With support for 
Keyword: WINDS
Reverse Whois » KEYWORD [winds ] { 37,449 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | winds.info | - | 19 Jul 2025 | 19 Jul 2025 | 19 Jul 2026 |
| 2 | winds.me | Name.com, Inc. | 5 Mar 2012 | 8 Jun 2017 | 5 Mar 2018 |
| 3 | winds.us | - | 5 Jul 2022 | 3 Aug 2025 | 5 Jul 2026 |
| 4 | winds.biz | GMO Internet Inc. | 2 Feb 2018 | 22 Jan 2020 | 2 Feb 2021 |
| 5 | winds.church | Porkbun, LLC | 29 Dec 2017 | 3 Jan 2018 | 29 Dec 2018 |
| 6 | winds.blue | Name.com, Inc. | 14 Dec 2014 | 16 Dec 2022 | 14 Dec 2027 |
| 7 | winds.red | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 14 Mar 2018 | 28 May 2020 | 14 Mar 2028 |
| 8 | winds.xyz | West263 International Limited | 19 May 2019 | 10 Jul 2025 | 19 May 2027 |
| 9 | winds.work | GMO Internet Inc. | 15 Feb 2021 | 20 Jan 2025 | 15 Feb 2026 |
| 10 | winds.help | Uniregistrar Corp | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 11 | winds.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 12 | winds.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 6 Apr 2015 | 15 Dec 2021 | 6 Apr 2026 |
| 13 | winds.tech | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Jul 2023 | 18 Aug 2024 | 17 Jul 2024 |
| 14 | winds.solar | GoDaddy.com, LLC | 15 May 2015 | 29 Jun 2025 | 15 May 2026 |
| 15 | winds.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 14 Jun 2015 | 24 May 2017 | 14 Jun 2018 |
| 16 | winds.education | GoDaddy.com, LLC | 15 Jul 2015 | 16 Jul 2017 | 15 Jul 2018 |
| 17 | winds.global | Google, Inc. | 28 Aug 2025 | 28 Aug 2025 | 28 Aug 2026 |
| 18 | winds.online | Tucows Domains Inc. | 26 Aug 2015 | 7 Aug 2025 | 26 Aug 2026 |
| 19 | winds.mobi | OVH sas | 29 Apr 2015 | 13 Jun 2024 | 29 Apr 2025 |
| 20 | winds.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Nov 2015 | 13 Jan 2017 | 2 Nov 2018 |
| 21 | winds.one | - | 10 Aug 2024 | 26 Jun 2025 | 10 Aug 2025 |
| 22 | winds.tokyo | GMO Internet Inc. | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2017 |
| 23 | winds.com | GoDaddy.com, LLC | 26 May 2003 | 27 Jan 2024 | 26 May 2030 |
| 24 | winds.cloud | Porkbun, LLC | 16 Jul 2025 | 21 Jul 2025 | 16 Jul 2026 |
| 25 | winds.vip | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 May 2016 | 4 Apr 2017 | 17 May 2018 |
| 26 | winds.website | - | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 27 | winds.xin | - | 8 May 2016 | 8 May 2016 | 8 May 2017 |
| 28 | winds.ltd | GoDaddy.com, LLC | 22 Jun 2016 | 3 Aug 2024 | 22 Jun 2024 |
| 29 | winds.host | Limited Liability Company "Registrar of domain nam… | 21 May 2023 | 30 Jun 2024 | 21 May 2024 |
| 30 | winds.lol | - | 6 May 2023 | 18 Jul 2024 | 6 May 2024 |
| 31 | winds.link | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 32 | winds.property | Uniregistrar Corp | 16 Oct 2016 | 26 Nov 2017 | 16 Oct 2017 |
| 33 | winds.insure | GoDaddy.com, LLC | 18 Oct 2016 | 28 May 2017 | 18 Oct 2017 |
| 34 | winds.net | Google, Inc. | 26 Nov 1997 | 10 Nov 2024 | 25 Nov 2025 |
| 35 | winds.org | eNom, Inc. | 30 Dec 1994 | 7 Aug 2025 | 29 Dec 2028 |
| 36 | winds.be | - | 3 Oct 2015 | - | - |
| 37 | winds.de | - | - | 21 Jan 2015 | - |
| 38 | winds.fr | - | 26 Feb 2007 | 5 Jan 2016 | - |
| 39 | winds.it | - | 4 Mar 2009 | 20 Mar 2025 | 4 Mar 2026 |
| 40 | winds.sc | GMO Internet Inc. | 10 Feb 2009 | 3 Aug 2023 | 10 Feb 2025 |
| 41 | winds.pro | Interlink Co., Ltd. | 9 May 2014 | 23 Jun 2025 | 9 May 2026 |
| 42 | winds.co.uk | - | 24 Dec 2002 | 23 Dec 2024 | 24 Dec 2025 |
| 43 | winds.tv | - | 1 Dec 2012 | 31 Oct 2017 | 1 Dec 2018 |
| 44 | winds.ws | GoDaddy.com, LLC | 24 May 2003 | 8 May 2017 | 24 May 2018 |
| 45 | winds.live | CommuniGal Communication Ltd. | 21 Sep 2024 | 26 Sep 2024 | 21 Sep 2025 |
| 46 | winds.company | Network Solutions, LLC | 31 May 2017 | 13 May 2025 | 31 May 2026 |
| 47 | winds.life | GoDaddy.com, LLC | 14 Sep 2022 | 7 Sep 2024 | 14 Sep 2025 |
| 48 | winds.zone | NameCheap, Inc. | 3 Oct 2017 | 3 Oct 2017 | 3 Oct 2018 |
| 49 | winds.co | GoDaddy.com, LLC | 28 Oct 2014 | 23 Sep 2024 | 27 Oct 2025 |
| 50 | winds.agency | GoDaddy.com, LLC | 22 Oct 2017 | 22 Oct 2017 | 22 Oct 2018 |
| 51 | winds.amsterdam | Metaregistrar BV Applications | 22 Dec 2017 | 22 Dec 2017 | 22 Dec 2018 |
| 52 | winds.org.uk | - | 5 Jan 2025 | 5 Jan 2025 | 5 Jan 2026 |
| 53 | winds.farm | GoDaddy.com, LLC | 17 Feb 2018 | 17 Feb 2018 | 17 Feb 2019 |
| 54 | winds.gallery | Gandi SAS | 7 Feb 2017 | 25 Feb 2018 | 7 Feb 2019 |
| 55 | winds.studio | Gandi SAS | 7 Feb 2017 | 25 Feb 2018 | 7 Feb 2019 |
| 56 | winds.media | Gandi SAS | 7 Feb 2017 | 25 Feb 2018 | 7 Feb 2019 |
| 57 | winds.co.in | GoDaddy.com, LLC | 13 Jan 2018 | 30 May 2025 | 13 Jan 2026 |
| 58 | winds.care | Name.com, Inc. | 9 Mar 2018 | 2 May 2018 | 9 Mar 2019 |
| 59 | winds.cool | Name.com, Inc. | 9 Mar 2018 | 2 May 2018 | 9 Mar 2019 |
| 60 | winds.run | DNSPod, Inc. | 27 Jun 2020 | 27 Jun 2020 | 27 Jun 2021 |
| 61 | winds.rentals | Name.com, Inc. | 9 Mar 2018 | 4 May 2018 | 9 Mar 2019 |
| 62 | winds.pictures | Name.com, Inc. | 9 Mar 2018 | 4 May 2018 | 9 Mar 2019 |
| 63 | winds.today | Namesilo, LLC | 2 Dec 2024 | 7 Dec 2024 | 2 Dec 2025 |
| 64 | winds.watch | Name.com, Inc. | 9 Mar 2018 | 5 May 2018 | 9 Mar 2019 |
| 65 | winds.energy | Hostinger, UAB | 13 Jul 2024 | 13 Jul 2025 | 13 Jul 2026 |
| 66 | winds.works | NameKing.com Inc. | 11 Oct 2020 | 11 Oct 2020 | 11 Oct 2021 |
| 67 | winds.club | GMO Internet Inc. | 11 Aug 2019 | 31 Jul 2025 | 11 Aug 2026 |
| 68 | winds.academy | NameCheap, Inc. | 25 Oct 2022 | 5 Jan 2024 | 25 Oct 2023 |
| 69 | winds.digital | - | 25 Jun 2024 | 25 Jun 2025 | 25 Jun 2026 |
| 70 | winds.group | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Nov 2020 | 24 Feb 2025 | 14 Nov 2025 |
| 71 | winds.finance | GoDaddy.com, LLC | 19 Sep 2024 | 24 Sep 2024 | 19 Sep 2025 |
| 72 | winds.ink | NameCheap, Inc. | 18 Feb 2025 | 23 Feb 2025 | 18 Feb 2026 |
| 73 | winds.dk | - | 6 Nov 2021 | - | 5 Nov 2023 |
| 74 | winds.ru.com | NameKing.com Inc. | 5 Jul 2025 | 10 Jul 2025 | 5 Jul 2026 |
| 75 | winds.moe | GoDaddy.com, LLC | 25 Jun 2022 | 6 Aug 2023 | 25 Jun 2023 |
| 76 | winds.travel | NameCheap, Inc. | 15 Jul 2022 | 19 Jul 2025 | 15 Jul 2026 |
| 77 | winds.report | NameCheap, Inc. | 13 Sep 2022 | 19 Aug 2024 | 13 Sep 2025 |
| 78 | winds.au | - | - | 5 Oct 2022 | - |
| 79 | winds.app | GoDaddy.com, LLC | 30 Dec 2018 | 10 Feb 2025 | 30 Dec 2024 |
| 80 | winds.blog | Netowl, Inc. | 29 Aug 2025 | 29 Aug 2025 | 29 Aug 2026 |
| 81 | winds.buzz | Namesilo, LLC | 16 Aug 2022 | 18 Sep 2023 | 16 Aug 2023 |
| 82 | winds.ca | Namespro Solutions Inc. | 15 Apr 2005 | 16 Mar 2025 | 15 Apr 2026 |
| 83 | winds.cash | - | 25 Jun 2024 | 25 Jun 2025 | 25 Jun 2026 |
| 84 | winds.fun | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 1 Jun 2024 | 10 Jul 2025 | 1 Jun 2025 |
| 85 | winds.gay | NameCheap, Inc. | 22 Feb 2023 | 25 Feb 2024 | 22 Feb 2027 |
| 86 | winds.services | Google, Inc. | 5 Apr 2023 | 3 Jun 2025 | 5 Apr 2026 |
| 87 | winds.llc | GoDaddy.com, LLC | 9 Jul 2018 | 20 Aug 2024 | 9 Jul 2024 |
| 88 | winds.world | GMO Internet Inc. | 24 Feb 2017 | 8 Feb 2025 | 24 Feb 2026 |
| 89 | winds.earth | GoDaddy.com, LLC | 4 Jan 2020 | 22 Dec 2024 | 4 Jan 2026 |
| 90 | winds.in | Dynadot, LLC | 3 May 2017 | 15 May 2025 | 3 May 2026 |
| 91 | winds.io | - | 14 Nov 2019 | 17 Feb 2025 | 14 Nov 2025 |
| 92 | winds.jp | - | 1 Sep 2022 | 1 Nov 2024 | 30 Sep 2025 |
| 93 | winds.design | Domeneshop AS dba domainnameshop.com | 26 Apr 2023 | 1 Jul 2025 | 26 Apr 2026 |
| 94 | winds.uk | - | 7 Jun 2019 | 6 Jun 2025 | 7 Jun 2026 |
| 95 | winds.email | Cronon AG | 14 Nov 2023 | 29 Dec 2024 | 14 Nov 2025 |
| 96 | winds.press | DNSPod, Inc. | 4 Feb 2024 | 9 Feb 2024 | 4 Feb 2027 |
| 97 | winds.nl | - | 1 Oct 2008 | 30 Jul 2025 | - |
| 98 | winds.ru | - | 27 Aug 2003 | - | 27 Aug 2026 |
| 99 | winds.eu | - | - | - | - |
| 100 | winds.su | - | 22 Apr 2020 | - | 22 Apr 2026 |
| 101 | winds.rest | Namesilo, LLC | 25 Jun 2024 | 29 Jul 2025 | 25 Jun 2025 |
| 102 | winds.skin | Namesilo, LLC | 25 Jun 2024 | 29 Jul 2025 | 25 Jun 2025 |
| 103 | winds.rocks | NameCheap, Inc. | 16 Jul 2024 | 21 Jun 2025 | 16 Jul 2026 |
| 104 | winds.financial | GoDaddy.com, LLC | 19 Sep 2024 | 24 Sep 2024 | 19 Sep 2025 |
| 105 | winds.se | - | 8 Jul 2018 | 3 Jul 2025 | 8 Jul 2026 |
| 106 | winds.pt | - | 1 Aug 2024 | - | 1 Aug 2026 |
| 107 | winds.solutions | Tucows Domains Inc. | 23 Dec 2024 | 23 Dec 2024 | - |
| 108 | winds.best | Dynadot, LLC | 27 Feb 2025 | 11 Apr 2025 | 27 Feb 2026 |
| 109 | winds.day | Google, Inc. | 3 May 2025 | 26 Jun 2025 | 3 May 2026 |
| 110 | winds.love | Porkbun, LLC | 11 May 2025 | 16 May 2025 | 11 May 2026 |
| 111 | winds.place | Tucows Domains Inc. | 6 Jul 2025 | 6 Jul 2025 | - |
| 112 | winds.cz | - | 14 Jul 2025 | 17 May 2024 | 14 Jul 2026 |
| 113 | winds-up.com | OVH sas | 14 May 2008 | 15 May 2024 | 14 May 2025 |
| 114 | windsofchange.net | NameCheap, Inc. | 16 Jul 2002 | 16 Jun 2025 | 16 Jul 2026 |
| 115 | windsonne-alternativeenergien.de | - | - | 16 Feb 2017 | - |
| 116 | windsor-telecom.co.uk | - | 27 Apr 1999 | 5 Jul 2023 | 27 Apr 2028 |
| 117 | windsorcircle.com | GoDaddy.com, LLC | 19 Oct 2010 | 9 Apr 2025 | 19 Oct 2025 |
| 118 | windsorstar.com | Webnames.ca Inc. | 23 Dec 1995 | 29 Jul 2025 | 22 Dec 2025 |
| 119 | windsurfers.de | - | - | 10 Aug 2018 | - |
| 120 | windsorcommunities.com | GoDaddy.com, LLC | 8 Dec 1998 | 10 Feb 2025 | 7 Dec 2027 |
| 121 | windsport.com | Network Solutions, LLC | 13 Jun 1995 | 26 Jun 2023 | 12 Jun 2028 |
| 122 | winds-score.com | CloudFlare, Inc. | 5 Jun 2006 | 25 Mar 2024 | 5 Jun 2026 |
| 123 | windsor.gov.uk | - | - | - | - |
| 124 | windstreambusiness.com | MarkMonitor Inc. | 14 Mar 2006 | 2 Aug 2024 | 14 Mar 2026 |
| 125 | windsurfermag.com | - | 8 Nov 2024 | 8 Nov 2024 | 8 Nov 2025 |
| 126 | windshield.com | NameCheap, Inc. | 22 May 1997 | 23 Apr 2025 | 23 May 2026 |
| 127 | winds2min.com | Tucows Domains Inc. | 29 Sep 2020 | 3 Oct 2022 | 29 Sep 2023 |
| 128 | windsor8.com | NameCheap, Inc. | 8 Jan 2005 | 9 Dec 2024 | 8 Jan 2026 |
| 129 | windsorcakecraft.co.uk | - | 22 Aug 2005 | 17 Feb 2025 | 22 Aug 2026 |
| 130 | windsorplywood.com | Network Solutions, LLC | 15 Jan 1996 | 25 Aug 2025 | 14 Jan 2029 |
| 131 | windspots.com | Infomaniak Network SA | 18 Jun 2004 | 10 Jun 2025 | 18 Jun 2026 |
| 132 | windstuffnow.com | Internet Domain Services BS Corp | 26 Aug 2001 | 5 Aug 2025 | 26 Aug 2026 |
| 133 | windsorbrokers.biz | Wild West Domains, LLC | 2 Apr 2002 | 23 Mar 2025 | 1 Apr 2027 |
| 134 | windsorfederal.com | Network Solutions, LLC | 11 Sep 1997 | 12 Jul 2024 | 10 Sep 2029 |
| 135 | windsorhoteis.com.br | - | 25 Sep 1998 | 2 Aug 2022 | 25 Sep 2027 |
| 136 | windsorsmith.com | Instra Corporation Pty Ltd. | 6 Dec 2001 | 19 Nov 2024 | 6 Dec 2025 |
| 137 | windsorstore.com | Network Solutions, LLC | 4 Nov 1999 | 23 Jul 2018 | 4 Nov 2027 |
| 138 | windsorwholesale.com.au | - | - | 1 Jun 2024 | - |
| 139 | windstream.net | MarkMonitor Inc. | 1 Mar 2002 | 22 Jul 2025 | 1 Mar 2026 |
| 140 | windstreamonline.com | MarkMonitor Inc. | 20 Apr 2006 | 2 Aug 2024 | 20 Apr 2026 |
| 141 | windsor-verlag.com | - | 29 Oct 2024 | 29 Oct 2024 | 29 Oct 2025 |
| 142 | windstreambusiness.net | MarkMonitor Inc. | 18 Aug 2010 | 17 Jul 2025 | 18 Aug 2027 |
| 143 | windsurfing.pro | CloudFlare, Inc. | 3 Apr 2007 | 25 Jul 2025 | 3 Apr 2026 |
