Our database now contains whois records of 637 Million (637,289,939) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [637 Million Domains] $10,000 Details

Keyword: WWWGOOGLE

Reverse Whois » KEYWORD [wwwgoogle ]  { 424 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1wwwgoogle.it-31 Oct 20186 Feb 202531 Oct 2025
2wwwgoogle.fr-26 Nov 201415 Nov 202412 Nov 2025
3wwwgoogle.pl-15 May 200312 Apr 202514 May 2026
4wwwgoogle.comMarkMonitor Inc.3 Mar 199930 Jan 20253 Mar 2026
5wwwgoogle.es----
6wwwgoogle.infoNetwork Solutions, LLC20 Jan 202410 Jan 202520 Jan 2026
7wwwgoogle.usDynadot, LLC11 Jul 202311 Jul 202411 Jul 2024
8wwwgoogle.clickName.com, Inc.29 Nov 201429 Nov 201429 Nov 2015
9wwwgoogle.xyz-29 Jun 20254 Jul 202529 Jun 2026
10wwwgoogle.bizeName Technology Co., Ltd.26 Nov 201523 May 201625 Nov 2016
11wwwgoogle.mobi-8 Jan 20168 Mar 20168 Jan 2017
12wwwgoogle.vipDynadot, LLC16 Jun 202217 Jun 202316 Jun 2023
13wwwgoogle.inDynadot, LLC4 Mar 202016 Sep 20214 Mar 2026
14wwwgoogle.coMarkMonitor Inc.16 Sep 201019 Aug 202515 Sep 2026
15wwwgoogle.at--7 Aug 2024-
16wwwgoogle.orgSquarespace Domains LLC16 Dec 202421 Dec 202416 Dec 2025
17wwwgoogle.co.nz-24 Jul 201722 Jan 201824 Jul 2018
18wwwgoogle.de--12 Mar 2018-
19wwwgoogle.com.au--19 Jun 2025-
20wwwgoogle.com.cn????????????28 Feb 2005-28 Feb 2026
21wwwgoogle.pt-5 Jul 2012-5 Jun 2026
22wwwgoogle.com.uaHosting Art, B.V.1 Nov 2013-1 Nov 2016
23wwwgoogle.ch----
24wwwgoogle.ca-2 May 20021 May 20252 May 2026
25wwwgoogle.kzHostserver GmbH18 Jun 200913 Nov 2016-
26wwwgoogle.cz-27 Oct 200413 Jan 202527 Oct 2025
27wwwgoogle.no-21 Sep 201521 Sep 2015-
28wwwgoogle.netMarkMonitor Inc.12 Feb 200211 Jan 202512 Feb 2026
29wwwgoogle.com.my-9 Aug 201026 Jul 20169 Aug 2017
30wwwgoogle.cn-25 Dec 2015-25 Dec 2025
31wwwgoogle.ie-22 Oct 2013-22 Oct 2017
32wwwgoogle.co.inKey-Systems GmbH4 Oct 202118 Nov 20244 Oct 2025
33wwwgoogle.dk-26 Jun 2024-25 Jun 2026
34wwwgoogle.eu----
35wwwgoogle.com.br-18 May 199916 Apr 202518 May 2026
36wwwgoogle.co.uk-13 Jun 20248 Jul 202413 Jun 2025
37wwwgoogle.com.coAbove.com Pty Ltd.3 Sep 202314 Oct 20243 Sep 2024
38wwwgoogle.meAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
39wwwgoogle.gr----
40wwwgoogle.com.mxMarkMonitor Inc.4 Sep 20031 Aug 20163 Sep 2017
41wwwgoogle.com.tw-24 Mar 2015-24 Mar 2018
42wwwgoogle.co.za-28 Nov 200427 Oct 201628 Nov 2017
43wwwgoogle.beKey-Systems GmbH30 Apr 2023--
44wwwgoogle.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 Mar 202517 Mar 202517 Mar 2026
45wwwgoogle.asiaMarkMonitor Inc.3 Mar 20084 Feb 20253 Mar 2026
46wwwgoogle.siteregister.com, Inc.18 Jan 202331 Mar 202418 Jan 2024
47wwwgoogle.cc-5 Jun 20164 Jul 20255 Jun 2027
48wwwgoogle.pwKey-Systems GmbH28 Dec 201910 Feb 202428 Dec 2023
49wwwgoogle.domainsGoogle, Inc.19 Nov 202119 Nov 202219 Nov 2023
50wwwgoogle.co.kr-8 Aug 200111 Jul 20208 Aug 2023
51wwwgoogle.oneGoogle, Inc.22 Jan 202228 Jan 202322 Jan 2024
52wwwgoogle.cloudNameKing.com Inc.28 Mar 202211 May 202428 Mar 2024
53wwwgoogle.jp-22 May 20221 Jun 202330 Jun 2023
54wwwgoogle.storeTucows Domains Inc.9 Feb 202321 Mar 20249 Feb 2024
55wwwgoogle.dayGoogle, Inc.8 Mar 202219 May 20258 Mar 2025
56wwwgoogle.pageGoogle, Inc.27 Apr 202127 Apr 202327 Apr 2024
57wwwgoogle.uk-17 Jun 202530 Jul 202517 Jun 2026
58wwwgoogle.ro-6 Oct 2004-6 Jan 2026
59wwwgoogle.nl-8 Aug 201426 Nov 2024-
60wwwgoogle.ioAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
61wwwgoogle.newsAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
62wwwgoogle.clubNamesilo, LLC26 Oct 202329 Nov 202426 Oct 2024
63wwwgoogle.clMarkMonitor Inc.9 Aug 2010-24 Jun 2026
64wwwgoogle.cm-2 Sep 20237 Oct 20232 Sep 2024
65wwwgoogle.au--14 Mar 2025-
66wwwgoogle.ru-6 Feb 2004-6 Feb 2026
67wwwgoogle.se-21 Jul 20061 Jul 202521 Jul 2026
68wwwgoogle.sk-25 Aug 202326 Aug 20244 Oct 2024
69wwwgoogle.shopGMO Internet Inc.21 May 202428 Jun 202421 May 2025
70wwwgoogle.onlineGoDaddy.com, LLC27 Nov 202427 Jan 202527 Nov 2025
71wwwgooglestar.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Oct 201430 Oct 201430 Oct 2015
72wwwgoogletranslate.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
73wwwgoogledownload.comMarkMonitor Inc.8 Jul 20226 Jun 20258 Jul 2026
74wwwgooglemail.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
75wwwgooglesniper.comGoDaddy.com, LLC29 Sep 201429 Sep 201429 Sep 2015
76wwwgoogleflights.comPSI-USA, Inc. dba Domain Robot22 Sep 201412 Nov 202422 Sep 2025
77wwwgoogle-flights.comPSI-USA, Inc. dba Domain Robot22 Sep 201422 Sep 201422 Sep 2015
78wwwgoogleexpress.comGoogle, Inc.1 Jan 20191 Jan 20191 Jan 2020
79wwwgooglemerchandisestore.comDynadot, LLC11 Dec 201412 Dec 201411 Dec 2015
80wwwgooglecom.scienceAlpnames Limited25 Mar 2015-24 Mar 2016
81wwwgooglefeud.comAbove.com Pty Ltd.7 Sep 202318 Oct 20247 Sep 2024
82wwwgooglewww.comGMO Internet Inc.3 Sep 20173 Sep 20173 Sep 2018
83wwwgoogleglass.comHiChina Zhicheng Technology Limited7 May 20157 May 20157 May 2016
84wwwgoogleplay.comGoDaddy.com, LLC26 May 20155 Mar 202526 May 2026
85wwwgooglede.comFabulous.com Pty Ltd.24 Sep 201524 Sep 201524 Sep 2016
86wwwgoogleclassroom.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
87wwwgooglejunior.comGoDaddy.com, LLC10 Dec 201510 Dec 201510 Dec 2016
88wwwgoogledrive.comHiChina Zhicheng Technology Limited24 Feb 202125 Feb 202524 Feb 2025
89wwwgoogledomains.comGoogle, Inc.31 Aug 201831 Aug 201831 Aug 2019
90wwwgooglesearch.winAlpnames Limited8 Feb 2016-7 Feb 2017
91wwwgoogleblog.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
92wwwgooglegmail.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
93wwwgoogletagmanager.comGoDaddy.com, LLC18 Apr 202319 Apr 202518 Apr 2027
94wwwgooglepl.comXin Net Technology Corporation30 Aug 201830 Aug 201830 Aug 2019
95wwwgooglesex.comDomain.com, LLC26 Jun 201626 Jun 201626 Jun 2017
96wwwgoogleme.com-11 Aug 201611 Aug 201611 Aug 2017
97wwwgoogler.comAbove.com Pty Ltd.27 Aug 20238 Oct 202427 Aug 2024
98wwwgoogledotcom.comGransy s.r.o. d/b/a subreg.cz20 Sep 202120 Sep 202220 Sep 2022
99wwwgooglesearchbuffie.comGoogle, Inc.13 Sep 201613 Oct 201713 Sep 2017
100wwwgooglecomsearchqbuffie.comGoogle, Inc.13 Sep 201613 Oct 201713 Sep 2017
101wwwgooglein.comFabulous.com Pty Ltd.21 May 201224 Jul 201721 May 2018
102wwwgooglecrom.comGoDaddy.com, LLC11 Oct 202223 Dec 202311 Oct 2023
103wwwgoogleoogle.comMarkMonitor Inc.8 Aug 20027 Jul 20258 Aug 2026
104wwwgooglen.comAbove.com Pty Ltd.30 Aug 202310 Oct 202430 Aug 2024
105wwwgoogleplus.comGoDaddy.com, LLC5 Apr 202417 Jun 20255 Apr 2025
106wwwgoogleblogsearch.comMarkMonitor Inc.16 Sep 200515 Aug 202416 Sep 2025
107wwwgooglemusic.comMarkMonitor Inc.8 Sep 20057 Aug 20248 Sep 2025
108wwwgooglearth.comInternet Domain Services BS Corp13 Jul 200512 Dec 201513 Jul 2017
109wwwgooglesearch.comGoDaddy.com, LLC23 Feb 202424 Feb 202523 Feb 2026
110wwwgooglefr.comMarkMonitor Inc.26 Jul 200424 Jun 202526 Jul 2026
111wwwgooglemaps.comMarkMonitor Inc.6 Apr 20055 Mar 20256 Apr 2026
112wwwgoogleom.comGMO Internet Inc.9 Aug 20219 Aug 20219 Aug 2022
113wwwgooglebe.comGMO Internet Inc.9 Aug 20219 Aug 20219 Aug 2022
114wwwgooglenewsalerts.comMarkMonitor Inc.3 Jun 20032 May 20253 Jun 2026
115wwwgooglee.comNameKing.com Inc.13 Jan 200529 Mar 202513 Jan 2025
116wwwgooglemap.comMarkMonitor Inc.14 Apr 200513 Mar 202514 Apr 2026
117wwwgoogleimages.comGoogle, Inc.1 Apr 20191 Apr 20191 Apr 2020
118wwwgoogles.com-2 Feb 20246 Mar 20252 Feb 2025
119wwwgoogledz.comGMO Internet Inc.9 Aug 20219 Aug 20219 Aug 2022
120wwwgoogleratings.comMarkMonitor Inc.3 Aug 20042 Jul 20253 Aug 2026
121wwwgooglenews.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
122wwwgooglel.comCloud Yuqu LLC28 Mar 202310 May 202428 Mar 2024
123wwwgoogleplaystore.comGoDaddy.com, LLC23 Sep 20224 Nov 202323 Sep 2023
124wwwgoogleo.comAbove.com Pty Ltd.13 Aug 202324 Oct 202413 Aug 2024
125wwwgooglecom.comMarkMonitor Inc.17 Jun 200216 May 202517 Jun 2026
126wwwgoogleaudio.comGoDaddy.com, LLC21 Oct 200922 Oct 202421 Oct 2025
127wwwgoogleearth.comMarkMonitor Inc.28 Jun 200527 May 202528 Jun 2026
128wwwgooglechrome.comMarkMonitor Inc.4 Jun 20103 May 20254 Jun 2026
129wwwgooglenewsalert.comMarkMonitor Inc.2 Jun 20031 May 20252 Jun 2026
130wwwgoogleyahoo.comMarkMonitor Inc.13 May 200511 Apr 202513 May 2026
131wwwgoogleuk.comBeijing Lanhai Jiye Technology Co., Ltd29 Apr 202230 Jun 202529 Apr 2025
132wwwgooglesyndicatedsearch.comMarkMonitor Inc.16 Sep 200615 Aug 202416 Sep 2025
133wwwgooglesyndication.comMarkMonitor Inc.11 Mar 20037 Feb 202511 Mar 2026
134wwwgoogle-analytics.comDynadot, LLC10 Jul 202510 Jul 202510 Jul 2026
135wwwgooglecom.mobiBeijing Innovative Linkage Technology Ltd. dba dns…7 Nov 20067 Aug 20087 Nov 2016
136wwwgooglefr.netDynadot, LLC11 Jul 201025 Jun 201911 Jul 2020
137wwwgoogleratings.netMarkMonitor Inc.3 Aug 20042 Jul 20253 Aug 2026
138wwwgooglecom.netMarkMonitor Inc.30 Oct 200428 Sep 202430 Oct 2025
139wwwgooglesyndicatedsearch.netMarkMonitor Inc.16 Sep 200615 Aug 202416 Sep 2025
140wwwgooglesyndicatedsearch.orgMarkMonitor Inc.16 Sep 200620 Aug 202416 Sep 2025
141wwwgoogleratings.orgMarkMonitor Inc.3 Aug 20047 Jul 20253 Aug 2026
142wwwgoogledocs.xyzUniregistrar Corp3 Jun 201624 Sep 20163 Jun 2017
143wwwgooglede.de--29 Jun 2012-
144wwwgoogleco.comAbove.com Pty Ltd.27 Aug 20237 Nov 202427 Aug 2024
145wwwgoogleusercontent.comGoogle, Inc.1 Dec 20181 Dec 20181 Dec 2019
146wwwgooglecomar.comTucows Domains Inc.31 Jan 201731 Jan 201731 Jan 2018
147wwwgooglevideo.comEpik Inc.1 Dec 202016 Jul 20221 Dec 2025
148wwwgooglecrome.comNameKing.com Inc.31 Aug 202114 Oct 202231 Aug 2022
149wwwgooglew.comGoDaddy.com, LLC26 Mar 20177 May 202426 Mar 2024
150wwwgooglegoogle.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
151wwwgoogle3.comAbove.com Pty Ltd.30 Aug 202310 Oct 202430 Aug 2024
152wwwgoogled.comAbove.com Pty Ltd.27 Aug 20238 Oct 202427 Aug 2024
153wwwgoogle4.comAbove.com Pty Ltd.30 Aug 202310 Oct 202430 Aug 2024
154wwwgoogleweblight.comGoogle, Inc.3 Dec 20183 Dec 20183 Dec 2019
155wwwgoogleru.comFabulous.com Pty Ltd.5 Jun 201724 Jul 20175 Jun 2018
156wwwgoogleca.comAbove.com Pty Ltd.7 Sep 202319 Oct 20247 Sep 2024
157wwwgooglebing.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Nov 201716 Nov 201716 Nov 2018
158wwwgoogleacademico.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Nov 201724 Nov 201724 Nov 2018
159wwwgooglephotos.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Dec 20171 Dec 20171 Dec 2018
160wwwgooglemsn.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
161wwwgooglecouk.co.ukReserved27 Aug 200730 Aug 201727 Aug 2019
162wwwgooglepay.comHiChina Zhicheng Technology Limited14 May 201921 Jun 202414 May 2024
163wwwgooglecloud.comSquarespace Domains LLC18 May 20244 May 202518 May 2026
164wwwgooglesheets.comGoogle, Inc.24 Jan 201826 Jan 201824 Jan 2019
165wwwgoogledocs.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
166wwwgooglenet.comXin Net Technology Corporation13 Apr 201813 Apr 201813 Apr 2019
167wwwgoogleplayclassaction.comWest263 International Limited11 Feb 202011 Feb 202011 Feb 2021
168wwwgoogleone.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
169wwwgoogleadservices.comeName Technology Co., Ltd.16 Apr 202228 May 202516 Apr 2025
170wwwgooglenl.comDynadot, LLC25 Sep 201825 Sep 201825 Sep 2019
171wwwgooglepr.comDynadot, LLC25 Sep 201825 Sep 201825 Sep 2019
172wwwgooglepk.comDynadot, LLC25 Sep 201825 Sep 201825 Sep 2019
173wwwgooglevn.comDynadot, LLC25 Sep 201825 Sep 201825 Sep 2019
174wwwgooglecombr.comWix.com Ltd.4 Feb 202217 Mar 20254 Feb 2025
175wwwgoogleiq.comDynadot, LLC25 Sep 201825 Sep 201825 Sep 2019
176wwwgooglestore.comHangzhou AiMing Network Co., LTD15 Dec 202215 Jan 202415 Dec 2023
177wwwgooglevoice.comGoogle, Inc.1 Apr 20191 Apr 20191 Apr 2020
178wwwgoogledoc.comNamesilo, LLC21 Jul 202521 Jul 202521 Jul 2026
179wwwgoogleadwords.comHiChina Zhicheng Technology Limited27 Oct 201827 Oct 201827 Oct 2019
180wwwgoogleads.comGoogle, Inc.14 Apr 202215 Apr 202314 Apr 2024
181wwwgoogleassistant.comGoogle, Inc.1 Apr 20191 Apr 20191 Apr 2020
182wwwgoogletrips.comGoogle, Inc.21 May 201921 May 201921 May 2020
183wwwgoogleshopping.comGoogle, Inc.21 May 201921 May 201921 May 2020
184wwwgoogleadsense.comGoogle, Inc.21 May 201921 May 201921 May 2020
185wwwgoogle1.comAbove.com Pty Ltd.30 Aug 202310 Oct 202430 Aug 2024
186wwwgooglesmaps.comGoDaddy.com, LLC19 Aug 201919 Aug 201919 Aug 2020
187wwwgooglescholar.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
188wwwgoogleopinionrewards.comNamesilo, LLC13 Feb 202014 Feb 202013 Feb 2021
189wwwgooglecoronavirus.comCloud Yuqu LLC15 Mar 202015 Mar 202015 Mar 2021
190wwwgooglecovid19.comDynadot, LLC21 Mar 202021 Mar 202021 Mar 2021
191wwwgoogleplusdatalitigation.comDynadot, LLC4 Aug 20204 Aug 20204 Aug 2021
192wwwgoogleworkspace.comNameKing.com Inc.6 Oct 20206 Oct 20206 Oct 2021
193wwwgoogleplex.comDNSPod, Inc.23 Nov 202022 Nov 202123 Nov 2021
194wwwgoogle1a.xyzGMO Internet Inc.9 Feb 2021-9 Feb 2022
195wwwgoogle2a.xyzGMO Internet Inc.17 Mar 202127 May 202217 Mar 2022
196wwwgooglecom.coGoDaddy.com, LLC5 Jul 202016 Aug 20235 Jul 2023
197wwwgoogleforms.comHiChina Zhicheng Technology Limited19 Jul 202120 Jul 202219 Jul 2022
198wwwgoogleercom.comLaunchpad, Inc.21 Jul 20211 Sep 202221 Jul 2022
199wwwgooglempas.comGoDaddy.com, LLC26 Jul 20217 Aug 202226 Jul 2023
200wwwgooglemeet.comNamesilo, LLC12 Jun 202016 Aug 202512 Jun 2025
201wwwgoogleapis.comChengdu West Dimension Digital Technology Co., Ltd…15 Aug 202222 Oct 202315 Aug 2023
202wwwgoogledot.comGransy s.r.o. d/b/a subreg.cz20 Sep 202126 Sep 202220 Sep 2022
203wwwgooglewallet.comCloud Yuqu LLC11 May 202215 Jul 202311 May 2023
204wwwgooglecomguweigongming588.xyzNamesilo, LLC6 Jun 202224 Jun 20226 Jun 2024
205wwwgooglechat.comMarkMonitor Inc.19 Jul 202217 Jun 202519 Jul 2026
206wwwgoogleplaydevelopersettlement.comChengdu West Dimension Digital Technology Co., Ltd…24 Jun 202231 Jul 202324 Jun 2023
207wwwgooglefederal.comCloud Yuqu LLC25 Jun 20221 Sep 202325 Jun 2023
208wwwgooglecapaysettlement.comChengdu West Dimension Digital Technology Co., Ltd…6 Jul 202212 Aug 20236 Jul 2023
209wwwgooglesite.comMedia Elite Holdings Limited24 Sep 20245 Jan 202524 Sep 2025
210wwwgoogleadservice.comGoDaddy.com, LLC15 Nov 202227 Jan 202415 Nov 2023
211wwwgoogleflight.comCloud Yuqu LLC21 Nov 202221 Nov 202221 Nov 2025
212wwwgoogleonline.comSquarespace Domains LLC10 Aug 202410 Aug 202510 Aug 2025
213wwwgoogleplayappsettlement.comCloud Yuqu LLC14 Jan 202327 Mar 202414 Jan 2024
214wwwgoogleplayantitrustsettlement.comCloud Yuqu LLC14 Jan 202327 Mar 202414 Jan 2024
215wwwgooglebard.comCloud Yuqu LLC8 Feb 20239 Feb 20248 Feb 2025
216wwwgooglei.comCommuniGal Communication Ltd.4 Mar 200730 Apr 20254 Mar 2025
217wwwgooglec.comNameSecure L.L.C.5 May 20076 May 20255 May 2026
218wwwgoogle360.comSquarespace Domains LLC8 Sep 20248 Sep 20248 Sep 2025
219wwwgooglecookieplacementprivacysettlement.comNameKing.com Inc.11 Mar 202225 May 202311 Mar 2023
220wwwgooglebipasettlement.comNameKing.com Inc.15 Mar 202228 Apr 202415 Mar 2024
221wwwgoogle-bard.comDynadot, LLC11 May 202321 Jul 202411 May 2024
222wwwgoogleconverse.comDynadot, LLC11 May 202321 Jul 202411 May 2024
223wwwgooglelocationhistorysettlement.comCloud Yuqu LLC1 Aug 20232 Aug 20241 Aug 2025
224wwwgoogleca.ca-13 Aug 202323 Oct 202413 Aug 2024
225wwwgooglep.comAbove.com Pty Ltd.13 Aug 202324 Oct 202413 Aug 2024
226wwwgooglek.comAbove.com Pty Ltd.13 Aug 202324 Oct 202413 Aug 2024
227wwwgooglem.comAbove.com Pty Ltd.13 Aug 202324 Oct 202413 Aug 2024
228wwwgooglemailcom.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
229wwwgooglemapscom.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
230wwwgooglefibercom.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
231wwwgoogledrivecom.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
232wwwgooglenewscom.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
233wwwgooglesearchcom.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
234wwwgoogleplaycom.comAbove.com Pty Ltd.14 Aug 202324 Sep 202414 Aug 2024
235wwwgooglefiber.comAbove.com Pty Ltd.14 Aug 202324 Oct 202414 Aug 2024
236wwwgooglecomcom.comAbove.com Pty Ltd.15 Aug 202326 Oct 202415 Aug 2024
237wwwgooglechromecom.comAbove.com Pty Ltd.15 Aug 202326 Oct 202415 Aug 2024
238wwwgoogleblogcom.comAbove.com Pty Ltd.15 Aug 202326 Oct 202415 Aug 2024
239wwwgooglekcom.comAbove.com Pty Ltd.15 Aug 202326 Oct 202415 Aug 2024
240wwwgooglemaps.coAbove.com Pty Ltd.18 Aug 202328 Sep 202418 Aug 2024
241wwwgooglef.comAbove.com Pty Ltd.27 Aug 20238 Oct 202427 Aug 2024
242wwwgooglercom.comAbove.com Pty Ltd.27 Aug 20238 Oct 202427 Aug 2024
243wwwgoogledcom.comAbove.com Pty Ltd.27 Aug 20237 Nov 202427 Aug 2024
244wwwgooglelcom.comAbove.com Pty Ltd.27 Aug 20237 Nov 202427 Aug 2024
245wwwgooglescom.comAbove.com Pty Ltd.27 Aug 20237 Nov 202427 Aug 2024
246wwwgoogleecom.comAbove.com Pty Ltd.27 Aug 20237 Nov 202427 Aug 2024
247wwwgooglewcom.comAbove.com Pty Ltd.27 Aug 20237 Nov 202427 Aug 2024
248wwwgooglefcom.comAbove.com Pty Ltd.27 Aug 20238 Oct 202427 Aug 2024
249wwwgooglecim.comAbove.com Pty Ltd.28 Aug 20238 Nov 202428 Aug 2024
250wwwgooglecpm.comAbove.com Pty Ltd.28 Aug 20238 Nov 202428 Aug 2024
251wwwgoogleckm.comAbove.com Pty Ltd.28 Aug 20238 Nov 202428 Aug 2024
252wwwgooglecxom.comAbove.com Pty Ltd.28 Aug 20237 Nov 202428 Aug 2024
253wwwgooglecok.comAbove.com Pty Ltd.28 Aug 20238 Nov 202428 Aug 2024
254wwwgooglexom.comAbove.com Pty Ltd.29 Aug 20238 Nov 202429 Aug 2024
255wwwgooglevim.comAbove.com Pty Ltd.29 Aug 20238 Nov 202429 Aug 2024
256wwwgooglemapscpm.comAbove.com Pty Ltd.31 Aug 202311 Oct 202431 Aug 2024
257wwwgoogleclm.comAbove.com Pty Ltd.30 Aug 20239 Nov 202430 Aug 2024
258wwwgooglemapsclm.comAbove.com Pty Ltd.31 Aug 202311 Oct 202431 Aug 2024
259wwwgoogle4com.comAbove.com Pty Ltd.30 Aug 20239 Nov 202430 Aug 2024
260wwwgoogle2.comAbove.com Pty Ltd.30 Aug 202310 Oct 202430 Aug 2024
261wwwgoogle2com.comAbove.com Pty Ltd.30 Aug 20239 Nov 202430 Aug 2024
262wwwgoogle3com.comAbove.com Pty Ltd.30 Aug 20239 Nov 202430 Aug 2024
263wwwgooglecon.comAbove.com Pty Ltd.30 Aug 202310 Oct 202430 Aug 2024
264wwwgooglecm.comAbove.com Pty Ltd.30 Aug 20239 Nov 202430 Aug 2024
265wwwgooglecomn.comAbove.com Pty Ltd.30 Aug 20239 Nov 202430 Aug 2024
266wwwgoogle-com.comAbove.com Pty Ltd.2 Sep 202314 Oct 20242 Sep 2024
267wwwgooglebardcom.comAbove.com Pty Ltd.31 Aug 202312 Oct 202431 Aug 2024
268wwwgoogleq.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
269wwwgooglea.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
270wwwgoogleb.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
271wwwgoogle5.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
272wwwgoogle0.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
273wwwgoogle7.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
274wwwgoogle6.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
275wwwgoogle8.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
276wwwgoogle9.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
277wwwgooglev.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
278wwwgoogleu.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
279wwwgoogley.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
280wwwgoogleg.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
281wwwgooglefb.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
282wwwgoogleh.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
283wwwgooglehotels.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
284wwwgooglej.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
285wwwgooglex.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
286wwwgooglez.comGoDaddy.com, LLC13 Dec 202413 Dec 202413 Dec 2025
287wwwgooglet.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
288wwwgoogleweather.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
289wwwgoogleroblox.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
290wwwgoogletarget.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
291wwwgooglecraigslist.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
292wwwgooglehomedepot.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
293wwwgooglepinterest.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
294wwwgooglewellsfargo.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
295wwwgooglemacys.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
296wwwgooglelowes.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
297wwwgooglenetflix.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
298wwwgooglestarbucks.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
299wwwgoogleindeed.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
300wwwgooglet-mobile.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
301wwwgooglebankofamerica.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
302wwwgooglegmaillogin.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
303wwwgooglefoxnews.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
304wwwgooglecostco.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
305wwwgoogle-co.comAbove.com Pty Ltd.3 Sep 202315 Oct 20243 Sep 2024
306wwwgoogle-c.comAbove.com Pty Ltd.3 Sep 202315 Oct 20243 Sep 2024
307wwwgooglefibernet.netAbove.com Pty Ltd.5 Sep 202317 Oct 20245 Sep 2024
308wwwgooglec0om.comAbove.com Pty Ltd.4 Sep 202315 Oct 20244 Sep 2024
309wwwgooglecoom.comAbove.com Pty Ltd.4 Sep 202315 Oct 20244 Sep 2024
310wwwgooglespeedtest.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
311wwwgooglewhatsapp.comAbove.com Pty Ltd.4 Sep 20234 Sep 20234 Sep 2024
312wwwgoogleyoutubecom.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
313wwwgoogleco0m.comAbove.com Pty Ltd.4 Sep 202315 Oct 20244 Sep 2024
314wwwgooglefacebook.comAbove.com Pty Ltd.4 Sep 20234 Sep 20234 Sep 2024
315wwwgooglenfl.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
316wwwgooglewordle.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
317wwwgoogleyoutube.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
318wwwgooglecricbuzz.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
319wwwgooglec9om.comAbove.com Pty Ltd.4 Sep 202315 Oct 20244 Sep 2024
320wwwgooglenba.comAbove.com Pty Ltd.4 Sep 202316 Oct 20244 Sep 2024
321wwwgoogle-search.comAbove.com Pty Ltd.8 Sep 202319 Oct 20248 Sep 2024
322wwwgooglechickfila.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
323wwwgoogleetsy.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
324wwwgooglerestaraunts.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
325wwwgooglecoffee.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
326wwwgooglebestbuy.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
327wwwgoogleuspstracking.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
328wwwgoogledominos.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
329wwwgoogle-restaurants.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
330wwwgoogleairbnb.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
331wwwgoogleamazon.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
332wwwgoogleamazonprime.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
333wwwgoogleamericanairlines.comAbove.com Pty Ltd.5 Sep 202315 Dec 20235 Sep 2024
334wwwgoogleautozone.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
335wwwgooglecanva.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
336wwwgooglecvs.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
337wwwgoogleespn.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
338wwwgoogleaolmail.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
339wwwgooglechatgpt.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
340wwwgoogledowjones.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
341wwwgoogleebay.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
342wwwgoogleflightscom.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
343wwwgooglefood.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
344wwwgooglefoodnearme.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
345wwwgooglegoogledrive.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
346wwwgooglehotmail.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
347wwwgooglelinkedin.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
348wwwgooglemcdonalds.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
349wwwgooglenbascores.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
350wwwgoogleomegle.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
351wwwgooglesuperbowl.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
352wwwgooglecapitalone.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
353wwwgoogleinstagram.comAbove.com Pty Ltd.5 Sep 202312 Sep 20235 Sep 2024
354wwwgooglekohls.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
355wwwgooglelakers.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
356wwwgoogleoutlook.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
357wwwgooglepizzahut.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
358wwwgooglereddit.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
359wwwgooglerestaurants.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
360wwwgooglerestaurantsnearme.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
361wwwgooglesamsclub.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
362wwwgooglesoap2day.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
363wwwgoogleweather10days.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
364wwwgooglecnn.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
365wwwgooglemegamillions.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
366wwwgooglesmmpanel.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
367wwwgooglesolitaire.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
368wwwgooglesongs.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
369wwwgoogletraductor.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
370wwwgoogletwitter.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
371wwwgoogleupstracking.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
372wwwgoogleusps.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
373wwwgooglewalgreens.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
374wwwgooglewalmart.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
375wwwgoogleyahoomail.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
376wwwgoogleyou.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
377wwwgooglezillow.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
378wwwgooglecalculator.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
379wwwgooglepremierleague.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
380wwwgoogleshein.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
381wwwgooglenflscores.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
382wwwgoogleonecom.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
383wwwgoogletiempo.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
384wwwgoogleweathertomorrow.comAbove.com Pty Ltd.5 Sep 202316 Oct 20245 Sep 2024
385wwwgooglefiber.netAbove.com Pty Ltd.5 Sep 202317 Oct 20245 Sep 2024
386wwwgoogleqs.comAbove.com Pty Ltd.7 Sep 202318 Oct 20247 Sep 2024
387wwwgooglecouk.comAbove.com Pty Ltd.7 Sep 202319 Oct 20247 Sep 2024
388wwwgoogledocscom.comAbove.com Pty Ltd.7 Sep 202319 Oct 20247 Sep 2024
389wwwgoogletranslatecom.comAbove.com Pty Ltd.7 Sep 202319 Oct 20247 Sep 2024
390wwwgooglewwwcom.comAbove.com Pty Ltd.7 Sep 202319 Oct 20247 Sep 2024
391wwwgooglelogin.comAbove.com Pty Ltd.10 Sep 202322 Oct 202410 Sep 2024
392wwwgooglegooglecom.comAbove.com Pty Ltd.8 Sep 202319 Oct 20248 Sep 2024
393wwwgoogle-google.comAbove.com Pty Ltd.8 Sep 202319 Oct 20248 Sep 2024
394wwwgooglecomfacebook.comAbove.com Pty Ltd.10 Sep 202312 Sep 202310 Sep 2024
395wwwgooglesearchweb.comDynadot, LLC13 Sep 202324 Nov 202413 Sep 2024
396wwwgoogleplaystateagantitrustlitigation.comCosmotown, Inc.10 Jan 202420 Feb 202510 Jan 2025
397wwwgooglebusiness.comDynadot, LLC23 Mar 20242 May 202523 Mar 2025
398wwwgoogleapp.comNamesilo, LLC19 Apr 202422 May 202519 Apr 2025
399wwwgoogletoday.comNamesilo, LLC18 Apr 202418 Jun 202518 Apr 2025
400wwwgooglestor.comGoDaddy.com, LLC22 Apr 20244 Jul 202522 Apr 2025
401wwwgoogleru.ru-13 Jul 2008-13 Jul 2026
402wwwgooglemaps.de--28 Aug 2024-
403wwwgoogleassistantprivacylitigation.comCloud Yuqu LLC18 Jun 20241 Aug 202518 Jun 2025
404wwwgooglefinance.comDynadot, LLC9 Jul 202410 Jul 20259 Jul 2026
405wwwgoogledomain.comSquarespace Domains LLC30 Jul 202419 Aug 202530 Jul 2025
406wwwgooglebaiducom.vipBeijing Lanhai Jiye Technology Co., Ltd16 Aug 202416 Aug 202516 Aug 2025
407wwwgooglebaiducom.comMetaregistrar BV Applications16 Aug 202416 Aug 202516 Aug 2025
408wwwgoogle-comvn.comDynadot, LLC22 Aug 202427 Apr 202522 Aug 2026
409wwwgooglecom-vn.comDynadot, LLC5 Nov 202428 Apr 20255 Nov 2026
410wwwgoogleadtechclassaction.comGoDaddy.com, LLC7 Nov 202417 Jul 20257 Nov 2025
411wwwgoogle24.comCloudFlare, Inc.14 Nov 202419 Nov 202414 Nov 2025
412wwwgoogle99.comCloudFlare, Inc.25 Dec 20241 Jan 202525 Dec 2025
413wwwgooglepictures.comMedia Elite Holdings Limited2 Jan 202513 Apr 20252 Jan 2026
414wwwgoogle-vn.comDynadot, LLC1 Jan 20251 Jan 20251 Jan 2026
415wwwgoogleit.comSquarespace Domains LLC17 Jan 202517 Jan 202517 Jan 2026
416wwwgooglerr88-vncom.comDynadot, LLC25 Feb 20255 Aug 202525 Feb 2028
417wwwgooglemd.appCloudFlare, Inc.10 Mar 202516 Mar 202510 Mar 2026
418wwwgooglew.de--13 Sep 2011-
419wwwgoogleadvertisingsettlement.comChengdu West Dimension Digital Technology Co., Ltd…7 May 20257 May 20257 May 2026
420wwwgooglemapsettlement.comDynadot, LLC12 Jun 202512 Jun 202512 Jun 2026
421wwwgooglexx88-vncom.comDynadot, LLC26 Jun 202526 Jun 202526 Jun 2026
422wwwgooglecom.topCSL Computer Service Langenbach GmbH d/b/a joker.c…6 Jul 20256 Jul 20256 Jul 2026
423wwwgooglee.de--5 Aug 2025-
424wwwgoogleeducationbipasettlement.comDropCatch.com 600 LLC5 Aug 20256 Aug 20255 Aug 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=wwwgoogle

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now