Our database now contains whois records of 641 Million (641,574,399) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [641 Million Domains] $10,000 Details

Keyword: XSERVICE

Reverse Whois » KEYWORD [xservice ]  { 203 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1xservice.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 Feb 201731 Aug 202322 Feb 2027
2xservice.onlineNameCheap, Inc.15 Jun 20251 Jul 202515 Jun 2026
3xservice.marketAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Nov 201510 Jan 201719 Nov 2017
4xservice.org-14 Sep 202227 Apr 202514 Sep 2025
5xservice.bizPDR Ltd. d/b/a PublicDomainRegistry.com26 Feb 201026 Feb 202425 Feb 2024
6xservice.comGoDaddy.com, LLC21 Apr 199831 Mar 202520 Apr 2026
7xservice.infoNameCheap, Inc.15 Sep 2025-15 Sep 2026
8xservice.cloudTucows Domains Inc.7 Mar 20245 Mar 20257 Mar 2026
9xservice.menPDR Ltd. d/b/a PublicDomainRegistry.com4 Oct 20174 Oct 20174 Oct 2018
10xservice.co.uk-21 Mar 20143 Apr 202421 Mar 2026
11xservice.siteGMO Internet Inc.24 Oct 201913 Oct 202024 Oct 2021
12xservice.winNameCheap, Inc.30 Mar 20184 Apr 201830 Mar 2019
13xservice.clubNameCheap, Inc.17 Jul 2021-17 Jul 2022
14xservice.net-13 Jun 20245 Jul 202513 Jun 2026
15xservice.proHostinger, UAB12 Jan 202517 Jan 202512 Jan 2026
16xservice.digitalNameCheap, Inc.30 Jun 202030 Jun 202030 Jun 2021
17xservice.techWest263 International Limited10 Jan 202519 Feb 202510 Jan 2026
18xservice.websiteLimited Liability Company "Registrar of domain nam…1 Mar 20211 Mar 20211 Mar 2022
19xservice.uk-31 Jul 202223 Jul 202431 Jul 2024
20xservice.coNameKing.com Inc.14 Dec 202121 Mar 202214 Dec 2022
21xservice.appGoogle, Inc.17 Mar 201926 Jun 202517 Mar 2026
22xservice.worldRegional Network Information Center, JSC dba RU-CE…20 Oct 202220 Oct 202220 Oct 2023
23xservice.groupRegional Network Information Center, JSC dba RU-CE…20 Oct 202220 Oct 202220 Oct 2023
24xservice.expertRegional Network Information Center, JSC dba RU-CE…20 Oct 202220 Oct 202220 Oct 2023
25xservice.supportPDR Ltd. d/b/a PublicDomainRegistry.com25 Oct 202223 Oct 202425 Oct 2025
26xservice.consultingPDR Ltd. d/b/a PublicDomainRegistry.com20 Dec 202218 Dec 202420 Dec 2025
27xservice.devPorkbun, LLC5 Jan 202316 Mar 20245 Jan 2024
28xservice.com.cn-28 Jan 2016-28 Jan 2027
29xservice.md-31 Jan 2018-31 Jan 2025
30xservice.it-11 Aug 19978 Oct 202422 Sep 2025
31xservice.linkAmazon Registrar, Inc.8 Jun 20229 May 20258 Jun 2026
32xservice.meGoDaddy.com, LLC20 Jun 202220 Jun 202320 Jun 2024
33xservice.nl-6 Jan 201723 Dec 2017-
34xservice.com.pl-28 Jun 201026 Jun 202528 Jun 2026
35xservice.ro-4 Mar 2009-1 Jul 2028
36xservice.by-23 Jan 202523 Jan 202523 Jan 2026
37xservice.businessPDR Ltd. d/b/a PublicDomainRegistry.com3 Aug 20236 Aug 20253 Aug 2026
38xservice.storeDattatec.com SRL11 Dec 202416 Dec 202411 Dec 2025
39xservice.com.br-29 Jun 200814 Jun 202129 Jun 2031