| 144 | windsad.com | - | 30 Oct 2024 | 16 Aug 2025 | 30 Oct 2025 |
| 145 | windsorbrokers.com | Wild West Domains, LLC | 13 Jan 2000 | 10 Jan 2023 | 13 Jan 2028 |
| 146 | windsorvineyards.com | GoDaddy.com, LLC | 8 Jun 1996 | 20 May 2025 | 7 Jun 2026 |
| 147 | windstream.com | MarkMonitor Inc. | 20 May 1997 | 19 Apr 2025 | 21 May 2027 |
| 148 | windsurfercrs.com | CloudFlare, Inc. | 11 Feb 2009 | 29 Jan 2025 | 11 Feb 2026 |
| 149 | windstsupport.com | eNom, Inc. | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 150 | windsorvillageshops.com | Network Solutions, LLC | 21 Oct 2014 | 23 Jun 2024 | 21 Oct 2026 |
| 151 | windsongrealtors.com | GoDaddy.com, LLC | 21 Oct 2014 | 24 Oct 2016 | 21 Oct 2017 |
| 152 | windshieldsinlongmont.com | GoDaddy.com, LLC | 11 Jan 2017 | 11 Jan 2017 | 11 Jan 2018 |
| 153 | windscreenreplacementgeelong.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 154 | windscreenrepairmelbourne.com | CloudFlare, Inc. | 22 Mar 2022 | 1 Jun 2025 | 22 Mar 2025 |
| 155 | windstorms.net | Hosting Concepts B.V. dba Openprovider | 21 Sep 2023 | 13 Jul 2025 | 21 Sep 2025 |
| 156 | windshieldsinlongmont.info | GoDaddy.com, LLC | 11 Jan 2017 | 12 Jan 2018 | 11 Jan 2019 |
| 157 | windspiritstudio.com | Dynadot, LLC | 14 May 2019 | 29 Apr 2025 | 14 May 2026 |
| 158 | windsornewyork.com | TurnCommerce, Inc. DBA NameBright.com | 15 Aug 2013 | 26 Sep 2024 | 15 Aug 2024 |
| 159 | windsorhypergrill.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 160 | windsorhyperbarandgrill.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 161 | windsorcrossing-apts.com | Wild West Domains, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 162 | windsingeradventures.com | GMO Internet Inc. | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 163 | windshorn.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 164 | windshieldrepairnorfolkva.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 165 | windshieldrepairhamptonva.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 166 | winds-fishing.co.jp | - | 8 Mar 2000 | 1 Apr 2025 | - |
| 167 | windshieldstogo.com | GoDaddy.com, LLC | 18 Aug 1999 | 19 Aug 2025 | 18 Aug 2026 |
| 168 | windsmoor.co.uk | - | 11 Apr 1997 | 11 Mar 2025 | 11 Apr 2026 |
| 169 | windsor-hotels.co.jp | - | 19 Mar 1999 | 1 Apr 2025 | - |
| 170 | windsor.com.pe | - | - | - | - |
| 171 | windsor.ie | - | 18 Aug 1998 | 15 Nov 2020 | 30 Jun 2026 |
| 172 | windsorbaths.com.au | - | - | 28 Nov 2024 | - |
| 173 | windsorbnb.com | GoDaddy.com, LLC | 2 Sep 2014 | 9 Sep 2024 | 2 Sep 2026 |
| 174 | windsorflorida.com | GoDaddy.com, LLC | 10 Dec 1999 | 11 Dec 2024 | 10 Dec 2025 |
| 175 | windsorgov.com | Network Solutions, LLC | 19 Sep 2002 | 18 Sep 2024 | 19 Sep 2027 |
| 176 | windsorhoteis.com | Network Solutions, LLC | 24 Jul 2000 | 24 Jul 2019 | 24 Jul 2029 |
| 177 | windsorpeak.com | GoDaddy.com, LLC | 25 Jul 1996 | 24 Jul 2025 | 24 Jul 2026 |
| 178 | windsorplazahotel.com | Tucows Domains Inc. | 27 May 2004 | 28 Apr 2025 | 27 May 2026 |
| 179 | windsorpubliclibrary.com | NameScout Corp. | 23 Oct 2000 | 20 Sep 2024 | 23 Oct 2025 |
| 180 | windsorqualitymeats.com | NameCheap, Inc. | 24 May 2012 | 1 May 2023 | 24 May 2029 |
| 181 | windsorracket.co.jp | - | 27 Jan 1999 | 1 Feb 2025 | - |
| 182 | windspeaker.co | GoDaddy.com, LLC | 19 Nov 2014 | 24 Nov 2024 | 18 Nov 2025 |
| 183 | windsportswear-shop.de | - | - | 16 Dec 2022 | - |
| 184 | windsrestaurant.com | GoDaddy.com, LLC | 6 Feb 2015 | 19 Feb 2025 | 6 Feb 2026 |
| 185 | windstar.com | MarkMonitor Inc. | 12 Nov 1993 | 24 Jun 2025 | 11 Nov 2025 |
| 186 | windstarcruises.com | GoDaddy.com, LLC | 13 Nov 1995 | 6 Nov 2024 | 2 Dec 2025 |
| 187 | windstoneeditions.com | eNom, Inc. | 18 Jun 1998 | 16 Jun 2025 | 17 Jun 2026 |
| 188 | windstreamhosting.biz | Tucows Domains Inc. | 11 Apr 2008 | 18 Mar 2025 | 10 Apr 2026 |
| 189 | windstreamhosting.com | Tucows Domains Inc. | 13 Jun 2006 | 15 May 2025 | 13 Jun 2026 |
| 190 | windsurf.co.nz | - | 6 Jun 2002 | 15 Oct 2024 | - |
| 191 | windsurf.co.uk | - | - | 5 Feb 2025 | 7 Mar 2026 |
| 192 | windsurf.de | - | - | 27 Jun 2025 | - |
| 193 | windsurfjournal.com | Gandi SAS | 7 Oct 2004 | 18 Aug 2025 | 7 Oct 2030 |
| 194 | windserf.com.ua | - | - | - | - |
| 195 | windsorite.ca | - | 27 Aug 2009 | 29 Jul 2025 | 26 Aug 2026 |
| 196 | windstone.su | - | - | - | - |
| 197 | windsurfer.cl | - | 9 Aug 2007 | - | 2 Sep 2024 |
| 198 | windsorchess.ca | - | - | - | - |
| 199 | windsorsquare.ca | - | 3 Jul 2019 | 3 Jul 2025 | 3 Jul 2026 |
| 200 | windsorpointe.net | GoDaddy.com, LLC | 21 Oct 2014 | 25 Oct 2019 | 21 Oct 2020 |
| 201 | windsor-manor.us | GoDaddy.com, LLC | 21 Oct 2014 | 8 Oct 2017 | 20 Oct 2018 |
| 202 | windshieldsinlongmont.net | GoDaddy.com, LLC | 11 Jan 2017 | 11 Jan 2017 | 11 Jan 2018 |
| 203 | windsurfing.nl | - | 4 Oct 1999 | 30 Nov 2021 | - |
| 204 | windsurfing.pl | - | 4 May 1998 | 27 Mar 2025 | 3 May 2026 |
| 205 | windshorn.info | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 206 | windstarcruisesblog.com | HiChina Zhicheng Technology Limited | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 207 | windsurfing.gr | - | - | - | - |
| 208 | windsorterracebrooklynapartments.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 209 | windsorsquaremanor.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2020 | 20 Apr 2020 | 20 Apr 2021 |
| 210 | windsorprice.com | TurnCommerce, Inc. DBA NameBright.com | 31 Mar 2022 | 2 May 2024 | 31 Mar 2024 |
| 211 | windsornott.com | Tucows Domains Inc. | 23 Oct 2014 | 27 Oct 2015 | 23 Oct 2016 |
| 212 | windsormayorbrucemartin.com | Network Solutions, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 213 | windsorhousehartlepool.com | GoDaddy.com, LLC | 23 Oct 2014 | 24 Oct 2016 | 23 Oct 2017 |
| 214 | windsorhillspropertymanagement.com | GoDaddy.com, LLC | 23 Oct 2014 | 24 Oct 2024 | 23 Oct 2026 |
| 215 | windsoraustin.com | GoDaddy.com, LLC | 18 Sep 2017 | 19 Sep 2023 | 18 Sep 2025 |
| 216 | windsofgod.com | TurnCommerce, Inc. DBA NameBright.com | 7 Jul 2017 | 1 Jul 2020 | 7 Jul 2026 |
| 217 | windsorsmith.com.au | - | - | 23 Mar 2025 | - |
| 218 | winds-wakayama.com | eNom, Inc. | 7 Apr 2006 | 8 Mar 2025 | 7 Apr 2026 |
| 219 | windsonline.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 May 2003 | 22 May 2025 | 22 May 2026 |
| 220 | windsurf.bg | - | 31 Mar 2009 | - | 18 Mar 2016 |
| 221 | windstarembroidery.com | Domain.com, LLC | 17 Mar 2005 | 24 Jun 2025 | 17 Mar 2026 |
| 222 | windsorshores.org | Tucows Domains Inc. | 18 Oct 2011 | 22 Oct 2014 | 18 Oct 2015 |
| 223 | windshorn.org | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 224 | windshorn.net | GoDaddy.com, LLC | 25 Dec 2015 | 25 Dec 2015 | 25 Dec 2016 |
| 225 | winds-tantei.net | eNom, Inc. | 18 Jan 2017 | 23 Dec 2024 | 18 Jan 2026 |
| 226 | windsurfpoint.com | DropCatch.com 724 LLC | 20 Sep 2023 | 11 Apr 2025 | 20 Sep 2025 |
| 227 | windsorsmithrealestate.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2023 | 25 Oct 2025 |
| 228 | windsorsmithestates.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2023 | 25 Oct 2025 |
| 229 | windsorrealestategroupllc.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 230 | windsordesign.biz | eNom, Inc. | 24 Oct 2014 | 24 Oct 2014 | 23 Oct 2015 |
| 231 | windsor125.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Mar 2021 | 18 May 2025 | 16 Mar 2025 |
| 232 | windsorracket-online.com | GoDaddy.com, LLC | 23 Jan 2014 | 29 Jan 2025 | 23 Jan 2026 |
| 233 | windshield-repair-forum.com | GoDaddy.com, LLC | 1 Aug 2003 | 3 Mar 2025 | 2 Mar 2026 |
| 234 | windsoreats.com | eNom, Inc. | 15 Mar 2004 | 22 Aug 2025 | 15 Mar 2026 |
| 235 | winds-of-war.eu | - | - | - | - |
| 236 | windsorct.org | Network Solutions, LLC | 22 Jul 1998 | 28 May 2025 | 21 Jul 2028 |
| 237 | windsorcc.org | eNom, Inc. | 11 Mar 1997 | 26 Feb 2025 | 12 Mar 2026 |
| 238 | windsor-racecourse.co.uk | - | 4 Jan 2000 | 14 Dec 2024 | 4 Jan 2026 |
| 239 | windsorpinerolo.com | - | 21 Jun 2022 | 23 Jul 2023 | 21 Jun 2023 |
| 240 | windsorturf.com.au | - | - | 2 Jun 2024 | - |
| 241 | windsor-partners.net | GoDaddy.com, LLC | 2 Jun 2018 | 14 Aug 2024 | 2 Jun 2024 |
| 242 | windslicer.website | NameCheap, Inc. | 3 Mar 2015 | 9 Mar 2015 | 3 Mar 2016 |
| 243 | windsorseniorcity.com | GoDaddy.com, LLC | 24 May 2013 | 25 May 2015 | 24 May 2016 |
| 244 | windsorthodontics.com | GoDaddy.com, LLC | 20 Dec 2011 | 17 Feb 2014 | 20 Dec 2015 |
| 245 | windshireterrace.com | GoDaddy.com, LLC | 9 Nov 2016 | 12 Mar 2024 | 9 Nov 2026 |
| 246 | windsurfingnews.us | GoDaddy.com, LLC | 26 May 2011 | 7 Jul 2014 | 25 May 2015 |
| 247 | windsorhillvacation.com | GoDaddy.com, LLC | 25 May 2013 | 26 May 2015 | 25 May 2016 |
| 248 | windsorsmithrealestate.info | GoDaddy.com, LLC | 25 Oct 2014 | 9 Dec 2024 | 25 Oct 2025 |
| 249 | windsoretonplan.com | GoDaddy.com, LLC | 7 Jan 2019 | 7 Jan 2019 | 7 Jan 2020 |
| 250 | windsorvanities.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2017 |
| 251 | windsorprecision.com | Tucows Domains Inc. | 25 Oct 2014 | 10 Oct 2024 | 25 Oct 2025 |
| 252 | windsor-kollektion.com | Key-Systems GmbH | 18 Jun 2014 | 19 Jun 2017 | 18 Jun 2018 |
| 253 | windshielddashboardcarmountholder.com | PSI-USA, Inc. dba Domain Robot | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 254 | windshielddashboardcarmount.com | PSI-USA, Inc. dba Domain Robot | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 255 | windskle.com | GoDaddy.com, LLC | 26 May 2014 | 27 May 2015 | 26 May 2016 |
| 256 | windshieldreplacementautoglassrepairlaspalmasca.com | GoDaddy.com, LLC | 27 May 2010 | 27 May 2015 | 27 May 2016 |
| 257 | windsurfinginelsalvador.com | GoDaddy.com, LLC | 27 May 2011 | 28 May 2015 | 27 May 2016 |
| 258 | windsisters.org | GoDaddy.com, LLC | 27 May 2012 | 8 Jun 2015 | 27 May 2016 |
| 259 | windsorpoolandspashop.com | GoDaddy.com, LLC | 27 May 2011 | 28 May 2015 | 27 May 2016 |
| 260 | windsurfingelsalvador.com | GoDaddy.com, LLC | 27 May 2011 | 28 May 2015 | 27 May 2016 |
| 261 | windsorglobaladvisors.com | GoDaddy.com, LLC | 28 May 2014 | 28 May 2015 | 28 May 2016 |
| 262 | windsorpondsnews.com | Key-Systems GmbH | 9 Sep 2020 | 9 Sep 2020 | 9 Sep 2021 |
| 263 | windsormccf.com | GoDaddy.com, LLC | 27 May 2014 | 28 May 2015 | 27 May 2016 |
| 264 | windsitesurvey.com | GoDaddy.com, LLC | 29 May 2013 | 30 May 2015 | 29 May 2016 |
| 265 | windsurfkos.com | Wild West Domains, LLC | 29 May 2014 | 10 Jun 2015 | 29 May 2016 |
| 266 | windsorsmithrealestate.net | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2024 | 25 Oct 2025 |
| 267 | windsurfingparksville.com | GoDaddy.com, LLC | 29 May 2014 | 10 Jun 2015 | 29 May 2016 |
| 268 | windship.co | GoDaddy.com, LLC | 31 May 2014 | 5 Jun 2015 | 30 May 2015 |
| 269 | windsorpetstudio.com | GoDaddy.com, LLC | 30 May 2012 | 31 May 2015 | 30 May 2016 |
| 270 | windsorguanabara.com | GoDaddy.com, LLC | 30 May 2013 | 28 May 2014 | 30 May 2015 |
| 271 | windsorpetphotos.com | GoDaddy.com, LLC | 30 May 2012 | 31 May 2015 | 30 May 2016 |
| 272 | windsurfandkitesurf.com | eNom, Inc. | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 273 | windsterhoods.com | Key-Systems GmbH | 26 Oct 2014 | 30 Aug 2022 | 26 Oct 2027 |
| 274 | windsorbusinessnetworking.com | Name.com, Inc. | 12 Jan 2022 | 12 Jan 2022 | 12 Jan 2023 |
| 275 | windshieldrepairwaco.com | Tucows Domains Inc. | 27 Oct 2014 | 10 Jul 2025 | 27 Oct 2025 |
| 276 | windsheim.com | DomainCraze LLC | 9 Feb 2014 | 10 Feb 2018 | 9 Feb 2019 |
| 277 | windsordowns.com | GoDaddy.com, LLC | 1 Jun 2006 | 2 Sep 2022 | 1 Jun 2026 |
| 278 | windsorcollective.com | TurnCommerce, Inc. DBA NameBright.com | 22 Aug 2020 | 30 Jul 2022 | 22 Aug 2025 |
| 279 | windsor-csc.org | GoDaddy.com, LLC | 27 Jan 2010 | 28 Mar 2014 | 27 Jan 2016 |
| 280 | windsweptcontracting.com | GoDaddy.com, LLC | 2 Jun 2011 | 3 Jun 2015 | 2 Jun 2016 |
| 281 | windstarwildlifeinstitute.org | GoDaddy.com, LLC | 18 May 2017 | 18 May 2017 | 18 May 2018 |
| 282 | windsorrealestateagents.com | GoDaddy.com, LLC | 24 Jun 2018 | 14 Aug 2025 | 24 Jun 2026 |
| 283 | windsurfing-shop.com | GoDaddy.com, LLC | 3 Jun 2005 | 4 Jun 2015 | 3 Jun 2016 |
| 284 | windsurfing-gear.com | GoDaddy.com, LLC | 3 Jun 2005 | 4 Jun 2015 | 3 Jun 2016 |
| 285 | windsorbuilder-tx.com | GoDaddy.com, LLC | 4 Jun 2013 | 4 Jun 2015 | 4 Jun 2016 |
| 286 | windsurfingequipment.net | GoDaddy.com, LLC | 3 Jun 2005 | 4 Jun 2015 | 3 Jun 2016 |
| 287 | windsurfing-sails.com | GoDaddy.com, LLC | 3 Jun 2005 | 4 Jun 2015 | 3 Jun 2016 |
| 288 | windshieldrepairseattlewa.com | GoDaddy.com, LLC | 3 Jun 2011 | 4 Jun 2015 | 3 Jun 2016 |
| 289 | windshieldreplacementseattle.org | - | - | - | - |
| 290 | windsorlocksmithservices.com | GoDaddy.com, LLC | 22 May 2014 | 23 May 2015 | 22 May 2016 |
| 291 | windsorsmithrealestate.org | GoDaddy.com, LLC | 25 Oct 2014 | 9 Dec 2024 | 25 Oct 2025 |
| 292 | windshieldvid.com | GoDaddy.com, LLC | 22 May 2012 | 23 May 2015 | 22 May 2016 |
| 293 | windstormdamagerestorationmichigan.net | Wild West Domains, LLC | 22 May 2010 | 23 May 2015 | 22 May 2016 |
| 294 | windstonecapitalmergers.com | GoDaddy.com, LLC | 21 May 2008 | 22 May 2015 | 21 May 2016 |
| 295 | windshieldreplacementthorntonco.info | Crazy Domains FZ-LLC | 26 Oct 2014 | 27 Oct 2014 | 26 Oct 2015 |
| 296 | windshieldreplacementcarmelin.info | Crazy Domains FZ-LLC | 26 Oct 2014 | 27 Oct 2014 | 26 Oct 2015 |
| 297 | windsorcreekisbetter.com | GoDaddy.com, LLC | 22 May 2012 | 23 May 2015 | 22 May 2016 |
| 298 | windsportaddict.net | GoDaddy.com, LLC | 23 May 2011 | 4 Jun 2015 | 23 May 2016 |
| 299 | windshieldvideo.com | GoDaddy.com, LLC | 22 May 2012 | 23 May 2015 | 22 May 2016 |
| 300 | windsweptwriters.com | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 301 | windsorvotes.com | Gandi SAS | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 302 | windsortrent.com | Domain.com, LLC | 6 Jul 2023 | 19 Aug 2024 | 6 Jul 2024 |
| 303 | windsoreyesurgery.com | Webfusion Ltd. | 27 Oct 2014 | 20 Oct 2016 | 27 Oct 2018 |
| 304 | windshieldrepairdallastx.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 305 | windscreenrepairsessex.com | Webfusion Ltd. | 29 Mar 2016 | 29 Mar 2016 | 29 Mar 2017 |
| 306 | windscreennetwork.com | Webfusion Ltd. | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 307 | windsailwine.com | Network Solutions, LLC | 28 Oct 2014 | 29 Aug 2024 | 28 Oct 2025 |
| 308 | windsorwestsidehomes.com | GoDaddy.com, LLC | 29 Jan 2016 | 29 Jan 2016 | 29 Jan 2017 |
| 309 | windsorwestsidevacationhomes.com | GoDaddy.com, LLC | 18 Apr 2019 | 18 Apr 2025 | 18 Apr 2026 |
| 310 | windsorburke3.com | GoDaddy.com, LLC | 22 May 2014 | 22 May 2015 | 22 May 2016 |
| 311 | windshield-video.com | GoDaddy.com, LLC | 22 May 2012 | 23 May 2015 | 22 May 2016 |
| 312 | windsornaturediscovery.com | GoDaddy.com, LLC | 21 Jun 2021 | 16 Oct 2022 | 21 Jun 2026 |
| 313 | windsofhealing.com | Sibername Internet and Software Technologies Inc. | 2 Sep 2021 | 2 Sep 2021 | 2 Sep 2022 |
| 314 | windsurfing-croatia.com | Hetzner Online AG | 1 Aug 2017 | 1 Aug 2017 | 1 Aug 2018 |
| 315 | windsordiamondclub.com | GoDaddy.com, LLC | 5 Jun 2007 | 6 Jun 2015 | 5 Jun 2016 |
| 316 | windsorautoloans.com | NameKing.com Inc. | 19 Dec 2024 | 19 Dec 2024 | 19 Dec 2025 |
| 317 | windsystems.org | DROPCATCH.COM 812 LLC | 16 Mar 2017 | 14 Dec 2017 | 16 Mar 2018 |
| 318 | windshieldrepair-replacement.com | GoDaddy.com, LLC | 1 Aug 2009 | 20 Apr 2015 | 1 Aug 2015 |
| 319 | windshieldmarkers.com | GoDaddy.com, LLC | 10 Mar 2004 | 11 Mar 2025 | 10 Mar 2026 |
| 320 | windshield-glass.com | GoDaddy.com, LLC | 10 Dec 2014 | 14 Apr 2015 | 10 Dec 2015 |
| 321 | windsorave.com | Squarespace Domains LLC | 19 Mar 2024 | 31 May 2025 | 19 Mar 2025 |
| 322 | windsorburlington.com | GoDaddy.com, LLC | 7 Jun 2007 | 5 Jun 2015 | 7 Jun 2016 |
| 323 | windshieldtogo.com | Moniker Online Services LLC | 23 Nov 2004 | 28 Jan 2025 | 23 Nov 2025 |
| 324 | windsorforestny.org | GoDaddy.com, LLC | 26 Oct 2014 | 27 Oct 2016 | 26 Oct 2017 |
| 325 | windsormlslistings.com | GoDaddy.com, LLC | 28 Oct 2014 | 29 Oct 2016 | 28 Oct 2017 |
| 326 | windsorhotelbath.com | GoDaddy.com, LLC | 1 Oct 2021 | 1 Oct 2021 | 1 Oct 2022 |
| 327 | windsorbarrelfestival.com | GoDaddy.com, LLC | 28 Oct 2014 | 29 Oct 2016 | 28 Oct 2017 |
| 328 | windson.biz | GoDaddy.com, LLC | 28 Oct 2014 | 5 Nov 2017 | 27 Oct 2018 |
| 329 | windsocksbyrenae.com | Tucows Domains Inc. | 25 Oct 2006 | 29 Oct 2014 | 25 Oct 2015 |
| 330 | windsilk.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Oct 2014 | 27 Aug 2025 | 29 Oct 2025 |
| 331 | windshieldmedia.com | GoDaddy.com, LLC | 29 Oct 2014 | 25 Nov 2024 | 29 Oct 2025 |
| 332 | windshieldreplacementsmyrnade.info | GoDaddy.com, LLC | 25 Jun 2011 | 26 Jun 2015 | 25 Jun 2016 |
| 333 | windsurfperu.com | Annulet LLC | 20 May 2016 | 7 Jul 2025 | 20 May 2026 |
| 334 | windson.com | GoDaddy.com, LLC | 18 Nov 2003 | 27 Oct 2024 | 18 Nov 2025 |
| 335 | windsorclubs.com | TurnCommerce, Inc. DBA NameBright.com | 16 Jun 2016 | 27 Jul 2025 | 16 Jun 2025 |
| 336 | windsurfing4.me | Mesh Digital Limited | 18 Mar 2010 | 11 Mar 2016 | 18 Mar 2018 |
| 337 | windstargardens.com | GoDaddy.com, LLC | 12 Dec 2003 | 11 Dec 2018 | 12 Dec 2019 |
| 338 | windsordooroftexas.com | GoDaddy.com, LLC | 24 Mar 2013 | 4 Apr 2015 | 24 Mar 2017 |
| 339 | windsordoorofusa.com | GoDaddy.com, LLC | 24 Mar 2013 | 4 Apr 2015 | 24 Mar 2017 |
| 340 | windsordoortexas.com | GoDaddy.com, LLC | 24 Mar 2013 | 4 Apr 2015 | 24 Mar 2017 |
| 341 | windsordoorusa.com | GoDaddy.com, LLC | 24 Mar 2013 | 4 Apr 2015 | 24 Mar 2017 |
| 342 | windsynergyinc.com | GoDaddy.com, LLC | 18 Apr 2008 | 19 Apr 2014 | 18 Apr 2016 |
| 343 | windsynergy.net | GoDaddy.com, LLC | 17 Apr 2008 | 17 Apr 2015 | 17 Apr 2016 |
| 344 | windsynergy.org | GoDaddy.com, LLC | 17 Apr 2008 | 18 Apr 2014 | 17 Apr 2016 |
| 345 | windspirits.com | TurnCommerce, Inc. DBA NameBright.com | 3 Sep 2000 | 15 Jan 2020 | 3 Sep 2025 |
| 346 | windsupervisors.com | GoDaddy.com, LLC | 1 Apr 2008 | 8 May 2015 | 1 Apr 2016 |
| 347 | windshieldsautoglass.com | GoDaddy.com, LLC | 29 Apr 2021 | 30 Apr 2025 | 29 Apr 2026 |
| 348 | windshieldrepairservice.com | - | 23 Oct 2023 | 18 Nov 2024 | 23 Oct 2025 |
| 349 | windsorarts.com | GoDaddy.com, LLC | 20 Jul 2023 | 20 Jul 2023 | 20 Jul 2024 |
| 350 | windsorcapitol.com | GoDaddy.com, LLC | 24 Mar 2021 | 25 Mar 2024 | 24 Mar 2027 |
| 351 | windsorcleaners.com | GoDaddy.com, LLC | 4 May 2009 | 5 May 2025 | 4 May 2034 |
| 352 | windsorgate.com | eNom, Inc. | 16 Sep 2012 | 13 Sep 2024 | 16 Sep 2025 |
| 353 | windsbraut.com | eNom, Inc. | 13 Jun 2012 | 21 Jun 2025 | 13 Jun 2026 |
| 354 | windshieldpro.com | GoDaddy.com, LLC | 13 Sep 2021 | 17 Sep 2024 | 13 Sep 2025 |
| 355 | windsorunited.com | eNom, Inc. | 24 Feb 2006 | 8 Mar 2025 | 24 Feb 2026 |
| 356 | windsrv.com | eNom, Inc. | 12 Sep 2012 | 21 Dec 2016 | 12 Sep 2017 |
| 357 | windsurferresort.com | Jiangsu Bangning Science and technology Co. Ltd. | 29 Jul 2022 | 1 Sep 2023 | 29 Jul 2023 |
| 358 | windshieldprofessionals.com | eNom, Inc. | 1 Jun 2011 | 21 Aug 2025 | 1 Jun 2026 |
| 359 | windsoar.com | eNom, Inc. | 28 Feb 2011 | 8 Mar 2025 | 28 Feb 2026 |
| 360 | windsofjihad.com | eNom, Inc. | 16 Mar 2010 | 8 Mar 2017 | 16 Mar 2018 |
| 361 | windsoloists.com | eNom, Inc. | 5 Jan 2010 | 17 Jan 2017 | 5 Jan 2018 |
| 362 | windsorart.com | NameCheap, Inc. | 6 May 2025 | 6 May 2025 | 6 May 2026 |
| 363 | windsorauctions.com | TurnCommerce, Inc. DBA NameBright.com | 6 Jan 2023 | 16 Mar 2024 | 6 Jan 2026 |
| 364 | windsorcar.com | NameKing.com Inc. | 24 Aug 2023 | 7 Oct 2024 | 24 Aug 2024 |
| 365 | windsorfood.com | eNom, Inc. | 18 Jul 2012 | 19 Jul 2025 | 18 Jul 2026 |
| 366 | windsorplace.com | eNom, Inc. | 8 Nov 2001 | 8 Nov 2024 | 8 Nov 2025 |
| 367 | windsorrepublic.com | GoDaddy.com, LLC | 16 Oct 2019 | 9 Nov 2024 | 16 Oct 2025 |
| 368 | windsorwoods.com | eNom, Inc. | 18 May 2000 | 26 May 2025 | 18 May 2026 |
| 369 | windsweptkennels.com | DomainRegistry.com, Inc. | 16 May 2025 | 16 May 2025 | 16 May 2026 |
| 370 | windshieldwizard.com | eNom, Inc. | 22 Apr 2000 | 22 Apr 2025 | 22 Apr 2026 |
| 371 | windsorfarm.com | eNom, Inc. | 28 Oct 2011 | 25 Oct 2024 | 28 Oct 2025 |
| 372 | windsorvalley.com | eNom, Inc. | 4 Jun 2011 | 13 Jun 2025 | 4 Jun 2026 |
| 373 | windsource.com | eNom, Inc. | 20 Jul 2002 | 19 Jul 2025 | 20 Jul 2026 |
| 374 | windstyle.com | eNom, Inc. | 10 Nov 2003 | 8 Nov 2024 | 10 Nov 2025 |
| 375 | windshield.xyz | GoDaddy.com, LLC | 3 Jun 2014 | 4 Jun 2025 | 3 Jun 2026 |
| 376 | windsorweddings.com | GoDaddy.com, LLC | 1 Jun 2011 | 5 Jun 2025 | 1 Jun 2026 |
| 377 | windsorcastle.info | GoDaddy.com, LLC | 26 Sep 2022 | 26 Sep 2023 | 26 Sep 2024 |
| 378 | windserf.com | NameCheap, Inc. | 19 Feb 2025 | 19 Feb 2025 | 19 Feb 2026 |
| 379 | windsorelementary.com | eNom, Inc. | 22 Sep 2006 | 21 Sep 2024 | 22 Sep 2025 |
| 380 | windshieldsound.com | GoDaddy.com, LLC | 9 Dec 2009 | 21 Apr 2015 | 9 Dec 2015 |
| 381 | windshieldsounds.com | GoDaddy.com, LLC | 9 Dec 2009 | 21 Apr 2015 | 9 Dec 2015 |
| 382 | windshieldspeaker.com | Hefei Juming Network Technology Co., Ltd | 15 Nov 2022 | 17 Jan 2024 | 15 Nov 2023 |
| 383 | windshieldspeakers.com | GoDaddy.com, LLC | 9 Dec 2009 | 21 Apr 2015 | 9 Dec 2015 |
| 384 | windsuccess.com | GoDaddy.com, LLC | 21 May 2008 | 22 May 2025 | 21 May 2026 |
| 385 | windsweptalpacafarmstead.com | GoDaddy.com, LLC | 4 Feb 2009 | 14 Apr 2015 | 4 Feb 2016 |
| 386 | windshieldreplacementautoglassrepairpalmbayfl.com | GoDaddy.com, LLC | 22 Apr 2010 | 1 Apr 2019 | 22 Apr 2020 |
| 387 | windshieldreplacementautoglassrepairsafetyharborfl.com | GoDaddy.com, LLC | 22 Apr 2010 | 1 Apr 2019 | 22 Apr 2020 |
| 388 | windsoreyecare.com | CloudFlare, Inc. | 14 Mar 2007 | 6 Jun 2025 | 14 Mar 2026 |
| 389 | windsorfunerals.com | GoDaddy.com, LLC | 10 Jul 2009 | 24 Apr 2015 | 10 Jul 2015 |
| 390 | windshieldreplacementchandleraz.com | GoDaddy.com, LLC | 11 Nov 2015 | 12 Nov 2024 | 11 Nov 2025 |
| 391 | windsheildreplacement.com | GoDaddy.com, LLC | 8 May 2024 | 6 May 2025 | 8 May 2026 |
| 392 | windshieldprotection.com | Uniregistrar Corp | 22 Nov 2004 | 29 Nov 2024 | 22 Nov 2025 |
| 393 | windscreen.us | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 10 Feb 2025 | 4 Jun 2025 | 10 Feb 2026 |
| 394 | windsorrvstorage.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 395 | windsorhouseinn.com | GoDaddy.com, LLC | 20 Mar 2019 | 20 Mar 2019 | 20 Mar 2020 |
| 396 | windsor-salt.com | eName Technology Co., Ltd. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 397 | windsor-price.com | Tucows Domains Inc. | 29 Oct 2014 | 2 Nov 2019 | 29 Oct 2019 |
| 398 | windscrossing.com | register.com, Inc. | 17 Nov 2003 | 18 Nov 2024 | 17 Nov 2025 |
| 399 | windscreenspecialistsbirmingham.com | 1&1 Internet AG | 21 Mar 2020 | 21 Mar 2020 | 21 Mar 2026 |
| 400 | windscreenbirmingham.com | 1&1 Internet AG | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2018 |
| 401 | windsorathleticclub.com | GoDaddy.com, LLC | 13 Dec 2008 | 16 Dec 2024 | 13 Dec 2025 |
| 402 | windsongequitherapy.org | Go Montenegro Domains, LLC | 25 Apr 2015 | 5 Apr 2017 | 25 Apr 2018 |
| 403 | windsorpark.org | DropCatch.com 730 LLC | 2 Oct 2022 | 16 Nov 2024 | 2 Oct 2025 |
| 404 | windsornaturopathicclinic.com | GoDaddy.com, LLC | 16 Feb 2011 | 5 Jan 2025 | 16 Feb 2026 |
| 405 | windsongretreat.com | GoDaddy.com, LLC | 5 Jun 2018 | 6 Jun 2024 | 5 Jun 2026 |
| 406 | windshieldadvertising.com | Uniregistrar Corp | 8 Jan 2017 | 10 Jan 2025 | 8 Jan 2026 |
| 407 | windsurfingcamp.com | GoDaddy.com, LLC | 26 Feb 2004 | 13 May 2025 | 17 Mar 2026 |
| 408 | windsorforklift.com | GoDaddy.com, LLC | 28 Aug 2009 | 20 Apr 2015 | 28 Aug 2015 |
| 409 | windsormassageparlours.com | GoDaddy.com, LLC | 22 Jun 2013 | 23 Jun 2015 | 22 Jun 2016 |
| 410 | windshieldreplacementinscottsdale.com | GoDaddy.com, LLC | 26 Apr 2012 | 6 Apr 2019 | 26 Apr 2020 |
| 411 | windshieldreplacementbaltimoremd.info | GoDaddy.com, LLC | 25 Jun 2011 | 26 Jun 2015 | 25 Jun 2016 |
| 412 | windsurf.me | Dynadot, LLC | 21 Oct 2010 | 22 May 2017 | 21 Oct 2017 |
| 413 | windshieldrepairmaryland.com | Wild West Domains, LLC | 19 Dec 2013 | 16 Apr 2015 | 19 Dec 2015 |
| 414 | windschott.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 5 Sep 2013 | 30 May 2025 | 5 Sep 2026 |
| 415 | windstreamsucks.net | GoDaddy.com, LLC | 19 Apr 2018 | 19 Apr 2018 | 19 Apr 2020 |
| 416 | windsurf-kite-martinique.com | Key-Systems GmbH | 3 May 2015 | 21 Apr 2016 | 3 May 2018 |
| 417 | windsockskypark.com | GoDaddy.com, LLC | 18 Mar 2003 | 19 Mar 2024 | 18 Mar 2025 |
| 418 | windshieldreplacementhaverhillma.info | GoDaddy.com, LLC | 25 Jun 2011 | 26 Jun 2015 | 25 Jun 2016 |
| 419 | windsorlondon.com | NameCheap, Inc. | 8 May 2025 | 8 May 2025 | 8 May 2026 |
| 420 | windspinnersstore.com | GoDaddy.com, LLC | 26 Mar 2007 | 6 Mar 2025 | 26 Mar 2026 |
| 421 | windsense.com | TurnCommerce, Inc. DBA NameBright.com | 22 Apr 2015 | 3 Apr 2023 | 22 Apr 2026 |
| 422 | windsor.us | Wild West Domains, LLC | 2 Jun 2004 | 18 May 2025 | 1 Jun 2026 |
| 423 | windsor-canada.com | GoDaddy.com, LLC | 27 Nov 2018 | 27 Nov 2018 | 27 Nov 2019 |
| 424 | windscreenfixer.com | GoDaddy.com, LLC | 9 Jan 2021 | 9 Jan 2021 | 9 Jan 2022 |
| 425 | windsilk.net | HiChina Zhicheng Technology Limited | 29 Oct 2014 | 8 Oct 2018 | 29 Oct 2020 |
| 426 | windsofchange-online.com | NameKing.com Inc. | 14 Aug 2020 | 27 Sep 2023 | 14 Aug 2023 |
| 427 | windsoremployment.com | GoDaddy.com, LLC | 19 Feb 2020 | 20 Feb 2025 | 19 Feb 2026 |
| 428 | windsortv.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jun 2016 | 5 Jun 2020 | 11 Jun 2026 |
| 429 | windsurfingmorocco.com | GoDaddy.com, LLC | 30 Oct 2014 | 11 Jan 2025 | 30 Oct 2024 |
| 430 | windstormcomputing.com | BigRock Solutions Ltd. | 8 Apr 2017 | 7 Jun 2017 | 8 Apr 2018 |
| 431 | windsormeadowshomes.com | GoDaddy.com, LLC | 30 Oct 2014 | 11 Nov 2016 | 30 Oct 2017 |
| 432 | windsorghs.com | Tucows Domains Inc. | 27 Oct 2009 | 31 Oct 2014 | 27 Oct 2015 |
| 433 | windshieldwasherantifreeze.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2024 | 31 Oct 2029 |
| 434 | windsedge.com | GoDaddy.com, LLC | 23 Aug 1998 | 22 Aug 2025 | 22 Aug 2026 |
| 435 | windsplitter.com | NameCheap, Inc. | 18 Feb 2025 | 27 Jun 2025 | 18 Feb 2026 |
| 436 | windsorflights.com | Go Australia Domains, LLC | 29 Aug 2010 | 24 Apr 2015 | 29 Aug 2015 |
| 437 | windsurfingsail.com | TurnCommerce, Inc. DBA NameBright.com | 9 Jan 2022 | 21 Mar 2025 | 9 Jan 2025 |
| 438 | windsorpalmsaz.com | GoDaddy.com, LLC | 17 Apr 2008 | 29 Mar 2025 | 17 Apr 2026 |
| 439 | windshieldreplacementmurfreesborotn.info | GoDaddy.com, LLC | 9 Aug 2011 | 20 Jul 2019 | 9 Aug 2020 |
| 440 | windshieldmaster.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Dec 2012 | 23 Nov 2024 | 4 Dec 2025 |
| 441 | windspecialists.com | TurnCommerce, Inc. DBA NameBright.com | 16 Jan 2013 | 5 Apr 2025 | 16 Jan 2026 |
| 442 | windshieldrepair.co | Dynadot, LLC | 7 Jul 2025 | 3 Aug 2025 | 7 Jul 2026 |
| 443 | windsorcrestcondos.com | GoDaddy.com, LLC | 6 Apr 2006 | 17 Mar 2025 | 6 Apr 2026 |
| 444 | windstorms.com | GoDaddy.com, LLC | 31 Jul 1999 | 21 Mar 2025 | 31 Jul 2026 |
| 445 | windsorfarmsrealestate.com | GoDaddy.com, LLC | 24 Jun 2009 | 25 Jun 2015 | 24 Jun 2016 |
| 446 | windsurfdiscount.com | Key-Systems GmbH | 31 Oct 2014 | 5 Dec 2017 | 31 Oct 2018 |
| 447 | windsortecumsehndp.com | Tucows Domains Inc. | 28 Oct 2011 | 1 Nov 2014 | 28 Oct 2015 |
| 448 | windsorclassics.com | - | 16 Jan 2025 | 19 Jan 2025 | 16 Jan 2026 |
| 449 | windshieldreplacementmesaaz.com | Name.com, Inc. | 31 Oct 2014 | 3 Oct 2016 | 31 Oct 2017 |
| 450 | windshieldkare.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 451 | windsoroverheaddoor.com | GoDaddy.com, LLC | 12 Jun 2005 | 15 Jun 2015 | 12 Jun 2016 |
| 452 | windsorsiteremediation.com | GoDaddy.com, LLC | 12 Jan 2011 | 15 Apr 2015 | 12 Jan 2016 |
| 453 | windsorxtremepaintball.com | GoDaddy.com, LLC | 4 Sep 2008 | 27 Apr 2015 | 4 Sep 2015 |
| 454 | windsor-ladies.com | GoDaddy.com, LLC | 20 Dec 2005 | 5 May 2015 | 28 Aug 2017 |
| 455 | windstreaminternet.org | GoDaddy.com, LLC | 2 Sep 2014 | 2 Nov 2014 | 2 Sep 2015 |
| 456 | windsorcommunites.com | Fabulous.com Pty Ltd. | 18 Sep 2006 | 12 Sep 2024 | 18 Sep 2025 |
| 457 | windstudy.com | Dynadot, LLC | 22 Jan 2007 | 10 Feb 2025 | 22 Jan 2026 |
| 458 | windsuperstore.com | GoDaddy.com, LLC | 11 May 2009 | 12 May 2025 | 11 May 2026 |
| 459 | windsupplystore.com | GoDaddy.com, LLC | 11 May 2009 | 12 May 2025 | 11 May 2026 |
| 460 | windsbraut-wangerooge.de | - | - | 24 Jul 2016 | - |
| 461 | windsorbrass.com | GoDaddy.com, LLC | 2 Jan 2002 | 26 Aug 2024 | 2 Jan 2026 |
| 462 | windshieldglassreplacement.com | GoDaddy.com, LLC | 5 Oct 2020 | 6 Oct 2024 | 5 Oct 2026 |
| 463 | windsorchrysler.com | GoDaddy.com, LLC | 23 Dec 1999 | 12 Nov 2022 | 23 Dec 2025 |
| 464 | windshieldprosnorth.com | - | 20 Aug 2024 | 26 Jul 2025 | 20 Sep 2025 |
| 465 | windsorgardenscaravanpark.com.au | - | - | 6 Aug 2025 | - |
| 466 | windstoneok.com | GoDaddy.com, LLC | 26 Jul 2012 | 31 Jul 2013 | 26 Jul 2018 |
| 467 | windshieldmiami.com | GoDaddy.com, LLC | 15 Jul 2010 | 15 Jul 2025 | 15 Jul 2027 |
| 468 | windshieldsmiami.com | GoDaddy.com, LLC | 15 Jul 2010 | 15 Jul 2025 | 15 Jul 2027 |
| 469 | windshieldrepairmiami.com | GoDaddy.com, LLC | 15 Jul 2010 | 15 Jul 2025 | 15 Jul 2027 |
| 470 | windsorflyingclub.com | Rebel.com Corp. | 27 Jun 2000 | 13 May 2025 | 27 Jun 2026 |
| 471 | windshieldsofarizona.com | GoDaddy.com, LLC | 12 Nov 2013 | 24 Mar 2025 | 23 Mar 2026 |
| 472 | windscience.com | GoDaddy.com, LLC | 30 May 2005 | 29 Jul 2025 | 30 May 2026 |
| 473 | windscreensocal.com | GoDaddy.com, LLC | 29 May 2015 | 10 Jul 2024 | 29 May 2024 |
| 474 | windsurfingchannel.com | eNom, Inc. | 23 Jan 2006 | 23 Jan 2017 | 23 Jan 2018 |
| 475 | windsurfingnetwork.com | eNom, Inc. | 23 Jan 2006 | 23 Jan 2017 | 23 Jan 2018 |
| 476 | windsorind.com | InterNetworX Ltd. & Co. KG | 19 Dec 1995 | 18 Dec 2024 | 18 Dec 2025 |
| 477 | windstreampackages.com | GoDaddy.com, LLC | 8 May 2019 | 8 May 2019 | 8 May 2020 |
| 478 | windsorgirls.com | GoDaddy.com, LLC | 19 Apr 1999 | 8 May 2025 | 19 Apr 2026 |
| 479 | windsorspas.com | NameCheap, Inc. | 21 Nov 2023 | 29 Oct 2024 | 21 Nov 2025 |
| 480 | windsoffire.com | eNom, Inc. | 16 Jul 1996 | 19 Jul 2025 | 15 Jul 2026 |
| 481 | windsorrun.com | GoDaddy.com, LLC | 27 Dec 2011 | 10 Sep 2022 | 27 Dec 2026 |
| 482 | windsorcharteracademy.org | FastDomain Inc. | 22 Jan 2010 | 29 May 2024 | 22 Jan 2029 |
| 483 | windshieldclaims.com | GoDaddy.com, LLC | 30 Sep 2008 | 26 May 2025 | 30 Sep 2025 |
| 484 | windsordentalpc.com | eNom, Inc. | 25 Apr 2008 | 27 Mar 2025 | 25 Apr 2026 |
| 485 | windsortwp.com | Wild West Domains, LLC | 22 Feb 2001 | 10 Feb 2025 | 22 Feb 2030 |
| 486 | windsongcountryestates.com | GoDaddy.com, LLC | 31 Aug 2006 | 1 Sep 2023 | 31 Aug 2025 |
| 487 | windsorknights.com | Network Solutions, LLC | 21 Jan 2003 | 10 Feb 2021 | 21 Jan 2030 |
| 488 | windsorparkcanton.org | Tucows Domains Inc. | 11 Dec 2003 | 2 Dec 2024 | 11 Dec 2025 |
| 489 | windsurfingnevis.com | NameCheap, Inc. | 11 Oct 2022 | 22 Nov 2024 | 11 Oct 2024 |
| 490 | windsor-palms-florida.net | Tucows Domains Inc. | 8 Mar 2002 | 6 Feb 2025 | 8 Mar 2026 |
| 491 | windsorevents.com | TurnCommerce, Inc. DBA NameBright.com | 2 Nov 2015 | 27 Oct 2020 | 2 Nov 2025 |
| 492 | windsorbrisbane.com | - | 27 Jun 2012 | 27 Jun 2012 | 27 Jun 2017 |
| 493 | windsorqld.com | Crazy Domains FZ-LLC | 10 Apr 2013 | 21 Apr 2017 | 10 Apr 2017 |
| 494 | windstrem.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jul 2006 | 26 Feb 2025 | 24 Jul 2026 |
| 495 | windsor-fox.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Oct 1997 | 26 Feb 2025 | 30 Sep 2025 |
| 496 | windsorctgurdwara.org | GoDaddy.com, LLC | 30 Oct 2014 | 14 Dec 2024 | 30 Oct 2034 |
| 497 | windstrean.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Sep 2006 | 30 Aug 2024 | 11 Sep 2025 |
| 498 | windstrea.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Nov 2006 | 26 Feb 2025 | 28 Nov 2025 |
| 499 | windsorautoinc.com | Tucows Domains Inc. | 6 Oct 2008 | 7 Sep 2024 | 6 Oct 2025 |
| 500 | windsurfing.biz | GoDaddy.com, LLC | 8 Jul 2025 | 13 Jul 2025 | 8 Jul 2026 |
| 501 | windstar.biz | NameKing.com Inc. | 26 Feb 2022 | 28 Mar 2023 | 26 Feb 2023 |
| 502 | windshields.biz | GoDaddy.com, LLC | 8 Dec 2021 | 19 Jan 2024 | 8 Dec 2023 |
| 503 | windsorrunningfestival.info | GoDaddy.com, LLC | 31 Oct 2014 | 15 Aug 2017 | 31 Oct 2020 |
| 504 | windsorhillapartments.com | GoDaddy.com, LLC | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 505 | windsfc.com | GoDaddy.com, LLC | 1 Nov 2014 | 6 Nov 2024 | 1 Nov 2026 |
| 506 | windsheildstogo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jun 2005 | 25 Jul 2025 | 13 Jun 2025 |
| 507 | windsockaviation.net | Tucows Domains Inc. | 21 Nov 2009 | 25 Nov 2020 | 21 Nov 2020 |
| 508 | windstram.net | Key-Systems GmbH | 18 Aug 2006 | 4 Aug 2025 | 18 Aug 2026 |
| 509 | windsoruniversity.net | One.com A/S | 9 Mar 2024 | 10 Mar 2025 | 9 Mar 2026 |
| 510 | windsostore.com | NameKing.com Inc. | 4 Aug 2021 | 17 May 2025 | 4 Aug 2026 |
| 511 | windsorrockproducts.com | MarkMonitor Inc. | 22 Dec 1999 | 20 Nov 2024 | 22 Dec 2025 |
| 512 | windstrream.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Sep 2006 | 30 Aug 2024 | 27 Sep 2025 |
| 513 | windstonebehavioral.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Apr 2024 | 20 Aug 2025 | 26 Apr 2026 |
| 514 | windsorbusiness.com | GoDaddy.com, LLC | 18 Dec 2003 | 18 Nov 2024 | 18 Dec 2025 |
| 515 | windsorheights.org | GoDaddy.com, LLC | 24 Apr 2002 | 3 Aug 2025 | 24 Apr 2027 |
| 516 | windsday.com | TurnCommerce, Inc. DBA NameBright.com | 15 Dec 2016 | 6 Apr 2022 | 15 Dec 2025 |
| 517 | windshieldcentral.com | Dynadot, LLC | 26 Apr 2010 | 5 Apr 2025 | 26 Apr 2026 |
| 518 | windshieldrepair99.com | GoDaddy.com, LLC | 13 Jul 2012 | 14 Jul 2025 | 13 Jul 2026 |
| 519 | windstaracademy.com | GoDaddy.com, LLC | 13 Mar 2014 | 14 Mar 2015 | 13 Mar 2016 |
| 520 | windstreeam.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Oct 2006 | 30 Sep 2024 | 15 Oct 2025 |
| 521 | windshutters.com | Tucows Domains Inc. | 29 Apr 1997 | 31 Mar 2025 | 30 Apr 2026 |
| 522 | windsweptliving.com | GoDaddy.com, LLC | 4 Sep 2008 | 5 Sep 2024 | 4 Sep 2026 |
| 523 | windshipaviation.com | GoDaddy.com, LLC | 3 May 2000 | 19 Mar 2025 | 18 Mar 2026 |
| 524 | windsorsstore.com | NameKing.com Inc. | 1 May 2023 | 15 Mar 2025 | 1 May 2026 |
| 525 | windshieldrepair.com | GoDaddy.com, LLC | 9 Dec 1996 | 5 Sep 2022 | 8 Dec 2030 |
| 526 | windsorgift.com | Annulet LLC | 29 Jun 2016 | 12 Aug 2025 | 29 Jun 2025 |
| 527 | windsorwindows.com | Network Solutions, LLC | 21 Jun 1998 | 20 Jun 2024 | 20 Jun 2034 |
| 528 | windsorparkavenue.com | GoDaddy.com, LLC | 7 Nov 2012 | 18 Apr 2015 | 7 Nov 2015 |
| 529 | windsorparknyc.com | GoDaddy.com, LLC | 7 Nov 2012 | 18 Apr 2015 | 7 Nov 2015 |
| 530 | windsorcabinets.com | GoDaddy.com, LLC | 12 Nov 2022 | 23 Jan 2024 | 12 Nov 2023 |
| 531 | windsorvt.com | GoDaddy.com, LLC | 12 May 1998 | 10 May 2025 | 11 May 2026 |
| 532 | windstreambiz.com | MarkMonitor Inc. | 2 Jun 2009 | 2 Aug 2024 | 2 Jun 2026 |
| 533 | windsorparts.net | Beijing Lanhai Jiye Technology Co., Ltd | 21 Nov 2022 | 21 Nov 2023 | 21 Nov 2024 |
| 534 | windsorurology.co.uk | - | 17 Mar 2023 | 2 Jul 2025 | 17 Mar 2026 |
| 535 | windsurfguide.com | - | 31 Jan 2025 | 31 Jan 2025 | 31 Jan 2026 |
| 536 | windsorlockspolice.com | NameCheap, Inc. | 9 Sep 2004 | 10 Aug 2025 | 9 Sep 2026 |
| 537 | windsonganimals.org | Register.it SPA | 22 Aug 2024 | 22 Aug 2024 | 22 Aug 2025 |
| 538 | windshieldreplacementbaldwinparkca.info | GoDaddy.com, LLC | 9 Aug 2011 | 20 May 2015 | 9 Aug 2015 |
| 539 | windshieldreplacementindianapolisin.info | GoDaddy.com, LLC | 9 Aug 2011 | 20 May 2015 | 9 Aug 2015 |
| 540 | windshieldreplacementsanantoniotx.info | GoDaddy.com, LLC | 9 Aug 2011 | 20 May 2015 | 9 Aug 2015 |
| 541 | windsorcasket.com | - | 15 Jul 2017 | 15 Jul 2017 | 15 Jul 2018 |
| 542 | windsorgardensdenver.org | GoDaddy.com, LLC | 19 Mar 2007 | 3 May 2025 | 19 Mar 2026 |
| 543 | windsox.us | GoDaddy.com, LLC | 17 Jun 2002 | 3 Aug 2025 | 16 Jun 2026 |
| 544 | windspeedpro.com | Network Solutions, LLC | 7 Jul 2003 | 5 Mar 2017 | 7 Jul 2019 |
| 545 | windsorhealthplan.com | GoDaddy.com, LLC | 6 Jan 2024 | 5 Jan 2025 | 6 Jan 2026 |
| 546 | windsorparkcoop.com | Network Solutions, LLC | 6 Jul 2005 | 7 May 2024 | 6 Jul 2026 |
| 547 | windsurfing.me | Dynadot, LLC | 13 Sep 2013 | 11 Apr 2017 | 13 Sep 2017 |
| 548 | windsorlivemusic.com | GoDaddy.com, LLC | 11 May 2005 | 23 Jun 2025 | 11 May 2026 |
| 549 | windsor-va.gov | - | - | - | - |
| 550 | windservers.com | NetEarth One Inc. d/b/a NetEarth | 18 Aug 2001 | 17 Aug 2025 | 18 Aug 2026 |
| 551 | windsorlockshistory.org | GoDaddy.com, LLC | 6 Sep 2013 | 24 Aug 2024 | 6 Sep 2025 |
| 552 | windshieldsnearyou.com | GoDaddy.com, LLC | 18 Nov 2009 | 19 Nov 2024 | 18 Nov 2025 |
| 553 | windsurfdiscount.net | Key-Systems GmbH | 31 Oct 2014 | 5 Dec 2017 | 31 Oct 2018 |
| 554 | windsorrunningfestival.org | GoDaddy.com, LLC | 31 Oct 2014 | 15 Aug 2017 | 31 Oct 2020 |
| 555 | windsorrunningfestival.net | GoDaddy.com, LLC | 31 Oct 2014 | 15 Aug 2017 | 31 Oct 2020 |
| 556 | windshieldreplacementauburnhillsmi.info | GoDaddy.com, LLC | 9 Aug 2011 | 20 Jul 2019 | 9 Aug 2020 |
| 557 | windshieldreplacementforestparkga.info | GoDaddy.com, LLC | 9 Aug 2011 | 29 Jan 2015 | 9 Aug 2015 |
| 558 | windstreaml.net | - | - | - | - |
| 559 | windshells.com | Metaregistrar BV Applications | 28 Jul 2022 | 28 Jul 2023 | 28 Jul 2023 |
| 560 | windsorpicturehouse.com | Webfusion Ltd. | 24 Jun 2013 | 11 Jul 2015 | 24 Jun 2016 |
| 561 | windsolution.com | TurnCommerce, Inc. DBA NameBright.com | 29 Oct 2004 | 30 Aug 2022 | 29 Oct 2025 |
| 562 | windshieldinsurance.com | TurnCommerce, Inc. DBA NameBright.com | 23 Mar 2007 | 26 Feb 2025 | 23 Mar 2026 |
| 563 | windsgallery.com | GoDaddy.com, LLC | 16 Mar 2003 | 17 Mar 2025 | 16 Mar 2026 |
| 564 | windscreens.net | - | 21 Aug 2015 | 19 Sep 2024 | 21 Aug 2026 |
| 565 | windsorgallery.com | GoDaddy.com, LLC | 9 Sep 1999 | 4 Mar 2025 | 26 Feb 2026 |
| 566 | windsorhillsfamilydentistrypc.com | register.com, Inc. | 10 Jun 2012 | 12 Jun 2015 | 10 Jun 2016 |
| 567 | windsorhomepricing.com | Tucows Domains Inc. | 22 Oct 2004 | 26 Oct 2024 | 22 Oct 2025 |
| 568 | windsofchangefilms.com | eNom, Inc. | 13 Mar 2016 | 13 Mar 2016 | 13 Mar 2017 |
| 569 | windsorphysiotherapist.com | Rebel.com Corp. | 3 Nov 2014 | 18 Sep 2024 | 3 Nov 2025 |
| 570 | windsorhuntclub.com | GoDaddy.com, LLC | 2 Nov 2014 | 3 Nov 2024 | 2 Nov 2026 |
| 571 | windsorductcleaning.com | - | 1 Aug 2025 | 1 Aug 2025 | 1 Aug 2026 |
| 572 | windsoratwestsidekissimmee.com | GoDaddy.com, LLC | 25 Aug 2016 | 17 Jun 2025 | 25 Aug 2025 |
| 573 | windscreenreplacementtipperary.com | Tucows Domains Inc. | 30 Oct 2008 | 3 Nov 2014 | 30 Oct 2015 |
| 574 | windscreenreplacementlimerick.com | Tucows Domains Inc. | 30 Oct 2008 | 3 Nov 2014 | 30 Oct 2015 |
| 575 | windsongcharters.com | CloudFlare, Inc. | 24 Feb 2003 | 22 Mar 2025 | 24 Feb 2027 |
| 576 | windsorraceway.com | GoDaddy.com, LLC | 8 Jun 1996 | 14 May 2025 | 7 Jun 2026 |
| 577 | windsurfcanarias.com | Dynadot, LLC | 1 Feb 2013 | 13 Jul 2017 | 1 Feb 2018 |
| 578 | windsor-palms-resort.com | GoDaddy.com, LLC | 8 Feb 2019 | 8 Feb 2019 | 8 Feb 2020 |
| 579 | windsorwelcomeweek.com | Realtime Register B.V. | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 580 | windshieldnet.com | eNom, Inc. | 4 Apr 2016 | 4 Apr 2016 | 4 Apr 2017 |
| 581 | windshieldnetwork.com | GoDaddy.com, LLC | 21 May 2018 | 21 May 2025 | 21 May 2026 |
| 582 | windsorchopper.com | GoDaddy.com, LLC | 24 May 2021 | 5 Jun 2024 | 24 May 2026 |
| 583 | windshieldreplacementphoenix.biz | GoDaddy.com, LLC | 7 Jun 2012 | 7 Jun 2015 | 6 Jun 2015 |
| 584 | windshieldwitness.com | NameCheap, Inc. | 24 Dec 2010 | 24 Nov 2024 | 24 Dec 2025 |
| 585 | windsongradiology.com | eNom, Inc. | 24 Jan 1999 | 23 Jan 2024 | 24 Jan 2027 |
| 586 | windsorgardens.com | GoDaddy.com, LLC | 27 Jul 1998 | 26 Jul 2025 | 26 Jul 2026 |
| 587 | windsorlatinmass.org | GoDaddy.com, LLC | 20 Sep 2003 | 4 Nov 2024 | 20 Sep 2025 |
| 588 | windsorlockschamber.org | Beijing Lanhai Jiye Technology Co., Ltd | 27 Mar 2025 | 11 Jun 2025 | 27 Mar 2026 |
| 589 | windsorteakfurniture.com | GoDaddy.com, LLC | 25 Apr 2012 | 25 Feb 2025 | 25 Apr 2030 |
| 590 | windspeedbyzip.com | Namesilo, LLC | 9 Jul 2008 | 10 Jul 2025 | 9 Jul 2026 |
| 591 | windshieldreplacementlasvegas.net | GoDaddy.com, LLC | 7 Jun 2012 | 8 Jun 2015 | 7 Jun 2016 |
| 592 | windsorbbc.com | MAFF Inc. | 24 Jun 2022 | 2 Sep 2023 | 24 Jun 2023 |
| 593 | windscafe.com | Network Solutions, LLC | 10 Mar 1997 | 1 Mar 2021 | 11 Mar 2026 |
| 594 | windsofwinterrelease.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Apr 2024 | 24 Aug 2025 | 21 Apr 2026 |
| 595 | windsorumc.org | GoDaddy.com, LLC | 1 Oct 2012 | 28 Jun 2024 | 1 Oct 2025 |
| 596 | windshieldwiperswitch.com | GoDaddy.com, LLC | 1 Mar 2014 | 3 Feb 2025 | 1 Mar 2026 |
| 597 | windsongphotoblog.com | Jiangsu Bangning Science and technology Co. Ltd. | 26 Nov 2019 | 26 Nov 2019 | 26 Nov 2020 |
| 598 | windsensations.com | Tucows Domains Inc. | 8 Apr 2000 | 12 Apr 2025 | 8 Apr 2026 |
| 599 | windshieldreplacementdenver.biz | GoDaddy.com, LLC | 7 Jun 2012 | 7 Jun 2015 | 6 Jun 2015 |
| 600 | windstream-inc.com | GoDaddy.com, LLC | 3 Jun 2008 | 4 Jun 2024 | 3 Jun 2026 |
| 601 | windscreenremoval.com | Network Solutions, LLC | 23 Aug 2017 | 23 Aug 2017 | 23 Aug 2018 |
| 602 | windstorminspections.com | GoDaddy.com, LLC | 28 Sep 2003 | 27 Mar 2024 | 28 Sep 2025 |
| 603 | windsorspitfires.com | Rebel.com Corp. | 7 Jan 1999 | 23 Nov 2024 | 7 Jan 2026 |
| 604 | windsormorning.com | GoDaddy.com, LLC | 9 Jun 2013 | 9 Jun 2015 | 9 Jun 2016 |
| 605 | windshieldreplacementdallas.biz | GoDaddy.com, LLC | 7 Jun 2012 | 7 Jun 2015 | 6 Jun 2015 |
| 606 | windsor-csd.org | Amazon Registrar, Inc. | 11 Mar 1998 | 22 Aug 2025 | 10 Mar 2026 |
| 607 | windsorparknc.com | GoDaddy.com, LLC | 5 Nov 2004 | 28 Oct 2024 | 5 Nov 2025 |
| 608 | windsteam.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jul 2006 | 26 Feb 2025 | 18 Jul 2026 |
| 609 | windshieldreplacementchicago.biz | GoDaddy.com, LLC | 7 Jun 2012 | 7 Jun 2015 | 6 Jun 2015 |
| 610 | windsorlocksct.org | Name.com, Inc. | 26 Oct 2007 | 29 Oct 2024 | 26 Oct 2025 |
| 611 | windsorhs.com | GoDaddy.com, LLC | 28 Jun 2000 | 14 May 2025 | 28 Jun 2026 |
| 612 | windsorpalmsusa.com | 1&1 Internet AG | 5 Jul 2002 | 6 Jul 2025 | 5 Jul 2026 |
| 613 | windsorpets.com | NameCheap, Inc. | 25 Jan 2024 | 26 Dec 2024 | 25 Jan 2026 |
| 614 | windsorwizards.org | GoDaddy.com, LLC | 14 Nov 2007 | 29 Dec 2024 | 14 Nov 2025 |
| 615 | windsorcolesvillelandownerscoalition.com | GoDaddy.com, LLC | 26 Apr 2014 | 26 Apr 2015 | 26 Apr 2016 |
| 616 | windsorcare.com | TierraNet Inc. d/b/a DomainDiscover | 16 Jun 2004 | 30 May 2025 | 16 Jun 2026 |
| 617 | windshieldsco.com | Wild West Domains, LLC | 11 Jun 2014 | 12 Jun 2015 | 11 Jun 2016 |
| 618 | windsoratmeadowhills.com | GoDaddy.com, LLC | 14 Mar 2011 | 15 Mar 2025 | 14 Mar 2026 |
| 619 | windsingerx.com | 1&1 Internet AG | 31 Jul 2013 | 1 Aug 2014 | 31 Jul 2015 |
| 620 | windsweptpl.com | GoDaddy.com, LLC | 11 Jun 2009 | 12 Jun 2015 | 11 Jun 2016 |
| 621 | windsormanorschooldistrict.com | - | - | - | - |
| 622 | windsorestatesales.com | Wild West Domains, LLC | 17 Jul 2006 | 22 Apr 2025 | 22 Apr 2026 |
| 623 | windsorpond.com | Google, Inc. | 28 Oct 2016 | 14 Oct 2024 | 28 Oct 2025 |
| 624 | windsorpersonaltrainer.com | Go France Domains, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 625 | windsorhotelhermanus.com | Fabulous.com Pty Ltd. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 626 | windsorhomes4you.com | GoDaddy.com, LLC | 3 Nov 2014 | 4 Nov 2016 | 3 Nov 2018 |
| 627 | windsorfun.com | NameCheap, Inc. | 25 Jan 2024 | 26 Dec 2024 | 25 Jan 2026 |
| 628 | windsorfixandflipinvesting.com | Tucows Domains Inc. | 4 Nov 2014 | 8 Nov 2015 | 4 Nov 2016 |
| 629 | windsoratwestsidevacationvillas.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2016 |
| 630 | windsor-pond.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 631 | windscreenrepairdublin.com | GoDaddy.com, LLC | 23 Jan 2024 | 23 Jan 2024 | 23 Jan 2025 |
| 632 | windshieldreplacement.info | Google, Inc. | 15 Mar 2023 | 3 Jun 2025 | 15 Mar 2026 |
| 633 | windsorsymphony.com | Amazon Registrar, Inc. | 31 Mar 1999 | 13 Jun 2025 | 31 Mar 2026 |
| 634 | windsoranimalclinic.com | GoDaddy.com, LLC | 30 Jun 2009 | 1 Jul 2025 | 30 Jun 2027 |
| 635 | windstarequipment.com | eNom, Inc. | 27 Nov 2012 | 29 Oct 2024 | 27 Nov 2025 |
| 636 | windsweptstables.net | Network Solutions, LLC | 13 Dec 2004 | 14 Feb 2025 | 13 Dec 2025 |
| 637 | windstreambundledeals.com | MarkMonitor Inc. | 12 Sep 2013 | 2 Aug 2024 | 12 Sep 2025 |
| 638 | windsorparkassembly.org | - | 4 May 2004 | 4 May 2004 | 4 May 2017 |
| 639 | windsoratmeridian.com | register.com, Inc. | 14 Mar 2011 | 24 Nov 2021 | 14 Mar 2030 |
| 640 | windsorlifesettlements.com | GoDaddy.com, LLC | 14 Jun 2012 | 15 Jun 2025 | 14 Jun 2026 |
| 641 | windsordoorsdirect.com | GoDaddy.com, LLC | 18 Aug 2010 | 26 Mar 2025 | 25 Mar 2026 |
| 642 | windsorbands.org | GoDaddy.com, LLC | 13 Dec 2022 | 22 Aug 2024 | 13 Dec 2032 |
| 643 | windsorstationvt.com | GoDaddy.com, LLC | 11 Jun 2013 | 11 Jun 2025 | 11 Jun 2027 |
| 644 | windsorparkillinois.org | GoDaddy.com, LLC | 9 Mar 2012 | 23 Apr 2025 | 9 Mar 2026 |
| 645 | windsormassage.ca | - | 27 Dec 2019 | 12 Dec 2021 | 27 Dec 2022 |
| 646 | windsetfarms.com | Network Solutions, LLC | 14 Jul 2001 | 14 May 2021 | 14 Jul 2026 |
| 647 | windsorpublishing.com | Network Solutions, LLC | 18 Mar 1998 | 3 Mar 2021 | 17 Mar 2026 |
| 648 | windstopper.com | MarkMonitor Inc. | 11 Jun 1998 | 9 May 2025 | 10 Jun 2026 |
| 649 | windsorsuites.com | GoDaddy.com, LLC | 7 Oct 2003 | 3 Jul 2025 | 7 Oct 2026 |
| 650 | windstar-cruises-luxury-lines.com | NameForward LLC | 12 Jan 2023 | 24 Mar 2024 | 12 Jan 2024 |
| 651 | windsorjcc.org | GMO Internet Inc. | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 652 | windsornissan.com | GoDaddy.com, LLC | 29 Nov 2000 | 30 Nov 2024 | 29 Nov 2025 |
| 653 | windsofsamsara.com | GoDaddy.com, LLC | 11 Jun 2024 | 24 Jul 2025 | 11 Jun 2026 |
| 654 | windsorcometsaau.com | Network Solutions, LLC | 12 Nov 2014 | 23 Jun 2024 | 12 Nov 2026 |
| 655 | windsongapartmentsoftaylor.com | Tucows Domains Inc. | 19 Jan 2012 | 21 Dec 2016 | 19 Jan 2018 |
| 656 | windsculpture.com | GoDaddy.com, LLC | 5 Apr 1999 | 2 Mar 2024 | 5 Apr 2028 |
| 657 | windstoneconstructionok.com | GoDaddy.com, LLC | 4 Nov 2014 | 9 Nov 2022 | 4 Nov 2032 |
| 658 | windsorservicegarage.com | GoDaddy.com, LLC | 4 Nov 2014 | 3 Nov 2024 | 4 Nov 2026 |
| 659 | windsorrepairloans.com | GoDaddy.com, LLC | 4 Nov 2014 | 3 Nov 2024 | 4 Nov 2026 |
| 660 | windsorautoservice.com | GoDaddy.com, LLC | 4 Nov 2014 | 3 Nov 2024 | 4 Nov 2026 |
| 661 | windsorhomes.us | GoDaddy.com, LLC | 15 Nov 2002 | 15 Feb 2024 | 14 Nov 2025 |
| 662 | windsurfinglens.com | GoDaddy.com, LLC | 21 May 2024 | 26 May 2025 | 21 May 2026 |
| 663 | windsorsanitation.com | DomainPeople, Inc. | 14 Aug 2003 | 29 May 2025 | 14 Aug 2026 |
| 664 | windsor-stevens.com | Tucows Domains Inc. | 31 Jan 2000 | 4 Nov 2024 | 31 Jan 2030 |
| 665 | windsoreyecare.ca | - | 4 Dec 2007 | 14 Jun 2024 | 4 Dec 2025 |
| 666 | windshieldreplacementcostz.com | NameCheap, Inc. | 22 Feb 2013 | 1 Apr 2025 | 22 Feb 2026 |
| 667 | windsorasheville.com | GoDaddy.com, LLC | 7 Jan 2014 | 12 Dec 2024 | 7 Jan 2027 |
| 668 | windstreampower.com | GoDaddy.com, LLC | 18 Dec 1998 | 3 Dec 2024 | 18 Dec 2026 |
| 669 | windsongranchliving.com | GoDaddy.com, LLC | 2 Jan 2013 | 3 Jan 2025 | 2 Jan 2026 |
| 670 | windspiritmedicine.com | Internet Domain Services BS Corp | 1 Feb 2008 | 26 Jan 2025 | 1 Feb 2026 |
| 671 | windsolarenergy.org | Domain.com, LLC | 4 Dec 2008 | 19 Nov 2024 | 4 Dec 2025 |
| 672 | windstreamtalent.com | MarkMonitor Inc. | 23 Apr 2013 | 22 Mar 2025 | 23 Apr 2027 |
| 673 | windsorcastlepark.com | GoDaddy.com, LLC | 21 Apr 2010 | 7 Sep 2022 | 21 Apr 2030 |
| 674 | windstonehoa.com | GoDaddy.com, LLC | 24 Feb 2005 | 24 Jun 2025 | 24 Jun 2027 |
| 675 | windsun.com | GoDaddy.com, LLC | 3 Jan 1997 | 3 Jan 2023 | 2 Jan 2029 |
| 676 | windsorhomestexas.com | GoDaddy.com, LLC | 27 Dec 2013 | 10 Feb 2024 | 9 Feb 2026 |
| 677 | windsorfunds.com | GoDaddy.com, LLC | 8 Feb 2013 | 1 Aug 2025 | 8 Feb 2027 |
| 678 | windsorofsavoy.com | Network Solutions, LLC | 11 Dec 1996 | 22 Apr 2025 | 10 Dec 2027 |
| 679 | windshieldco.com | TurnCommerce, Inc. DBA NameBright.com | 24 Mar 2022 | 23 Aug 2022 | 24 Mar 2026 |
| 680 | windshieldreplacementthousandoaks.com | GoDaddy.com, LLC | 12 Jun 2012 | 13 Jun 2015 | 12 Jun 2016 |
| 681 | windsor-gymnastics.com | GoDaddy.com, LLC | 13 Jun 2013 | 13 Jun 2015 | 13 Jun 2016 |
| 682 | windsorrepairloans.info | GoDaddy.com, LLC | 4 Nov 2014 | 6 Nov 2024 | 4 Nov 2024 |
| 683 | windsofwintercountdown.com | GoDaddy.com, LLC | 12 Jun 2013 | 13 Jun 2015 | 12 Jun 2016 |
| 684 | windsurfinghistory.com | Tucows Domains Inc. | 6 Nov 2014 | 24 Apr 2025 | 6 Nov 2025 |
| 685 | windsorhousestudios.com | Network Solutions, LLC | 5 Nov 2014 | 3 Nov 2017 | 5 Nov 2020 |
| 686 | windsorgatesapartments.com | Wild West Domains, LLC | 6 Nov 2014 | 11 Nov 2016 | 6 Nov 2017 |
| 687 | windsom.com | HiChina Zhicheng Technology Limited | 13 Mar 2017 | 21 Mar 2017 | 13 Mar 2027 |
| 688 | windshieldstampa.com | NameCheap, Inc. | 3 Nov 2022 | 15 Dec 2024 | 3 Nov 2024 |
| 689 | windshieldreplacementstpetersburg.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 690 | windshieldreplacementstpete.com | GoDaddy.com, LLC | 5 Nov 2014 | 6 Nov 2024 | 5 Nov 2025 |
| 691 | windshieldreplacementftmyers.com | GoDaddy.com, LLC | 5 Nov 2014 | 6 Nov 2024 | 5 Nov 2025 |
| 692 | windshieldreplacementbradenton.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 693 | windshieldrepair360.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 694 | windshieldcheck.com | CSC Corporate Domains, Inc. | 5 Nov 2014 | 20 May 2021 | 5 Nov 2026 |
| 695 | windscreenrepairfranchise.com | Tucows Domains Inc. | 5 Nov 2014 | 9 Nov 2015 | 5 Nov 2016 |
| 696 | windsailharbor.com | Tucows Domains Inc. | 14 Aug 2013 | 18 Aug 2014 | 14 Aug 2015 |
| 697 | windsofloveministires.com | Launchpad, Inc. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 698 | windsongranchsubdivision.com | GoDaddy.com, LLC | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2016 |
| 699 | windsorbbb.com | GMO Internet Inc. | 14 Apr 2020 | 15 Apr 2020 | 14 Apr 2021 |
| 700 | windsorconnecticutluxuryrealestate.com | GoDaddy.com, LLC | 17 Aug 2014 | 18 Aug 2016 | 17 Aug 2017 |
| 701 | windsorcopy.com | Google, Inc. | 19 Feb 2017 | 3 Apr 2025 | 19 Feb 2025 |
| 702 | windsorlocksconnecticutluxuryrealestate.com | GoDaddy.com, LLC | 17 Aug 2014 | 18 Aug 2016 | 17 Aug 2017 |
| 703 | windsurfingoutlet.com | Network Solutions, LLC | 17 Jun 2020 | 19 Aug 2025 | 17 Jun 2026 |
| 704 | windsorfamilymedicine.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jun 2005 | 26 Jun 2015 | 25 Jun 2016 |
| 705 | windsolarpowered.com | Wild West Domains, LLC | 15 Jun 2011 | 16 Jun 2015 | 15 Jun 2016 |
| 706 | windstsream.com | NameCheap, Inc. | 6 Oct 2023 | 18 Dec 2024 | 6 Oct 2024 |
| 707 | windsurfingboards.net | NameCheap, Inc. | 8 Feb 2018 | 8 Feb 2018 | 8 Feb 2019 |
| 708 | windshieldreplacementautoglassrepairphiladelphiapa.com | GoDaddy.com, LLC | 15 Jun 2010 | 16 Jun 2015 | 15 Jun 2016 |
| 709 | windshieldrepairdirectory.com | GoDaddy.com, LLC | 16 Jun 2010 | 17 Jun 2015 | 16 Jun 2016 |
| 710 | windsorathletics.org | GoDaddy.com, LLC | 16 Jun 2011 | 28 Jun 2015 | 16 Jun 2016 |
| 711 | windsorgrand.com | GoDaddy.com, LLC | 15 May 2024 | 15 May 2024 | 15 May 2027 |
| 712 | windshieldrepair303.com | GoDaddy.com, LLC | 17 Jun 2010 | 18 Jun 2015 | 17 Jun 2016 |
| 713 | windsorrootcanal.com | GoDaddy.com, LLC | 17 Jun 2008 | 18 Jun 2015 | 17 Jun 2016 |
| 714 | windshieldreplacementexperts.net | GoDaddy.com, LLC | 18 Jun 2014 | 19 Jun 2015 | 18 Jun 2016 |
| 715 | windscreenfactory.com | DropCatch.com 881 LLC | 31 Aug 2025 | 1 Sep 2025 | 31 Aug 2026 |
| 716 | windshieldscalifornia.com | Google, Inc. | 22 Jan 2024 | 7 Jan 2025 | 22 Jan 2026 |
| 717 | windshieldglassnow.com | GoDaddy.com, LLC | 18 Aug 2014 | 19 Aug 2024 | 18 Aug 2026 |
| 718 | windshieldglassnow.info | GoDaddy.com, LLC | 18 Aug 2014 | 2 Oct 2024 | 18 Aug 2026 |
| 719 | windshieldglassnow.net | GoDaddy.com, LLC | 18 Aug 2014 | 19 Aug 2024 | 18 Aug 2026 |
| 720 | windshieldglassnow.org | GoDaddy.com, LLC | 18 Aug 2014 | 2 Oct 2024 | 18 Aug 2026 |
| 721 | windshieldreplacementcompany.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 722 | windsorcourtghana.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 723 | windsorgg.com | TurnCommerce, Inc. DBA NameBright.com | 28 Jan 2019 | 28 Jan 2019 | 28 Jan 2020 |
| 724 | windsormill410locksmith.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 725 | windsormouthguard.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 726 | windsweptmarina.com | TurnCommerce, Inc. DBA NameBright.com | 18 Aug 2014 | 30 Oct 2024 | 18 Aug 2024 |
| 727 | windshieldrepairinchicago.com | GoDaddy.com, LLC | 19 Jun 2012 | 19 Jun 2015 | 19 Jun 2016 |
| 728 | windsorfooddeals.com | GoDaddy.com, LLC | 20 Jun 2014 | 20 Jun 2015 | 20 Jun 2016 |
| 729 | windshielddoctorwi.com | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 730 | windsoradvertising.com | Automattic Inc. | 28 Apr 2019 | 28 Apr 2019 | 28 Apr 2020 |
| 731 | windshieldreplacementsandiego.org | GoDaddy.com, LLC | 2 Jul 2016 | 2 Jul 2016 | 2 Jul 2017 |
| 732 | windsurferstore.com | GoDaddy.com, LLC | 4 Jul 2015 | 7 Jul 2015 | 4 Jul 2016 |
| 733 | windshieldsunshields.com | GoDaddy.com, LLC | 26 Feb 2010 | 15 Apr 2015 | 26 Feb 2016 |
| 734 | windshieldkit.com | GoDaddy.com, LLC | 27 Mar 2014 | 13 May 2025 | 27 Mar 2026 |
| 735 | windsurfingvacations.net | Fabulous.com Pty Ltd. | 1 Oct 2006 | 4 Nov 2014 | 1 Oct 2015 |
| 736 | windscreens2u.net | Tucows Domains Inc. | 4 Nov 2014 | 8 Nov 2017 | 4 Nov 2017 |
| 737 | windshakesthebarley.com | Wild West Domains, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 738 | windshieldmax.com | Dynadot, LLC | 6 May 2022 | 16 Jul 2023 | 6 May 2023 |
| 739 | windshieldrepairgrassvalley.com | Tucows Domains Inc. | 15 Aug 2011 | 20 Aug 2014 | 15 Aug 2015 |
| 740 | windshieldreplacementtoronto.com | Mesh Digital Limited | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 741 | windsor-movers.com | GoDaddy.com, LLC | 19 Aug 2014 | 31 Oct 2024 | 19 Aug 2024 |
| 742 | windsorlandhomes.com | register.com, Inc. | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 743 | windstarlpg.net | GoDaddy.com, LLC | 19 Aug 2014 | 15 Aug 2016 | 19 Aug 2017 |
| 744 | windstreamkickskittens.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 745 | windsolarenergy.info | Hosting Ukraine LLC | 21 Oct 2017 | 6 Aug 2018 | 21 Oct 2026 |
| 746 | windswepttaxi.com | register.com, Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 747 | windsorforestcommunity.com | Tucows Domains Inc. | 3 Nov 2011 | 7 Nov 2014 | 3 Nov 2015 |
| 748 | windsorestatesphase2.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 749 | windshieldprotector.com | Annulet LLC | 23 Aug 2016 | 10 Oct 2024 | 23 Aug 2025 |
| 750 | windsoartravel.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 751 | windsorbailiffservices.com | Dynadot3 LLC | 11 Sep 2022 | 21 Nov 2023 | 11 Sep 2023 |
| 752 | windsornine.com | Google, Inc. | 24 Jun 2015 | 8 Jul 2025 | 24 Jun 2026 |
| 753 | windshield-mansion.com | GMO Internet Inc. | 20 Aug 2014 | 29 May 2017 | 20 Aug 2018 |
| 754 | windshieldrepairalbuquerque.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Apr 2023 | 27 Apr 2025 | 26 Apr 2026 |
| 755 | windshieldrepairanaheim.com | Namesilo, LLC | 21 Sep 2023 | 22 Sep 2024 | 21 Sep 2025 |
| 756 | windshieldrepairanchorage.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 757 | windshieldrepaircalifornia.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2025 | 20 Aug 2027 |
| 758 | windshieldrepaircleveland.com | Google, Inc. | 14 Sep 2021 | 14 Sep 2021 | 14 Sep 2022 |
| 759 | windshieldrepaircoloradosprings.com | GoDaddy.com, LLC | 9 Oct 2018 | 25 Sep 2024 | 9 Oct 2025 |
| 760 | windshieldrepaircostamesa.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 761 | windshieldrepairdallas.com | GoDaddy.com, LLC | 14 Oct 2021 | 16 Oct 2024 | 14 Oct 2025 |
| 762 | windshieldrepairflorida.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2025 | 20 Aug 2027 |
| 763 | windshieldrepairfresno.com | NameCheap, Inc. | 14 Sep 2023 | 26 Nov 2024 | 14 Sep 2024 |
| 764 | windshieldrepairkansascity.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 765 | windshieldrepairny.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2025 | 20 Aug 2027 |
| 766 | windshieldrepairoakland.com | Google, Inc. | 14 Sep 2021 | 14 Sep 2021 | 14 Sep 2022 |
| 767 | windshieldrepairomaha.com | GoDaddy.com, LLC | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 768 | windshieldrepairpittsburgh.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 769 | windshieldrepairsacramento.com | Google, Inc. | 14 Sep 2021 | 14 Sep 2021 | 14 Sep 2022 |
| 770 | windshieldrepairseattle.com | Google, Inc. | 14 Sep 2021 | 14 Sep 2021 | 14 Sep 2022 |
| 771 | windshieldrepairtampa.com | - | 11 Dec 2022 | 7 Jan 2025 | 11 Dec 2025 |
| 772 | windshieldreplacementalbuquerque.com | NameCheap, Inc. | 8 Dec 2022 | 19 Feb 2024 | 8 Dec 2023 |
| 773 | windshieldreplacementatlanta.com | NameKing.com Inc. | 15 Aug 2022 | 29 Oct 2023 | 15 Aug 2023 |
| 774 | windshieldreplacementaustin.com | - | 30 Jan 2023 | 23 Feb 2024 | 30 Jan 2026 |
| 775 | windshieldreplacementcalifornia.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2025 | 20 Aug 2027 |
| 776 | windshieldreplacementchicago.com | NameCheap, Inc. | 7 May 2024 | 7 May 2025 | 7 May 2026 |
| 777 | windshieldreplacementcincinnati.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 778 | windshieldreplacementcolorado.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2025 | 20 Aug 2027 |
| 779 | windshieldreplacementcoloradosprings.com | CloudFlare, Inc. | 23 Jan 2024 | 20 Mar 2025 | 23 Jan 2026 |
| 780 | windshieldreplacementflorida.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2025 | 20 Aug 2027 |
| 781 | windshieldreplacementindianapolis.com | GoDaddy.com, LLC | 7 Oct 2024 | 7 Oct 2024 | 7 Oct 2025 |
| 782 | windshieldreplacementjacksonville.com | Launchpad, Inc. | 17 Feb 2021 | 1 Apr 2025 | 17 Feb 2025 |
| 783 | windshieldreplacementkansascity.com | GoDaddy.com, LLC | 2 Dec 2022 | 13 Jan 2024 | 2 Dec 2023 |
| 784 | windshieldreplacementmemphis.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 785 | windshieldreplacementmiami.com | GoDaddy.com, LLC | 4 Aug 2025 | 5 Aug 2025 | 4 Aug 2026 |
| 786 | windshieldreplacementnewyork.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2025 | 20 Aug 2027 |
| 787 | windshieldreplacementomaha.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 788 | windshieldreplacementpittsburgh.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 789 | windshieldreplacementsacramento.com | NameCheap, Inc. | 11 Feb 2021 | 12 Jan 2025 | 11 Feb 2026 |
| 790 | windshieldreplacementsandiego.com | One.com A/S | 15 Feb 2025 | 18 Feb 2025 | 15 Feb 2026 |
| 791 | windshieldreplacementseattle.com | NameCheap, Inc. | 22 Feb 2024 | 6 May 2025 | 22 Feb 2025 |
| 792 | windshieldreplacementsouthcarolina.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2025 | 20 Aug 2027 |
| 793 | windshieldreplacementtampa.com | eNom, Inc. | 14 Nov 2015 | 29 Feb 2024 | 14 Nov 2025 |
| 794 | windshieldreplacementtulsa.com | GoDaddy.com, LLC | 12 Nov 2018 | 12 Nov 2024 | 12 Nov 2025 |
| 795 | windshieldreplacementvirginiabeach.com | 1API GmbH | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 796 | windsofloveministries.com | Launchpad, Inc. | 20 Aug 2014 | 1 Aug 2016 | 20 Aug 2017 |
| 797 | windsofloveministries.org | Launchpad, Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 798 | windsofloveministries.us | Launchpad, Inc. | 20 Aug 2014 | 20 Aug 2014 | 19 Aug 2015 |
| 799 | windsorgrangeantiques.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2016 |
| 800 | windsorharborapartments.com | Wild West Domains, LLC | 21 Aug 2014 | 21 Aug 2016 | 21 Aug 2017 |
| 801 | windsorparks2030.com | Tucows Domains Inc. | 21 Aug 2014 | 25 Aug 2018 | 21 Aug 2018 |
| 802 | windsurf-masters.info | 1&1 Internet AG | 20 Aug 2014 | 20 Aug 2025 | 20 Aug 2026 |
| 803 | windsurf-masters.net | 1&1 Internet AG | 20 Aug 2014 | 15 Dec 2017 | 20 Aug 2026 |
| 804 | windsurf-masters.org | 1&1 Internet AG | 20 Aug 2014 | 20 Aug 2025 | 20 Aug 2026 |
| 805 | windshaka.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 806 | windshieldrepairkits.org | GoDaddy.com, LLC | 12 Jan 2015 | 13 Jan 2017 | 12 Jan 2018 |
| 807 | windshieldreplacementshop.com | GoDaddy.com, LLC | 18 Jan 2018 | 19 Jan 2025 | 18 Jan 2026 |
| 808 | windshieldreplacementshopshartfordct.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 809 | windshieldreplacementwesthartford.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 810 | windsorandco.com | eNom, Inc. | 12 Jan 2015 | 13 Dec 2024 | 12 Jan 2026 |
| 811 | windsorarlington.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 812 | windsoriron.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 813 | windsorpowdercoating.com | GoDaddy.com, LLC | 12 Jan 2015 | 13 Jan 2025 | 12 Jan 2026 |
| 814 | windsorviewrentals.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2017 |
| 815 | windstarmoving.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2017 |
| 816 | windsolar3d.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 817 | windsongwoodcrafts.com | register.com, Inc. | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2017 |
| 818 | windsor10.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 819 | windsormoney.com | GoDaddy.com, LLC | 8 Jul 2021 | 8 Jul 2021 | 8 Jul 2022 |
| 820 | windsupsailor.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 821 | windsupsurfer.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 822 | windsongrenewable.com | Namesilo, LLC | 6 Dec 2018 | 6 Dec 2018 | 6 Dec 2019 |
| 823 | windshieldreplacementchandler.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2025 | 22 Aug 2026 |
| 824 | windshieldreplacementflagstaff.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2025 | 22 Aug 2026 |
| 825 | windshieldreplacementflagstaffaz.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2019 | 22 Aug 2020 |
| 826 | windshieldreplacementfountainhillsaz.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2019 | 22 Aug 2020 |
| 827 | windshieldreplacementgilbert.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2025 | 22 Aug 2026 |
| 828 | windshieldreplacementqueencreek.com | NameCheap, Inc. | 14 Jun 2025 | 14 Jun 2025 | 14 Jun 2026 |
| 829 | windshieldreplacementqueencreekaz.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2019 | 22 Aug 2020 |
| 830 | windshieldreplacementsantanvalleyaz.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2019 | 22 Aug 2020 |
| 831 | windshieldreplacementscottsdaleaz.com | GoDaddy.com, LLC | 22 Aug 2014 | 17 Aug 2016 | 22 Aug 2017 |
| 832 | windshieldreplacementtempeaz.com | GoDaddy.com, LLC | 22 Aug 2014 | 17 Aug 2016 | 22 Aug 2017 |
| 833 | windshieldsnowiceremoval.com | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 834 | windsongsbestlisting.info | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 835 | windsordefence.com | 1&1 Internet AG | 25 Sep 2024 | 25 Sep 2024 | 25 Sep 2025 |
| 836 | windsorstubs.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Apr 2015 | 21 Aug 2017 |
| 837 | windsoryouthcheer.com | GoDaddy.com, LLC | 21 Aug 2014 | 16 Aug 2016 | 21 Aug 2017 |
| 838 | windsorkelly.net | Netdorm, Inc. dba DnsExit.com | 6 Nov 2014 | 7 Nov 2024 | 6 Nov 2025 |
| 839 | windsor-crew.com | Tucows Domains Inc. | 25 Feb 2007 | 1 Mar 2015 | 25 Feb 2016 |
| 840 | windsorlandscaping.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 841 | windsormathstutor.com | Wild West Domains, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 842 | windsurf-guadeloupe.org | Key-Systems GmbH | 28 Feb 2015 | 28 Feb 2017 | 28 Feb 2018 |
| 843 | windsurfcabarete.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Oct 2023 | 22 Dec 2024 | 20 Oct 2024 |
| 844 | windsolarlands.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 845 | windsor-profits.com | eNom, Inc. | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 846 | windsorhillsrealty.com | GMO Internet Inc. | 24 Jul 2023 | 4 Oct 2024 | 24 Jul 2024 |
| 847 | windsorhomeinspection.net | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 848 | windsorhomeinspections.net | GoDaddy.com, LLC | 22 Aug 2014 | 23 Aug 2025 | 22 Aug 2027 |
| 849 | windsorhomeinspections.org | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 850 | windsorroyal.com | GoDaddy.com, LLC | 22 Aug 2014 | 23 Aug 2025 | 22 Aug 2026 |
| 851 | windsorstreetauto.com | GoDaddy.com, LLC | 22 Aug 2014 | 23 Aug 2025 | 22 Aug 2026 |
| 852 | windshielddoctor-hub.com | GoDaddy.com, LLC | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 853 | windsoraa.com | eNom, Inc. | 21 Jul 2016 | 9 Feb 2017 | 21 Jul 2018 |
| 854 | windsortalent.com | GoDaddy.com, LLC | 13 Jan 2020 | 13 Jan 2020 | 13 Jan 2021 |
| 855 | windsorzgz.com | Arsys Internet, S.L. dba NICLINE.COM | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 856 | windsorhempstore.com | eNom, Inc. | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 857 | windshieldrepairsanantonio.com | Porkbun, LLC | 3 May 2024 | 15 May 2025 | 3 May 2026 |
| 858 | windsurfingforlife.org | Hosting Concepts B.V. dba Openprovider | 7 Nov 2014 | 15 Jul 2025 | 7 Nov 2025 |
| 859 | windsor-hotel.net | Tucows Domains Inc. | 7 Nov 2014 | 18 Jan 2024 | 7 Nov 2023 |
| 860 | windsor-hotel.mobi | Tucows Domains Inc. | 7 Nov 2014 | 11 Nov 2023 | 7 Nov 2024 |
| 861 | windschott.info | RegistryGate GmbH | 24 Aug 2014 | 14 Oct 2024 | 24 Aug 2025 |
| 862 | windshieldrepairct.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 863 | windshieldrepairma.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 864 | windshieldrepairme.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 865 | windshieldrepairnh.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 866 | windshieldrepairri.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 867 | windsoraassociat.com | DomainPeople, Inc. | 24 Aug 2014 | 26 Jul 2016 | 24 Aug 2017 |
| 868 | windsoratwestsiderent.com | GoDaddy.com, LLC | 24 Aug 2014 | 20 Aug 2015 | 24 Aug 2017 |
| 869 | windsorhillsdisneycondo.biz | 1&1 Internet AG | 24 Aug 2014 | - | 23 Aug 2015 |
| 870 | windsorhillsdisneycondo.com | 1&1 Internet AG | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 871 | windsorhillsdisneycondo.info | 1&1 Internet AG | 24 Aug 2014 | - | 24 Aug 2015 |
| 872 | windsorhillsdisneycondo.net | 1&1 Internet AG | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 873 | windsorhillsdisneycondo.org | 1&1 Internet AG | 24 Aug 2014 | - | 24 Aug 2015 |
| 874 | windsorhillsdisneycondo.us | 1&1 Internet AG | 24 Aug 2014 | - | 23 Aug 2015 |
| 875 | windsorjobs.com | TurnCommerce, Inc. DBA NameBright.com | 24 Aug 2014 | 18 Aug 2020 | 24 Aug 2025 |
| 876 | windshielddoctors.com | TurnCommerce, Inc. DBA NameBright.com | 12 Aug 2014 | 6 Aug 2020 | 12 Aug 2025 |
| 877 | windshieldrepairtucson.com | NameCheap, Inc. | 26 Apr 2024 | 27 Mar 2025 | 26 Apr 2026 |
| 878 | windsoras.com | Hosting Concepts B.V. dba Openprovider | 12 Feb 2025 | 25 Jul 2025 | 12 Feb 2028 |
| 879 | windsorinjurylaw.com | Tucows Domains Inc. | 12 Aug 2014 | 28 Jul 2025 | 12 Aug 2026 |
| 880 | windsormovingandstorage.com | Wild West Domains, LLC | 12 Aug 2014 | 13 Aug 2025 | 12 Aug 2026 |
| 881 | windsweptwanderers.com | Google, Inc. | 29 Nov 2017 | 14 Nov 2024 | 29 Nov 2025 |
| 882 | windshieldguide.com | NameCheap, Inc. | 13 Aug 2014 | 20 Jul 2025 | 13 Aug 2026 |
| 883 | windsongltd.com | Tucows Domains Inc. | 11 Mar 2021 | 22 May 2023 | 11 Mar 2023 |
| 884 | windsordiscount.com | DROPCATCH.COM 794 LLC | 31 Oct 2015 | 1 Nov 2016 | 31 Oct 2017 |
| 885 | windsorgoldbuyers.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 886 | windsorpeace.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Mar 2017 | 30 May 2017 | 31 Mar 2018 |
| 887 | windsurfbarcelona.com | - | 1 Nov 2024 | 18 Apr 2025 | 1 Nov 2026 |
| 888 | windshieldrepairgr.com | Tucows Domains Inc. | 23 Aug 2010 | 26 Aug 2014 | 23 Aug 2015 |
| 889 | windshiftequineimagery.com | eNom, Inc. | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 890 | windsoftrade.org | Tucows Domains Inc. | 25 Aug 2014 | 29 Aug 2022 | 25 Aug 2023 |
| 891 | windsongchildcareandpreschool.com | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 892 | windsor-group-archive.com | easyDNS Technologies, Inc. | 26 Aug 2014 | 24 Jun 2025 | 26 Aug 2026 |
| 893 | windsorextra.us | Network Solutions, LLC | 22 Aug 2011 | 25 Aug 2014 | 21 Aug 2015 |
| 894 | windsorhcn.us | Network Solutions, LLC | 22 Aug 2011 | 25 Aug 2014 | 21 Aug 2015 |
| 895 | windsorhealth.us | Network Solutions, LLC | 5 Aug 2011 | 25 Aug 2014 | 4 Aug 2015 |
| 896 | windsorhg.us | Network Solutions, LLC | 5 Aug 2011 | 25 Aug 2014 | 4 Aug 2015 |
| 897 | windsormedicare.us | Network Solutions, LLC | 22 Aug 2011 | 25 Aug 2014 | 21 Aug 2015 |
| 898 | windsormedicareextra.us | Network Solutions, LLC | 22 Aug 2011 | 25 Aug 2014 | 21 Aug 2015 |
| 899 | windsormilltowing.info | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 900 | windsorparkway.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 901 | windsorplan.us | Network Solutions, LLC | 22 Aug 2011 | 25 Aug 2014 | 21 Aug 2015 |
| 902 | windsorplans.us | Network Solutions, LLC | 22 Aug 2011 | 25 Aug 2014 | 21 Aug 2015 |
| 903 | windsorspeechtherapy.com | Squarespace Domains LLC | 8 Jun 2025 | 8 Jun 2025 | 8 Jun 2026 |
| 904 | windsorsquare.net | Google, Inc. | 20 Jul 2024 | 5 Jul 2025 | 20 Jul 2026 |
| 905 | windsorsterlingplans.us | Network Solutions, LLC | 16 Aug 2011 | 25 Aug 2014 | 15 Aug 2015 |
| 906 | windstorm-claim.com | GoDaddy.com, LLC | 26 Aug 2014 | 18 Jun 2025 | 17 Jun 2027 |
| 907 | windstorminsuranceclaim.com | GoDaddy.com, LLC | 27 Aug 2014 | 18 Jun 2025 | 17 Jun 2027 |
| 908 | windstreamventures.com | Porkbun, LLC | 30 Jun 2024 | 12 Jul 2025 | 30 Jun 2026 |
| 909 | windsweptmusic.com | GoDaddy.com, LLC | 26 Aug 2014 | 27 Aug 2024 | 26 Aug 2025 |
| 910 | windsurfsticker.com | Realtime Register B.V. | 11 Nov 2014 | 8 Nov 2024 | 11 Nov 2025 |
| 911 | windsurfing911.com | GoDaddy.com, LLC | 10 Nov 2014 | 11 Nov 2016 | 10 Nov 2017 |
| 912 | windsorfantasy.com | GoDaddy.com, LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2016 |
| 913 | winds7.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 914 | windshieldrepairgenius.com | GoDaddy.com, LLC | 14 Aug 2014 | 15 Aug 2024 | 14 Aug 2029 |
| 915 | windsor-solicitors.com | register.com, Inc. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2019 |
| 916 | windsorhomevaluation.com | Tucows Domains Inc. | 3 Dec 2016 | 13 Feb 2025 | 3 Dec 2024 |
| 917 | windsorroadbromsgrove.com | register.com, Inc. | 23 May 2017 | 23 May 2017 | 23 May 2018 |
| 918 | windstoreonlineperte.biz | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Aug 2014 | 14 Aug 2014 | 13 Aug 2015 |
| 919 | windstoreonlineperte.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 920 | windsurfcity.us | Network Solutions, LLC | 14 Aug 2014 | 14 Aug 2014 | 13 Aug 2015 |
| 921 | windshieldexpo.com | Wild West Domains, LLC | 30 Sep 2019 | 30 Sep 2019 | 30 Sep 2020 |
| 922 | windshieldrepairbryant.com | Name.com, Inc. | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 923 | windsongoriginaldesigns.com | GoDaddy.com, LLC | 27 Aug 2014 | 8 Oct 2024 | 27 Aug 2024 |
| 924 | windsor-commissions-from-home.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 925 | windsor-money-from-home.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 926 | windsorseverancestorage.com | FastDomain Inc. | 28 Aug 2014 | 12 Aug 2024 | 28 Aug 2025 |
| 927 | windsortrade.com | TurnCommerce, Inc. DBA NameBright.com | 9 Oct 2013 | 3 Oct 2020 | 9 Oct 2025 |
| 928 | windshieldreplacementks.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 929 | windslyce.com | GoDaddy.com, LLC | 11 Aug 1999 | 13 Aug 2025 | 11 Aug 2026 |
| 930 | windsonghomes.com | Epik Inc. | 15 Aug 2014 | 16 Aug 2025 | 15 Aug 2025 |
| 931 | windsordivorcelawyer.com | GoDaddy.com, LLC | 20 Oct 2017 | 18 Dec 2024 | 20 Oct 2025 |
| 932 | windsorremax.com | GoDaddy.com, LLC | 19 Feb 2021 | 20 Feb 2025 | 19 Feb 2027 |
| 933 | windsorsatelliteservices.com | Wild West Domains, LLC | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 934 | windstarnaplesflorida.com | Wild West Domains, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 935 | windstarspirit.org | Tucows Domains Inc. | 11 Aug 2013 | 15 Aug 2014 | 11 Aug 2015 |
| 936 | windster.net | 1&1 Internet AG | 23 Jan 2021 | 23 Jan 2021 | 23 Jan 2026 |
| 937 | windsurf-international.com | Dynadot, LLC | 21 Sep 2020 | 29 Aug 2024 | 21 Sep 2025 |
| 938 | windsofchangesalon.com | Tucows Domains Inc. | 12 Aug 2011 | 16 Aug 2014 | 12 Aug 2015 |
| 939 | windsoncorealestate.com | Tucows Domains Inc. | 13 Aug 2013 | 16 Aug 2014 | 13 Aug 2015 |
| 940 | windsorcreek28.com | register.com, Inc. | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 941 | windsorremarketing.com | TurnCommerce, Inc. DBA NameBright.com | 2 Nov 2018 | 2 Nov 2018 | 2 Nov 2019 |
| 942 | windsynth.org | Dynadot, LLC | 5 Apr 2020 | 26 Mar 2025 | 5 Apr 2026 |
| 943 | windsofchange.pro | Regional Network Information Center, JSC dba RU-CE… | 26 Oct 2013 | 24 Oct 2016 | 26 Oct 2017 |
| 944 | windsorbay.net | GoDaddy.com, LLC | 10 Nov 2014 | 11 Nov 2016 | 10 Nov 2018 |
| 945 | windsurfsg.com | eNom, Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 946 | windstormroofing.com | GoDaddy.com, LLC | 26 Jul 2022 | 6 Oct 2024 | 26 Jul 2024 |
| 947 | windsorwheelsct.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2019 |
| 948 | windsoressexeats.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 949 | windsorbizexperts.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 950 | windsoratwestsidevacationhome.com | 1&1 Internet AG | 11 Nov 2014 | 14 Apr 2018 | 11 Nov 2019 |
| 951 | windsor-wood.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2016 |
| 952 | windsor-antiques.com | Tucows Domains Inc. | 8 Nov 2011 | 12 Nov 2014 | 8 Nov 2015 |
| 953 | windsonglistening.com | Wild West Domains, LLC | 11 Nov 2014 | 12 Oct 2016 | 11 Nov 2017 |
| 954 | windshieldsinc.biz | GoDaddy.com, LLC | 11 Nov 2014 | 14 Aug 2016 | 10 Nov 2019 |
| 955 | windspinner.org | GoDaddy.com, LLC | 6 Oct 2023 | 18 Oct 2024 | 6 Oct 2025 |
| 956 | windsorwatch.org | Domain.com, LLC | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 957 | windsofchangetx.org | GoDaddy.com, LLC | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2016 |
| 958 | windsheardevice.org | GoDaddy.com, LLC | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 959 | windsheardevice.info | GoDaddy.com, LLC | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 960 | windsorontario.org | Omnis Network, LLC | 28 Oct 2007 | 18 Nov 2015 | 28 Oct 2016 |
| 961 | windsorweddingclub.com | HiChina Zhicheng Technology Limited | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 962 | windsormovie.com | Porkbun, LLC | 22 Apr 2024 | 23 Apr 2025 | 22 Apr 2026 |
| 963 | windsorgabriel.com | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 964 | windsorfriend.com | Melbourne IT, Ltd | 14 Nov 2014 | 26 Oct 2015 | 14 Nov 2017 |
| 965 | windsor1688.com | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 966 | windshieldrepairorangecounty.com | GoDaddy.com, LLC | 18 May 2015 | 13 Dec 2024 | 1 Jan 2027 |
| 967 | windsor-fast-cash.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 968 | windsorkennel.com | GoDaddy.com, LLC | 2 Oct 2020 | 6 Oct 2024 | 2 Oct 2025 |
| 969 | windspearwishes.com | Tucows Domains Inc. | 25 Aug 2012 | 28 Aug 2014 | 25 Aug 2015 |
| 970 | windspearwishes.net | Tucows Domains Inc. | 25 Aug 2012 | 29 Aug 2014 | 25 Aug 2015 |
| 971 | windsurge.info | GoDaddy.com, LLC | 27 Aug 2014 | 28 Aug 2014 | 27 Aug 2015 |
| 972 | windsor-terrace.com | Tucows Domains Inc. | 12 Sep 2014 | 16 Sep 2022 | 12 Sep 2022 |
| 973 | windsormoonshine.com | Name.com, Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 974 | windsormusicarchiveslicensing.com | eNom, Inc. | 12 Sep 2014 | 29 Aug 2017 | 12 Sep 2018 |
| 975 | windshieldreplacementshops.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 976 | windshieldreplacementsuffolkva.com | 1API GmbH | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 977 | windsngo.org | GoDaddy.com, LLC | 31 May 2024 | 12 Jul 2025 | 31 May 2025 |
| 978 | windsorparklane.com | Tucows Domains Inc. | 29 Aug 2014 | 2 Sep 2015 | 29 Aug 2016 |
| 979 | windsorwestholiday.com | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2016 | 30 Aug 2017 |
| 980 | windsorwestkissimmee.com | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2016 | 30 Aug 2017 |
| 981 | windsorwestneardisney.com | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2016 | 30 Aug 2017 |
| 982 | windsorwestrentals.com | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2016 | 30 Aug 2017 |
| 983 | windsorwestvacationrentals.com | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2024 | 30 Aug 2025 |
| 984 | windspearwishes.info | Tucows Domains Inc. | 25 Aug 2012 | 29 Aug 2014 | 25 Aug 2015 |
| 985 | windspearwishes.org | Tucows Domains Inc. | 25 Aug 2012 | 29 Aug 2014 | 25 Aug 2015 |
| 986 | windshield-replacement.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Sep 2014 | 12 Sep 2014 | 11 Sep 2015 |
| 987 | windshieldreplacementlasvegas.com | GoDaddy.com, LLC | 16 Nov 2022 | 17 Nov 2024 | 16 Nov 2025 |
| 988 | windsongal.com | NameCheap, Inc. | 12 Sep 2014 | 13 Aug 2024 | 12 Sep 2025 |
| 989 | windsongassistedliving.com | NameCheap, Inc. | 12 Sep 2014 | 13 Aug 2024 | 12 Sep 2025 |
| 990 | windsongmc.com | NameCheap, Inc. | 12 Sep 2014 | 13 Aug 2024 | 12 Sep 2025 |
| 991 | windsorapartmentsforrent.com | Tucows Domains Inc. | 9 Sep 2010 | 13 Sep 2015 | 9 Sep 2016 |
| 992 | windspiel-gin.com | InterNetworX Ltd. & Co. KG | 12 Sep 2014 | 10 Jun 2025 | 12 Sep 2026 |
| 993 | windsordrive.info | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 994 | windshieldrepairlasvegas.org | GoDaddy.com, LLC | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 995 | windstonecondo.com | Tucows Domains Inc. | 1 Aug 2017 | 5 Aug 2019 | 1 Aug 2019 |
| 996 | windsorwreaths.com | Automattic Inc. | 3 Dec 2022 | 8 Dec 2023 | 3 Dec 2024 |
| 997 | windsorservicesalliance.com | Tucows Domains Inc. | 11 Nov 2013 | 15 Nov 2014 | 11 Nov 2015 |
| 998 | windsongessentials.com | register.com, Inc. | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 999 | windsculpturesgallery.com | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 1000 | windsandwaterdev.com | Tucows Domains Inc. | 30 Aug 2014 | 10 Nov 2023 | 30 Aug 2023 |
Displaying 1,000 out of 37,449 domains starting with the keyword "WINDS". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=winds
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |