2017 |
| 865 | yasheng777.com | eNom, Inc. | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 866 | yashoindusstries.com | - | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2017 |
| 867 | yashomala.com | Tucows Domains Inc. | 24 Oct 2024 | 10 Nov 2024 | 24 Oct 2025 |
| 868 | yashmatta.com | GoDaddy.com, LLC | 1 Jul 2023 | 1 Jul 2023 | 1 Jul 2026 |
| 869 | yashishi.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 7 May 2023 | 7 May 2023 | 7 May 2024 |
| 870 | yashicacreation.com | Dynadot, LLC | 17 Oct 2021 | 17 Oct 2021 | 17 Oct 2022 |
| 871 | yashfabtech.com | Hostinger, UAB | 12 Jan 2024 | 15 Jan 2025 | 12 Jan 2026 |
| 872 | yashblinds.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 873 | yashomala.org | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 874 | yashomala.net | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 875 | yashomala.info | GoDaddy.com, LLC | 9 Jan 2015 | - | 9 Jan 2016 |
| 876 | yashmatta.org | GoDaddy.com, LLC | 14 Sep 2016 | 26 Oct 2024 | 14 Sep 2024 |
| 877 | yashighazal.com | GoDaddy.com, LLC | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 878 | yashashreegroup.com | NameCheap, Inc. | 28 May 2020 | - | 28 May 2021 |
| 879 | yasharahlanation.com | GoDaddy.com, LLC | 10 Jan 2015 | 25 Jan 2025 | 10 Jan 2026 |
| 880 | yashvika.com | NameKing.com Inc. | 11 Oct 2023 | 12 Oct 2024 | 11 Oct 2025 |
| 881 | yashuyadav.com | BigRock Solutions Ltd. | 11 Jan 2015 | 12 Jan 2015 | 11 Jan 2016 |
| 882 | yashingroup.com | Domain.com, LLC | 18 Dec 2022 | 2 Mar 2025 | 18 Dec 2024 |
| 883 | yashbond.com | GoDaddy.com, LLC | 2 Nov 2021 | 14 Jan 2024 | 2 Nov 2023 |
| 884 | yashruti.net | Name.com, Inc. | 10 Jan 2015 | 19 Dec 2019 | 10 Jan 2021 |
| 885 | yashodhara.org | GoDaddy.com, LLC | 21 Sep 2017 | 21 Sep 2017 | 21 Sep 2018 |
| 886 | yashodhara.info | GoDaddy.com, LLC | 11 Jan 2015 | - | 11 Jan 2016 |
| 887 | yashservice.com | GoDaddy.com, LLC | 14 Jan 2024 | 4 Jan 2025 | 14 Jan 2026 |
| 888 | yashiman.net | HiChina Zhicheng Technology Limited | 30 Sep 2017 | 10 Oct 2017 | - |
| 889 | yashrajtantia.com | GoDaddy.com, LLC | 17 Dec 2021 | 17 Dec 2021 | 17 Dec 2022 |
| 890 | yashpalconstructions.com | BigRock Solutions Ltd. | 27 May 2019 | 27 May 2019 | 27 May 2021 |
| 891 | yashnursingbureau.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Apr 2022 | 4 Apr 2025 | 3 Apr 2026 |
| 892 | yashang888.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 15 Apr 2022 | 16 Apr 2023 | 15 Apr 2024 |
| 893 | yash1380.com | Realtime Register B.V. | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 894 | yashwantvidyalay.com | - | - | - | - |
| 895 | yashvivek.com | GoDaddy.com, LLC | 6 Aug 2022 | 14 Jul 2025 | 6 Aug 2026 |
| 896 | yashun2003.com | Web Commerce Communications Limited dba WebNic.cc | 7 Jun 2023 | 18 Aug 2024 | 7 Jun 2024 |
| 897 | yashrajglobalservices.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 898 | yashixin.com | Dynadot4 LLC | 7 Jun 2022 | 17 Aug 2023 | 7 Jun 2023 |
| 899 | yashitang.com | Realtime Register B.V. | 16 Jun 2024 | 17 Jun 2025 | 16 Jun 2026 |