40xservice.ai-17 Aug 202316 Sep 202517 Aug 2025
41xservice.ru-16 Mar 2023-16 Mar 2026
42xservice.su-28 May 2015-28 May 2026
43xservice.dealsPDR Ltd. d/b/a PublicDomainRegistry.com13 May 202411 May 202513 May 2026
44xservice.vipDynadot, LLC18 Jan 202526 Mar 202518 Jan 2031
45xservice.topDNSPod, Inc.18 Mar 202518 Mar 202518 Mar 2026
46xservice.spaceGoDaddy.com, LLC19 Mar 202525 Apr 202519 Mar 2026
47xservice.ioGoDaddy.com, LLC14 Sep 202515 Sep 202514 Sep 2026
48xservicesprovider.com1API GmbH31 Oct 201431 Oct 201431 Oct 2015
49xservicesa.comTucows Domains Inc.27 Jun 20141 Jul 201527 Jun 2016
50xserviceoncall.comCrazy Domains FZ-LLC11 Nov 201520 Nov 201611 Nov 2017
51xserviceonline.comGoDaddy.com, LLC18 Jan 202118 Jan 202118 Jan 2022
52xservices.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 May 20232 Jul 202425 May 2024
53xservicetercerizacao.comPSI-USA, Inc. dba Domain Robot26 Jan 201626 Jan 201626 Jan 2017
54xservices.bizOVH sas19 Mar 202524 Mar 202519 Mar 2026
55xservices.orgGoDaddy.com, LLC19 May 201614 Jul 202419 May 2026
56xservices-indonesia.comInternet Domain Services BS Corp11 Jul 201612 Jul 201711 Jul 2017
57xservices-malaysia.comInternet Domain Services BS Corp11 Jul 201612 Jul 201711 Jul 2017
58xserviceng.comWeb4Africa Inc12 Sep 201624 Oct 201712 Sep 2017
59xservice1.linkAlpnames Limited16 Sep 201616 Sep 201716 Sep 2018
60xservicetech.comHiChina Zhicheng Technology Limited1 Jun 20141 Jun 20141 Jun 2017
61xservicesgroup.comTurnCommerce, Inc. DBA NameBright.com17 Nov 201813 Feb 202517 Nov 2025
62xservicehub.comGoDaddy.com, LLC4 Dec 202315 Feb 20254 Dec 2024
63xservices.comNetwork Solutions, LLC3 Feb 19976 Dec 20244 Feb 2026
64xservicesrl.comGoDaddy.com, LLC24 Jun 201417 Jun 201624 Jun 2017
65xservicejobs.comeNom, Inc.19 May 20131 Jul 202419 May 2024
66xservices.netGoDaddy.com, LLC14 Mar 200031 May 202416 Jun 2029
67xserviceterceirizacao.com-19 Oct 201619 Oct 201619 Oct 2017
68xservices.cloudTucows Domains Inc.7 Mar 20245 Mar 20257 Mar 2026
69xservicemen.comDomainPrime.com LLC10 Mar 201211 Mar 201710 Mar 2018
70xservice-bofaadmin2.comInterweb Advertising D.B.A. Profile Builder12 Dec 201614 Dec 201712 Dec 2017
71xservicebase.comGoDaddy.com, LLC28 Jan 201728 Jan 201728 Jan 2018
72xservicex.comXin Net Technology Corporation1 Feb 20171 Feb 20171 Feb 2018
73xservicecloud.comGoDaddy.com, LLC22 Apr 20172 Oct 202231 Dec 2025
74xservicegroup.co.ukPras Web Tech Pvt. Ltd.24 Apr 201724 Apr 201724 Apr 2019
75xservicesn.comOVH sas12 Jul 201712 Jul 201712 Jul 2018
76xservicecenter.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Aug 20172 Aug 20172 Aug 2018
77xserviceapp.comGoDaddy.com, LLC26 Jul 20236 Sep 202426 Jul 2024
78xservicewellsfargoadminonl.netGoogle, Inc.7 Dec 20178 Dec 20177 Dec 2018
79xservices.co.uk-23 Sep 200524 Aug 202523 Sep 2026
80xservices-gov.co.ukregister.com, Inc.31 Jan 201731 Jan 201731 Jan 2018
81xservices.onlineHostinger, UAB5 Nov 202410 Nov 20245 Nov 2025
82xservicedoc.comShinjiru MSC Sdn Bhd13 Jun 201813 Jun 201813 Jun 2019
83xservicepayment.comGoogle, Inc.4 Jul 20184 Jul 20184 Jul 2019
84xservicedelhi.comGoDaddy.com, LLC13 Aug 201813 Aug 201813 Aug 2019
85xserviceaccountalert-apple.comGoogle, Inc.14 Sep 201814 Sep 201814 Sep 2019
86xserviceaccountalertapple.comGoogle, Inc.14 Sep 201814 Sep 201814 Sep 2019
87xserviceaccountalert.comGoogle, Inc.14 Sep 201814 Sep 201814 Sep 2019
88xservicegroup.comTucows Domains Inc.12 Apr 202214 Apr 202512 Apr 2026
89xserviceshop.comGoogle, Inc.13 Jul 202328 Jun 202513 Jul 2026
90xservicelivrasionssl.infoGoDaddy.com, LLC3 Jan 20193 Jan 20193 Jan 2020
91xservicecentre.comGoogle, Inc.19 Feb 201920 Feb 201919 Feb 2020
92xserviceresolutioncentre.comGoogle, Inc.19 Feb 201920 Feb 201919 Feb 2020
93xservicescentre.comGoogle, Inc.19 Feb 201920 Feb 201919 Feb 2020
94xserviceccendolgan.comGoogle, Inc.20 Feb 201920 Feb 201920 Feb 2020
95xserviceccendolgan.netGoogle, Inc.20 Feb 201920 Feb 201920 Feb 2020
96xserviceccendolgan.businessGoogle, Inc.20 Feb 201925 Feb 201920 Feb 2020
97xservicefo.comWeb Commerce Communications Limited dba WebNic.cc24 Apr 201924 Apr 201924 Apr 2020
98xserviceapplservicepaymntinfrmtn9704.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
99xserviceapplservicepaymntinfrmtn9707.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
100xserviceapplservicepaymntinfrmtn9703.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
101xserviceapplservicepaymntinfrmtn9708.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
102xserviceapplservicepaymntinfrmtn9705.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
103xserviceapplservicepaymntinfrmtn9710.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
104xserviceapplservicepaymntinfrmtn9702.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
105xserviceapplservicepaymntinfrmtn9701.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
106xserviceapplservicepaymntinfrmtn9706.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
107xserviceapplservicepaymntinfrmtn9709.comGoogle, Inc.10 Oct 201910 Oct 201910 Oct 2020
108xserviceapplsepaymntinfrmtnbvserw97020.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
109xserviceapplsepaymntinfrmtnbvserw97016.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
110xserviceapplsepaymntinfrmtnbvserw97017.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
111xserviceapplsepaymntinfrmtnbvserw97018.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
112xserviceapplsepaymntinfrmtnbvserw97019.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
113xserviceapplsepaymntinfrmtnbvserw97012.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
114xserviceapplsepaymntinfrmtnbvserw97014.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
115xserviceapplsepaymntinfrmtnbvserw97015.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
116xserviceapplsepaymntinfrmtnbvserw97013.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
117xserviceapplsepaymntinfrmtnbvserw97011.comGoogle, Inc.13 Oct 201913 Oct 201913 Oct 2020
118xservicez.comGoDaddy.com, LLC15 Oct 201915 Oct 201915 Oct 2020
119xservice360.comGoDaddy.com, LLC11 Nov 201911 Nov 201911 Nov 2020
120xserviceindustry.comGoDaddy.com, LLC1 Dec 20202 Dec 20241 Dec 2025
121xserviceindustries.comGoDaddy.com, LLC1 Dec 20202 Dec 20241 Dec 2025
122xservicepayxy.infoNameCheap, Inc.10 Dec 202010 Dec 202010 Dec 2021
123xservicepay.infoNameCheap, Inc.10 Dec 202010 Dec 202010 Dec 2021
124xservicemanplumbing.comGoDaddy.com, LLC9 Jan 20219 Jan 20219 Jan 2022
125xservicedebtcollection.comWild West Domains, LLC22 Apr 202122 Apr 202122 Apr 2022
126xservice-company.com1&1 Internet AG22 May 202122 May 202122 May 2022
127xservice-78.onlineBeget LLC11 Aug 202111 Aug 202111 Aug 2022
128xservice78.onlineBeget LLC11 Aug 202111 Aug 202111 Aug 2022
129xservicescompany.comGoogle, Inc.22 Aug 202122 Sep 202422 Aug 2024
130xservicehome.onlineHostinger, UAB31 Aug 202131 Aug 202131 Aug 2022
131xservice-4u.artNamesilo, LLC13 Sep 202113 Sep 202113 Sep 2022
132xservices.techNameCheap, Inc.8 Oct 20218 Oct 20218 Oct 2022
133xservicemsk.storeBeget LLC13 Oct 202113 Oct 202113 Oct 2022
134xservicesx.comGoDaddy.com, LLC24 Oct 202118 Oct 202424 Oct 2029
135xservices.xyzEpik Inc.2 Nov 202118 Dec 20242 Nov 2025
136xservices.topNamesilo, LLC21 Nov 202121 Nov 202421 Nov 2025
137xserviceshub.comGoDaddy.com, LLC4 Jan 20225 Jan 20254 Jan 2026
138xservicess.comAutomattic Inc.9 Feb 20224 May 20249 Feb 2025
139xservices.de--7 Aug 2024-
140xserviceplus.comPDR Ltd. d/b/a PublicDomainRegistry.com19 May 202230 Jun 202319 May 2023
141xservice1244.comGoDaddy.com, LLC26 Jun 202231 Dec 202426 Jun 2026
142xservices.coAbove.com Pty Ltd.19 May 202524 May 202519 May 2026
143xservicecardinfo.comWix.com Ltd.8 Nov 20228 Nov 20228 Nov 2023
144xservices.ccNameCheap, Inc.10 Nov 202222 Jan 202410 Nov 2023
145xserviceone.comGoogle, Inc.23 Nov 20223 Feb 202523 Nov 2024
146xservices.pl-1 Dec 20169 Oct 20241 Dec 2025
147xservices.in1&1 Internet AG2 Dec 20222 Dec 20242 Dec 2024
148xservicesnigeria.orgGoDaddy.com, LLC8 Dec 202218 Feb 20258 Dec 2024
149xservicesxcablex251.comregister.com, Inc.15 Jan 202315 Jan 202315 Jan 2024
150xservices.africaDomain Name Services (Pty) Ltd2 Jun 202212 Jun 20232 Jun 2023
151xserviceplus.beOne.com A/S5 Feb 2007--
152xservices.feedbackTLD Registrar Solutions Ltd.25 Jan 20233 Apr 202425 Jan 2026
153xservicecu.infoNamesilo, LLC25 Feb 202329 Apr 202425 Feb 2024
154xservicensewave.siteHostinger, UAB3 Mar 20239 May 20243 Mar 2024
155xservice-premium.comGMO Internet Inc.10 Mar 202320 Apr 202410 Mar 2024
156xservicelao.comName.com, Inc.14 Mar 202027 May 202514 Mar 2025
157xservicecu.proNamesilo, LLC18 Mar 202325 May 202418 Mar 2024
158xservice-mi.it-8 Oct 200724 Oct 20248 Oct 2025
159xservices.it-12 May 202226 May 202312 May 2023
160xservicesrl.it-28 Feb 200616 Mar 202528 Feb 2026
161xservices.nlOne.com A/S29 Sep 200021 Nov 2019-
162xserviceshopcar.comWix.com Ltd.16 Jul 202326 Aug 202416 Jul 2024
163xservices.spaceOVH sas20 Jul 202317 Aug 202420 Jul 2024
164xservicevtk.topChengdu West Dimension Digital Technology Co., Ltd…3 Jul 202316 Aug 20243 Jul 2024
165xservicesapp.comGoDaddy.com, LLC26 Jul 20236 Sep 202426 Jul 2024
166xservice12440.comGoDaddy.com, LLC27 Sep 202327 Sep 202327 Sep 2025
167xservicepros.comGoDaddy.com, LLC29 Sep 20238 Oct 202329 Sep 2025
168xservices.net.br-13 Nov 202326 Nov 202413 Nov 2025
169xservicemall.comGoDaddy.com, LLC24 Nov 202324 Nov 202324 Nov 2025
170xservices.uk-10 Apr 202410 Apr 202410 Apr 2025
171xservicedebtcollection.com.au--18 Apr 2025-
172xservices.pt----
173xservicesroad.comHostinger, UAB16 Apr 202416 Jun 202416 Apr 2026
174xservice-task.ru-21 May 2021-21 May 2024
175xservice-tehniki.ru-20 Jun 2023-20 Jun 2024
176xservice35.ru-8 Sep 2022-8 Sep 2025
177xservices.ru-21 Feb 2018-21 Feb 2026
178xservice-999.ru-27 Aug 2021-27 Aug 2026
179xservices.fr-19 Oct 202230 Nov 202419 Oct 2025
180xservices.sk-27 Mar 20149 Apr 202527 Mar 2026
181xserviceoficina.comHostinger, UAB27 Jun 202431 May 202527 Jun 2026
182xservicesco.comGoDaddy.com, LLC9 Aug 202410 Aug 20259 Aug 2026
183xserviceappz.ru-2 Sep 2024-2 Sep 2025
184xserviceappz.storeBeget LLC2 Sep 20243 Sep 20252 Sep 2026
185xservicegood.siteNameCheap, Inc.17 Sep 202424 Sep 202417 Sep 2025
186xservices.co.inGoDaddy.com, LLC22 Dec 202230 May 202522 Dec 2025
187xservicescfd.proHostinger, UAB31 Oct 20249 Dec 202431 Oct 2025
188xservices.meChengdu West Dimension Digital Technology Co., Ltd…8 Nov 20244 Jun 20258 Nov 2025
189xservicefut.cyou-11 Nov 20249 Jun 202511 Nov 2025
190xservicefut.icu-11 Nov 202410 Jun 202511 Nov 2025
191xservices-hotline.comNamesilo, LLC26 Nov 202426 Nov 202426 Nov 2025
192xservicescfd.comNordreg AB2 Dec 202410 Dec 20242 Dec 2025
193xservicescfd.xyzHostinger, UAB10 Dec 202415 Dec 202410 Dec 2025
194xservicecougarswiftlmessageboxreceiver.comNameCheap, Inc.20 Mar 2025-20 Mar 2026
195xservices.tvMarkMonitor Inc.18 Feb 200722 Jan 202518 Feb 2026
196xservicenet.email-25 Jun 202525 Jun 202525 Jun 2026
197xservicenet.orgCloudFlare, Inc.24 Jun 202529 Jun 202524 Jun 2026
198xservicetmsh.onlineLimited Liability Company "Registrar of domain nam…11 Jul 20258 Sep 202511 Jul 2026
199xservicetmsh.ru-11 Jul 2025-11 Jul 2026
200xservicedesk.com-5 Sep 20257 Sep 20255 Sep 2026
201xservices.ioGoDaddy.com, LLC14 Sep 202514 Sep 202514 Sep 2026
202xservices.org.cn-3 Sep 2025-3 Sep 2026
203xservices.cz-21 Mar 201721 Mar 201721 Mar 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=xservice

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now