| 900 | yashitaagro.com | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 901 | yashengwang.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 902 | yashang618.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 6 May 2021 | 7 May 2023 | 6 May 2024 |
| 903 | yasharoglu.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Jan 2015 | 9 Jan 2017 | 14 Jan 2018 |
| 904 | yashrajpilefoundation.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jan 2015 | 12 Jan 2017 | 16 Jan 2018 |
| 905 | yashodapublicschool.com | 1API GmbH | 1 Dec 2021 | 1 Dec 2021 | 1 Dec 2022 |
| 906 | yashiohukugyou.biz | GMO Internet Inc. | 16 Jan 2015 | 9 Aug 2015 | 15 Jan 2016 |
| 907 | yashiman.com | GMO Internet Inc. | 4 Sep 2025 | 4 Sep 2025 | 4 Sep 2026 |
| 908 | yashiltrade.com | Tucows Domains Inc. | 16 Jan 2015 | 20 Jan 2016 | 16 Jan 2017 |
| 909 | yashimatani.com | GMO Internet Inc. | 25 Apr 2015 | 5 Jun 2017 | 25 Apr 2018 |
| 910 | yashsolution.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 911 | yashun.wang | eName Technology Co., Ltd. | 17 May 2015 | 3 Oct 2016 | 17 May 2018 |
| 912 | yashpanwar.science | Alpnames Limited | 18 May 2015 | - | 17 May 2016 |
| 913 | yashita.xyz | GMO Internet Inc. | 22 May 2015 | 23 May 2015 | 22 May 2016 |
| 914 | yashirotyou.xyz | GMO Internet Inc. | 22 May 2015 | 23 May 2015 | 22 May 2016 |
| 915 | yashirotooru.xyz | GMO Internet Inc. | 22 May 2015 | 23 May 2015 | 22 May 2016 |
| 916 | yashirokoukoumae.xyz | GMO Internet Inc. | 22 May 2015 | 23 May 2015 | 22 May 2016 |
| 917 | yashiroda.xyz | GMO Internet Inc. | 22 May 2015 | 23 May 2015 | 22 May 2016 |
| 918 | yashiro.xyz | GMO Internet Inc. | 9 Jul 2024 | 10 Jul 2025 | 9 Jul 2026 |
| 919 | yashio.xyz | NameCheap, Inc. | 5 Apr 2023 | 17 May 2024 | 5 Apr 2024 |
| 920 | yashima.xyz | GMO Internet Inc. | 23 Nov 2016 | 7 Dec 2016 | 23 Nov 2017 |
| 921 | yashiki.xyz | GMO Internet Inc. | 22 May 2015 | 23 May 2015 | 22 May 2016 |
| 922 | yashe.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 May 2015 | 23 May 2015 | 23 May 2016 |
| 923 | yashu.webcam | Alpnames Limited | 28 May 2015 | 28 May 2015 | 27 May 2016 |
| 924 | yashmultiway.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 925 | yashili.rocks | eNom, Inc. | 14 Jun 2015 | 14 Jun 2015 | 14 Jun 2016 |
| 926 | yashite.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 927 | yashige.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 928 | yashang.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 929 | yashprint.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 930 | yashcommunications.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 931 | yashou.top | Todaynic.com Inc. | 15 Oct 2024 | 21 Mar 2025 | 15 Oct 2025 |
| 932 | yashioshihotels.review | Alpnames Limited | 3 Jul 2015 | - | 2 Jul 2016 |
| 933 | yashirohotels.review | Alpnames Limited | 4 Jul 2015 | - | 3 Jul 2016 |
| 934 | yashkinohotels.review | Alpnames Limited | 3 Jul 2015 | - | 2 Jul 2016 |
| 935 | yashen.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 12 Sep 2016 | 30 Jun 2017 | 12 Sep 2017 |
| 936 | yashanhotels.review | Alpnames Limited | 3 Jul 2015 | - | 2 Jul 2016 |
| 937 | yashma.gold | Regional Network Information Center, JSC dba RU-CE… | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2016 |
| 938 | yashilandaiys.com | Eranet International Limited | 31 Dec 2024 | 31 Dec 2024 | 31 Dec 2025 |
| 939 | yashengjie.com | - | 19 Jun 2023 | 20 Jul 2024 | 19 Jun 2024 |
| 940 | yashin.top | Namesilo, LLC | 28 Jan 2021 | 28 Jan 2021 | 28 Jan 2022 |
| 941 | yashanti.yoga | Tucows Domains Inc. | 11 Jul 2015 | 11 Jul 2015 | 11 Jul 2016 |
| 942 | yasha.club | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 25 May 2023 | 30 May 2023 | 25 May 2024 |
| 943 | yasheng.site | GMO Internet Inc. | 21 May 2025 | 28 May 2025 | 21 May 2026 |
| 944 | yasheng.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Jul 2015 | - | 23 Jul 2016 |
| 945 | yasheng.love | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Jul 2015 | - | 23 Jul 2016 |
| 946 | yashu.top | Shanghai Best Oray Information S&T Co., Ltd | 21 Jun 2023 | 5 Aug 2024 | 21 Jun 2026 |
| 947 | yashioshi.accountant | Alpnames Limited | 8 Aug 2015 | - | 7 Aug 2016 |
| 948 | yashierr.com | Hangzhou AiMing Network Co., LTD | 12 Oct 2021 | 12 Oct 2021 | 12 Oct 2022 |
| 949 | yashell.com | Google, Inc. | 1 Apr 2017 | 26 Apr 2024 | 1 Apr 2027 |
| 950 | yashyxgxs.com | Net-Chinese Co., Ltd. | 3 Aug 2022 | 3 Aug 2022 | 3 Aug 2023 |
| 951 | yashyxcl.com | Namesilo, LLC | 18 Apr 2019 | 19 Apr 2025 | 18 Apr 2026 |
| 952 | yashrajenterprise.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 953 | yashian.com | GoDaddy.com, LLC | 3 Feb 2025 | 17 Jun 2025 | 3 Feb 2026 |
| 954 | yasharismailoglu.com | Tucows Domains Inc. | 14 Jan 2011 | 19 Jan 2015 | 14 Jan 2016 |
| 955 | yashinn.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 May 2024 | 21 Jul 2025 | 20 May 2026 |
| 956 | yashinaent.com | BigRock Solutions Ltd. | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2017 |
| 957 | yashilpen.com | OnlineNIC, Inc. | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 958 | yashima-cpa.com | GMO Internet Inc. | 21 Jan 2015 | 6 Jan 2025 | 21 Jan 2026 |
| 959 | yashiduo.com | HiChina Zhicheng Technology Limited | 26 Jun 2018 | 26 Jun 2018 | 26 Jun 2019 |
| 960 | yashehome.com | DNSPod, Inc. | 7 Nov 2021 | 8 Dec 2023 | 7 Nov 2023 |
| 961 | yashiweb.info | Tucows Domains Inc. | 17 Aug 2015 | 21 Aug 2017 | 17 Aug 2018 |
| 962 | yashiwang.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Aug 2015 | 10 Aug 2025 | 17 Aug 2026 |
| 963 | yashwantvidyalay.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 964 | yashomandir.net | Domainshype.com, Inc. | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 965 | yashlaser.com | Hostinger, UAB | 13 May 2025 | 13 May 2025 | 13 May 2026 |
| 966 | yashchinfamily.com | eNom, Inc. | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2016 |
| 967 | yashagencies.com | GoDaddy.com, LLC | 26 Jun 2018 | 7 Sep 2024 | 26 Jun 2024 |
| 968 | yash-associates.com | Hostinger, UAB | 3 Apr 2025 | 3 Apr 2025 | 3 Apr 2026 |
| 969 | yashship.com | GoDaddy.com, LLC | 23 Jan 2015 | 6 Mar 2025 | 23 Jan 2025 |
| 970 | yasheli.com | HiChina Zhicheng Technology Limited | 18 Apr 2020 | 19 Apr 2025 | 18 Apr 2026 |
| 971 | yashamotors.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 972 | yashvicollection.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jan 2015 | 12 Jan 2017 | 24 Jan 2018 |
| 973 | yashyuh.com | Xin Net Technology Corporation | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 974 | yashatours.com | Bizcn.com, Inc. | 22 Sep 2017 | 22 Sep 2017 | 22 Sep 2018 |
| 975 | yashviparikh.com | GoDaddy.com, LLC | 27 Jan 2015 | 28 Jan 2025 | 27 Jan 2026 |
| 976 | yashyxlsj.com | Xin Net Technology Corporation | 28 Jan 2015 | 13 Jan 2017 | 28 Jan 2018 |
| 977 | yashyuoreyere.com | GMO Internet Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 978 | yashypydnysc.com | GMO Internet Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 979 | yashybanssyos.com | GMO Internet Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 980 | yashpolychem.com | GoDaddy.com, LLC | 12 Oct 2022 | 24 Oct 2024 | 12 Oct 2025 |
| 981 | yashilai.com | DropCatch.com 1315 LLC | 11 Apr 2024 | 12 Apr 2024 | 11 Apr 2026 |
| 982 | yashforgings.com | Hostinger, UAB | 28 Oct 2024 | 28 Dec 2024 | 28 Oct 2025 |
| 983 | yashannet.com | Key-Systems GmbH | 20 Mar 2025 | 22 Mar 2025 | 20 Mar 2026 |
| 984 | yashang2015.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Aug 2015 | - | 19 Aug 2016 |
| 985 | yashwantinternational.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Aug 2015 | 29 Nov 2016 | 18 Aug 2017 |
| 986 | yashingloves.com | - | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2017 |
| 987 | yashifu.com | - | 1 Nov 2024 | 1 Nov 2024 | 1 Nov 2025 |
| 988 | yashvi.us | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 26 Jan 2016 |
| 989 | yashussunlimitedbusinesssolutions.com | GoDaddy.com, LLC | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 990 | yashussunlimited.com | GoDaddy.com, LLC | 29 Jan 2015 | 13 Jan 2025 | 29 Jan 2026 |
| 991 | yashraval.com | Name.com, Inc. | 11 Jan 2018 | 20 Dec 2024 | 11 Jan 2026 |
| 992 | yashmurty.com | GoDaddy.com, LLC | 29 Jan 2015 | 26 Jan 2024 | 29 Jan 2026 |
| 993 | yashindustry.com | GoDaddy.com, LLC | 11 Jan 2022 | 10 Jan 2025 | 11 Jan 2026 |
| 994 | yashangsuo.com | HiChina Zhicheng Technology Limited | 14 Apr 2018 | 15 Apr 2025 | 14 Apr 2026 |
| 995 | yashorganic.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 996 | yashrajfilmas.com | Fabulous.com Pty Ltd. | 17 Jan 2006 | 18 Jan 2017 | 17 Jan 2018 |
| 997 | yashiwanbo.com | eNom, Inc. | 26 Sep 2016 | 28 Aug 2024 | 26 Sep 2025 |
| 998 | yashilaconsulting.com | Google, Inc. | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 999 | yashasviagrotech.com | Hostinger, UAB | 19 Oct 2023 | 23 Oct 2024 | 19 Oct 2025 |
| 1000 | yashagrotech.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
Displaying 1,000 out of 20,886 domains starting with the keyword "YASH". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=yash
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |