With support for 
Keyword: WELLNESSMA
Reverse Whois » KEYWORD [wellnessma ] { 1,757 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | wellnessma.com | TurnCommerce, Inc. DBA NameBright.com | 7 Jan 2016 | 17 Feb 2026 | 7 Jan 2026 |
| 2 | wellnessma.link | NameCheap, Inc. | 2 Jul 2024 | 7 Jul 2024 | 2 Jul 2026 |
| 3 | wellnessma.dev | NameCheap, Inc. | 2 Jul 2024 | - | - |
| 4 | wellnessmarketing-bg.com | GoDaddy.com, LLC | 19 Aug 2019 | 19 Aug 2019 | 19 Aug 2020 |
| 5 | wellnessmaker.net | Domain.com, LLC | 7 Jul 2023 | 20 Sep 2024 | 7 Jul 2024 |
| 6 | wellnessmama.com | Tucows Domains Inc. | 14 Oct 2009 | 7 Nov 2025 | 8 Nov 2026 |
| 7 | wellnessmarijuana.com | NameBrew LLC | 17 Jan 2026 | 18 Jan 2026 | 17 Jan 2027 |
| 8 | wellnessmarketplace.com | GoDaddy.com, LLC | 9 Dec 1999 | 10 Dec 2025 | 9 Dec 2026 |
| 9 | wellnessmassagetherapy4me.com | GoDaddy.com, LLC | 9 Aug 2011 | 15 Jun 2015 | 9 Aug 2016 |
| 10 | wellnessmart.com | GoDaddy.com, LLC | 26 Sep 2004 | 10 Jul 2025 | 9 Jul 2026 |
| 11 | wellnessmats.com | GoDaddy.com, LLC | 9 Jun 2006 | 10 Jun 2025 | 9 Jun 2026 |
| 12 | wellnessmarketer.com | Network Solutions, LLC | 18 Jun 2002 | 19 Apr 2025 | 18 Jun 2026 |
| 13 | wellnessmary.net | 1&1 Internet AG | 31 Oct 2014 | 15 Aug 2024 | 31 Oct 2026 |
| 14 | wellnessmassagetherapycenter.com | GoDaddy.com, LLC | 10 Jun 2010 | 11 Jun 2015 | 10 Jun 2016 |
| 15 | wellnessmagnet.com | TurnCommerce, Inc. DBA NameBright.com | 17 Dec 2021 | 26 Feb 2025 | 17 Dec 2024 |
| 16 | wellnessmay.com | OVH sas | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 17 | wellnessmassagetherapies.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2015 | 7 Feb 2026 | 24 Jun 2028 |
| 18 | wellnessmarketingnow.com | Network Solutions, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 19 | wellnessmarkt.biz | Key-Systems GmbH | 12 Aug 2014 | 16 Sep 2024 | 11 Aug 2024 |
| 20 | wellnessmadrid.com | 1&1 Internet AG | 10 Dec 2015 | 11 Dec 2018 | 10 Dec 2026 |
| 21 | wellnessmarkshop.com | Web Commerce Communications Limited dba WebNic.cc | 8 Nov 2014 | 11 Nov 2025 | 8 Nov 2027 |
| 22 | wellnessmakers.com | GoDaddy.com, LLC | 13 Aug 2014 | 7 Dec 2025 | 13 Aug 2027 |
| 23 | wellnessmakers.net | GoDaddy.com, LLC | 6 Jul 2017 | 6 Jul 2017 | 6 Jul 2018 |
| 24 | wellnessmamablog.com | Tucows Domains Inc. | 12 Aug 2014 | 11 Aug 2025 | 12 Aug 2026 |
| 25 | wellnessmaker.info | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2016 |
| 26 | wellnessmaker.org | Domain.com, LLC | 7 Jul 2023 | 20 Aug 2024 | 7 Jul 2024 |
| 27 | wellnessmakers.info | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2016 |
| 28 | wellnessmakers.org | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2016 |
| 29 | wellnessmassageandesthetics.com | Network Solutions, LLC | 26 Aug 2014 | 24 Aug 2016 | 26 Aug 2018 |
| 30 | wellnessmassagetherapy.com | TurnCommerce, Inc. DBA NameBright.com | 5 Apr 2014 | 30 Mar 2021 | 5 Apr 2026 |
| 31 | wellnessmagazine.info | Domain.com, LLC | 15 Sep 2014 | - | 15 Sep 2015 |
| 32 | wellnessmamacookbook.com | Tucows Domains Inc. | 3 Sep 2014 | 2 Sep 2025 | 3 Sep 2026 |
| 33 | wellnessmarijuanamedicine.com | GoDaddy.com, LLC | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2016 |
| 34 | wellnessmarijuanaproducts.com | GoDaddy.com, LLC | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2016 |
| 35 | wellnessmasala.com | Name.com, Inc. | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 36 | wellnessmaryland.com | DomainAdministration.com, LLC | 3 Oct 2017 | 4 Oct 2025 | 3 Oct 2026 |
| 37 | wellnessmarketingdusseldorf.com | Tucows Domains Inc. | 12 Nov 2013 | 17 Nov 2014 | 12 Nov 2015 |
| 38 | wellnessmarhq.com | Wild West Domains, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 39 | wellnessmarketingservice.com | Tucows Domains Inc. | 4 Sep 2013 | 7 Sep 2014 | 4 Sep 2015 |
| 40 | wellnessmamabook.com | Tucows Domains Inc. | 9 Sep 2014 | 8 Sep 2025 | 9 Sep 2026 |
| 41 | wellnessmamapodcast.com | Tucows Domains Inc. | 9 Sep 2014 | 8 Sep 2025 | 9 Sep 2026 |
| 42 | wellnessmassagefl.com | GoDaddy.com, LLC | 19 Nov 2014 | 20 Nov 2016 | 19 Nov 2018 |
| 43 | wellnessmamaapp.com | Tucows Domains Inc. | 1 Oct 2014 | 30 Sep 2025 | 1 Oct 2026 |
| 44 | wellnessmasseur.info | Mesh Digital Limited | 31 Jan 2017 | 6 Jan 2026 | 31 Jan 2027 |
| 45 | wellnessmakersblog.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2016 |
| 46 | wellnessmaximizer.com | Metaregistrar BV Applications | 18 Sep 2023 | 17 Sep 2025 | 18 Sep 2025 |
| 47 | wellnessmassageinwilmington.com | Tucows Domains Inc. | 24 Sep 2008 | 25 Aug 2025 | 24 Sep 2027 |
| 48 | wellnessmaam.com | Hebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.… | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 49 | wellnessmassagebed.com | Crazy Domains FZ-LLC | 24 Nov 2014 | 18 Feb 2015 | 24 Nov 2015 |
| 50 | wellnessmatagordacounty.com | FastDomain Inc. | 17 Oct 2014 | 17 Oct 2017 | 17 Oct 2018 |
| 51 | wellnessmassageloudoun.com | Domain.com, LLC | 18 Oct 2014 | 1 Dec 2017 | 18 Oct 2017 |
| 52 | wellnessmarketingmanifesto.com | eNom, Inc. | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 53 | wellnessmatagordacounty.org | FastDomain Inc. | 17 Oct 2014 | 17 Oct 2017 | 17 Oct 2018 |
| 54 | wellnessmarketingmethod.com | eNom, Inc. | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 55 | wellnessmastersswimclub.org | Domain.com, LLC | 25 Oct 2010 | 10 Oct 2016 | 25 Oct 2017 |
| 56 | wellnessmadeinfrance.com | 1&1 Internet AG | 18 Apr 2020 | 29 Jul 2021 | 18 Apr 2022 |
| 57 | wellnessmassageandskincare.com | Tucows Domains Inc. | 2 Dec 2014 | 6 Dec 2015 | 2 Dec 2016 |
| 58 | wellnessmavericks.com | DropCatch.com 1376 LLC | 15 Apr 2024 | 16 Apr 2024 | 15 Apr 2026 |
| 59 | wellnessmavens.com | GoDaddy.com, LLC | 9 Jan 2021 | 10 Jan 2026 | 9 Jan 2027 |
| 60 | wellnessmarketingtribe.com | eNom, Inc. | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 61 | wellnessmarketinginnercircle.com | eNom, Inc. | 9 Mar 2016 | 9 Mar 2016 | 9 Mar 2017 |
| 62 | wellnessmarketingmastermind.com | eNom, Inc. | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 63 | wellnessmatrix.us | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2016 | 14 Dec 2017 |
| 64 | wellnessmantra.com | GoDaddy.com, LLC | 27 Dec 2007 | 24 Dec 2025 | 27 Dec 2026 |
| 65 | wellnessmatterscenter.com | FastDomain Inc. | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 66 | wellnessmanagementcommunity.com | Domain.com, LLC | 31 Dec 2004 | 3 Jan 2017 | 31 Dec 2017 |
| 67 | wellnessmanagementcommunity.biz | Domain.com, LLC | 31 Dec 2004 | 2 Jan 2024 | 30 Dec 2023 |
| 68 | wellnessmanagementcommunity.net | Domain.com, LLC | 31 Dec 2004 | 16 Dec 2019 | 31 Dec 2020 |
| 69 | wellnessmanagementcommunity.info | Domain.com, LLC | 31 Dec 2004 | 3 Jan 2017 | 31 Dec 2017 |
| 70 | wellnessmanagement.info | Domain.com, LLC | 23 Dec 2003 | 8 Dec 2016 | 23 Dec 2017 |
| 71 | wellnessmanagementcommunity.org | Domain.com, LLC | 31 Dec 2004 | 3 Jan 2017 | 31 Dec 2017 |
| 72 | wellnessmanagement.org | GoDaddy.com, LLC | 23 Dec 2003 | 6 Feb 2026 | 23 Dec 2026 |
| 73 | wellnessmassagestudio.com | Namesilo, LLC | 6 May 2025 | 16 May 2025 | 6 May 2026 |
| 74 | wellnessmartialarts.xyz | Network Solutions, LLC | 18 Jul 2014 | 18 Jul 2014 | 18 Jul 2015 |
| 75 | wellnessmassagen.berlin | Cronon AG | 28 May 2015 | - | 28 May 2026 |
| 76 | wellnessmatters4you.xyz | Network Solutions, LLC | 3 Jun 2014 | 5 Jun 2014 | 3 Jun 2015 |
| 77 | wellnessmassagen.hamburg | 1&1 Internet AG | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2018 |
| 78 | wellnessmassagen.koeln | Key-Systems, LLC | 5 Sep 2014 | - | 5 Sep 2015 |
| 79 | wellnessmassage.koeln | InterNetworX Ltd. & Co. KG | 6 Mar 2017 | 6 Mar 2017 | 6 Mar 2018 |
| 80 | wellnessmassagen.jetzt | PSI-USA, Inc. dba Domain Robot | 2 Jan 2015 | 2 Jan 2015 | 1 Jan 2016 |
| 81 | wellnessmama.recipes | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 82 | wellnessmama.press | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | 28 Jan 2027 |
| 83 | wellnessmama.ninja | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 84 | wellnessmama.menu | Tucows Domains Inc. | 28 Jan 2015 | 1 Feb 2026 | 28 Jan 2027 |
| 85 | wellnessmama.media | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 86 | wellnessmama.life | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 87 | wellnessmama.kitchen | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 88 | wellnessmama.help | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | 28 Jan 2027 |
| 89 | wellnessmama.guru | Tucows Domains Inc. | 28 Jan 2015 | 1 Feb 2026 | 28 Jan 2027 |
| 90 | wellnessmama.expert | Tucows Domains Inc. | 28 Jan 2015 | 16 Feb 2026 | - |
| 91 | wellnessmama.diet | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | 28 Jan 2027 |
| 92 | wellnessmama.cooking | Tucows Domains Inc. | 28 Jan 2015 | 1 Feb 2026 | 28 Jan 2027 |
| 93 | wellnessmama.club | Tucows Domains Inc. | 28 Jan 2015 | 31 Jan 2026 | 27 Jan 2027 |
| 94 | wellnessmama.cleaning | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 95 | wellnessmanagement.guru | GoDaddy.com, LLC | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 96 | wellnessmama.tools | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 97 | wellnessmama.tips | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 98 | wellnessmama.support | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 99 | wellnessmassage.nrw | Mesh Digital Limited | 25 Mar 2015 | 23 Feb 2017 | 25 Mar 2018 |
| 100 | wellnessmag.rocks | united-domains AG | 3 Apr 2015 | 18 May 2017 | 3 Apr 2018 |
| 101 | wellnessmagz.com | Tucows Domains Inc. | 17 Jan 2017 | 17 Jan 2017 | 17 Jan 2018 |
| 102 | wellnessmamacare.com | Tucows Domains Inc. | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 103 | wellnessmantras.com | Annulet LLC | 27 Mar 2019 | 10 May 2025 | 27 Mar 2025 |
| 104 | wellnessmango.com | DropCatch.com 1249 LLC | 28 Mar 2018 | 28 Mar 2018 | 28 Mar 2019 |
| 105 | wellnessmango.org | GoDaddy.com, LLC | 8 Jan 2015 | 9 Jan 2017 | 8 Jan 2018 |
| 106 | wellnessmango.net | GoDaddy.com, LLC | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 107 | wellnessmango.info | GoDaddy.com, LLC | 8 Jan 2015 | 9 Jan 2017 | 8 Jan 2018 |
| 108 | wellnessmamaof4.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2017 |
| 109 | wellnessmats.today | Register.ca Inc. | 19 May 2015 | 19 May 2015 | 19 May 2017 |
| 110 | wellnessmagazin.fitness | PSI-USA, Inc. dba Domain Robot | 21 May 2015 | 5 Jul 2020 | 21 May 2021 |
| 111 | wellnessmassage.jetzt | Cronon AG | 17 Jul 2015 | - | 16 Jul 2016 |
| 112 | wellnessmassage.bayern | Cronon AG | 17 Jul 2015 | - | 17 Jul 2016 |
| 113 | wellnessmassage-in.bayern | Cronon AG | 17 Jul 2015 | - | 17 Jul 2016 |
| 114 | wellnessmassageandspa.com | Wix.com Ltd. | 26 Aug 2025 | 26 Aug 2025 | 26 Aug 2026 |
| 115 | wellnessmangements.com | GoDaddy.com, LLC | 29 Oct 2019 | 29 Oct 2019 | 29 Oct 2020 |
| 116 | wellnessmakelaar.com | Tucows Domains Inc. | 20 Jan 2010 | 24 Jan 2015 | 20 Jan 2016 |
| 117 | wellnessmania.info | Key-Systems GmbH | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 118 | wellnessmania.biz | Key-Systems GmbH | 29 Jul 2015 | 29 Jul 2015 | 28 Jul 2016 |
| 119 | wellnessmassageparis.com | 1&1 Internet AG | 27 Jan 2015 | 6 Feb 2026 | 27 Jan 2027 |
| 120 | wellnessmama.biz | Tucows Domains Inc. | 28 Jan 2015 | 31 Jan 2026 | 27 Jan 2027 |
| 121 | wellnessmania247.com | eNom, Inc. | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 122 | wellnessmama.us | Tucows Domains Inc. | 28 Jan 2015 | 26 Jan 2017 | 27 Jan 2018 |
| 123 | wellnessmama.pro | Tucows Domains Inc. | 28 Jan 2015 | 27 Jan 2026 | - |
| 124 | wellnessmatter.com | GoDaddy.com, LLC | 7 Nov 2018 | 4 Sep 2025 | 7 Nov 2026 |
| 125 | wellnessmaterial.com | NameCheap, Inc. | 18 Apr 2022 | 19 Mar 2025 | 18 Apr 2026 |
| 126 | wellnessmassagen-koeln.com | Tucows Domains Inc. | 26 May 2015 | 26 May 2015 | 26 May 2017 |
| 127 | wellnessmassage.info | united-domains AG | 21 Sep 2019 | 6 Feb 2026 | 21 Sep 2026 |
| 128 | wellnessmasterclass.com | GoDaddy.com, LLC | 7 Jan 2020 | 8 Jan 2026 | 7 Jan 2027 |
| 129 | wellnessmassagelandgraaf.com | Metaregistrar BV Applications | 9 Feb 2015 | 10 Feb 2026 | 9 Feb 2027 |
| 130 | wellnessmania.net | Key-Systems GmbH | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 131 | wellnessmania.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2023 | 20 Dec 2024 | 8 Nov 2024 |
| 132 | wellnessmakeup.com | Tucows Domains Inc. | 12 Feb 2015 | 11 Feb 2026 | 12 Feb 2027 |
| 133 | wellnessmassage-ruegen.com | 1&1 Internet AG | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 134 | wellnessmap.org | NameCheap, Inc. | 8 Jul 2025 | 13 Jul 2025 | 8 Jul 2026 |
| 135 | wellnessmassagepraxis.com | PSI-USA, Inc. dba Domain Robot | 24 Feb 2015 | 18 Apr 2017 | 24 Feb 2018 |
| 136 | wellnessmassage4u.com | Tucows Domains Inc. | 26 Feb 2015 | 2 Mar 2018 | 26 Feb 2018 |
| 137 | wellnessmatterswithlisa.com | GoDaddy.com, LLC | 6 Mar 2015 | 7 Mar 2025 | 6 Mar 2027 |
| 138 | wellnessmadeeasier.com | GoDaddy.com, LLC | 21 Nov 2018 | 22 Nov 2025 | 21 Nov 2026 |
| 139 | wellnessmassageclub.com | FastDomain Inc. | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 140 | wellnessmanual.com | NameCheap, Inc. | 27 Mar 2015 | 25 Feb 2025 | 27 Mar 2026 |
| 141 | wellnessmanagementtraining.com | Tucows Domains Inc. | 23 Mar 2012 | 27 Mar 2015 | 23 Mar 2016 |
| 142 | wellnessmanagementcoaching.com | - | - | - | - |
| 143 | wellnessmarketingrotterdam.com | Tucows Domains Inc. | 24 Aug 2010 | 28 Aug 2015 | 24 Aug 2016 |
| 144 | wellnessmania.com | TurnCommerce, Inc. DBA NameBright.com | 19 Nov 2022 | 13 Nov 2023 | 19 Nov 2026 |
| 145 | wellnessmarketingtoolkit.com | GoDaddy.com, LLC | 16 Sep 2020 | 17 Sep 2025 | 16 Sep 2026 |
| 146 | wellnessmaps.net | Tucows Domains Inc. | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2017 |
| 147 | wellnessmassageguide.com | CV. Jogjacamp | 4 Sep 2015 | 3 Sep 2016 | 4 Sep 2017 |
| 148 | wellnessmap.net | Paragon Internet Group Ltd t/a Paragon Names | 17 Dec 2015 | 14 Dec 2019 | 17 Dec 2020 |
| 149 | wellnessmadison.com | Squarespace Domains LLC | 13 May 2024 | 28 Apr 2025 | 13 May 2026 |
| 150 | wellnessmarketnetwork.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 151 | wellnessmadeeasy.org | Tucows Domains Inc. | 5 May 2015 | 25 Jan 2026 | 5 May 2026 |
| 152 | wellnessmasters.net | GoDaddy.com, LLC | 8 May 2015 | 8 May 2024 | 8 May 2026 |
| 153 | wellnessmachine.com | Go Canada Domains, LLC | 13 May 2015 | 14 May 2025 | 13 May 2026 |
| 154 | wellnessmassagega.com | GoDaddy.com, LLC | 11 Sep 2015 | 12 Sep 2025 | 11 Sep 2026 |
| 155 | wellnessmassagespain.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 156 | wellnessmanaged.com | CloudFlare, Inc. | 22 Jan 2025 | 3 Mar 2026 | 22 Jan 2026 |
| 157 | wellnessmarketonline.com | Tucows Domains Inc. | 19 Dec 2020 | 23 Dec 2022 | 19 Dec 2022 |
| 158 | wellnessmassageworks.com | NameCheap, Inc. | 10 Jun 2015 | 12 May 2025 | 10 Jun 2026 |
| 159 | wellnessmanifesto.org | GoDaddy.com, LLC | 10 Jun 2015 | 25 Jul 2025 | 10 Jun 2026 |
| 160 | wellnessmanifesto.net | Squarespace Domains LLC | 5 Dec 2023 | 16 Jan 2026 | 5 Dec 2025 |
| 161 | wellnessmanifesto.info | GoDaddy.com, LLC | 10 Jun 2015 | - | 10 Jun 2016 |
| 162 | wellnessmarket.biz | OnlineNIC, Inc. | 16 Jun 2015 | 16 Jun 2015 | 15 Jun 2016 |
| 163 | wellnessmakeshealthy.com | eNom, Inc. | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 164 | wellnessmandalas.com | eNom, Inc. | 17 Jun 2015 | 12 Jun 2017 | 17 Jun 2019 |
| 165 | wellnessmadeeasy4everyone.com | Domain.com, LLC | 19 Sep 2015 | 19 Sep 2015 | 19 Sep 2016 |
| 166 | wellnessmaster.info | 1&1 Internet AG | 17 Jun 2015 | 17 Jul 2017 | 17 Jun 2018 |
| 167 | wellnessmattersmost.com | NameCheap, Inc. | 9 Jul 2020 | 9 Jun 2025 | 9 Jul 2026 |
| 168 | wellnessmasterygroup.com | Hostinger, UAB | 26 Jun 2015 | 27 Jun 2025 | 26 Jun 2026 |
| 169 | wellnessmassagenyc.com | Network Solutions, LLC | 27 Jun 2015 | 27 Jun 2015 | 27 Jun 2016 |
| 170 | wellnessmattersnow.net | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 171 | wellnessmattersnow.info | GoDaddy.com, LLC | 23 Sep 2015 | 24 Sep 2016 | 23 Sep 2017 |
| 172 | wellnessmattersnow.com | Automattic Inc. | 14 Apr 2022 | 24 Nov 2025 | 14 Apr 2026 |
| 173 | wellnessmatters.info | eNom, Inc. | 29 Jan 2018 | 13 Mar 2025 | 29 Jan 2025 |
| 174 | wellnessmassagetherapybham.com | GoDaddy.com, LLC | 1 Jul 2015 | 1 Jul 2015 | 1 Jul 2017 |
| 175 | wellnessmarketintro.com | GoDaddy.com, LLC | 1 Jul 2015 | 1 Jul 2015 | 1 Jul 2016 |
| 176 | wellnessmandala.com | GoDaddy.com, LLC | 30 May 2020 | 11 Aug 2025 | 30 May 2025 |
| 177 | wellnessmasterkeys.com | GoDaddy.com, LLC | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 178 | wellnessmasterkey.com | Gabia, Inc. | 20 Dec 2024 | 1 Dec 2025 | 20 Dec 2026 |
| 179 | wellnessmart.us | GoDaddy.com, LLC | 9 Jul 2015 | 13 Jul 2017 | 8 Jul 2022 |
| 180 | wellnessmarket.net | GMO Internet Inc. | 17 Dec 2025 | 18 Dec 2025 | 17 Dec 2026 |
| 181 | wellnessmastershop.com | FastDomain Inc. | 10 May 2020 | 10 May 2020 | 10 May 2021 |
| 182 | wellnessmanifestationformula.com | GoDaddy.com, LLC | 19 Jul 2015 | 19 Jul 2015 | 19 Jul 2016 |
| 183 | wellnessmatscanada.com | GoDaddy.com, LLC | 21 Jul 2015 | 26 Jul 2024 | 21 Jul 2026 |
| 184 | wellnessmagzine.com | eNom, Inc. | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 185 | wellnessmassagen-oetztal.com | World4You Internet Services GmbH | 3 Aug 2015 | 1 Dec 2016 | 3 Aug 2017 |
| 186 | wellnessmatspet.com | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2020 |
| 187 | wellnessmattersyoumatter.com | GoDaddy.com, LLC | 2 Feb 2019 | 3 Feb 2026 | 2 Feb 2027 |
| 188 | wellnessmaps.com | Webfusion Ltd. | 25 Jan 2017 | 25 Jan 2026 | 25 Jan 2027 |
| 189 | wellnessmassageprinsenbeek.com | Key-Systems GmbH | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 190 | wellnessmassage-ulrikebeie.com | PSI-USA, Inc. dba Domain Robot | 12 Oct 2015 | 1 Dec 2025 | 12 Oct 2026 |
| 191 | wellnessmassagemd.com | GoDaddy.com, LLC | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 192 | wellnessmaaama.com | GoDaddy.com, LLC | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 193 | wellnessmamas.com | Tucows Domains Inc. | 22 Oct 2015 | 21 Oct 2025 | 22 Oct 2026 |
| 194 | wellnessmash.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 195 | wellnessmantra.net | GoDaddy.com, LLC | 27 Sep 2020 | 27 Sep 2020 | 27 Sep 2021 |
| 196 | wellnessmantra.life | Melbourne IT, Ltd | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 197 | wellnessmart.info | Network Solutions, LLC | 7 Nov 2015 | 20 Dec 2025 | 7 Nov 2027 |
| 198 | wellnessmassage-muenchen.com | Vautron Rechenzentrum AG | 8 Nov 2015 | 10 Nov 2025 | 8 Nov 2026 |
| 199 | wellnessmarketingbootcamp.com | GoDaddy.com, LLC | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 200 | wellnessmassagesigridsiegel.com | Tucows Domains Inc. | 10 Nov 2011 | 14 Nov 2015 | 10 Nov 2016 |
| 201 | wellnessmagneet.com | Cronon AG | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2017 |
| 202 | wellnessmafia.com | Dynadot, LLC | 21 Jun 2023 | 30 Jun 2025 | 21 Jun 2026 |
| 203 | wellnessmatters.life | GoDaddy.com, LLC | 11 Oct 2022 | 22 Dec 2023 | 11 Oct 2023 |
| 204 | wellnessmassagesbc.com | Wild West Domains, LLC | 22 Nov 2015 | 22 Nov 2015 | 22 Nov 2017 |
| 205 | wellnessmassagevt.info | Network Solutions, LLC | 23 Nov 2015 | 23 Nov 2015 | 23 Nov 2016 |
| 206 | wellnessmassagen-landau.com | RegistryGate GmbH | 1 Dec 2015 | 5 Jan 2026 | 1 Dec 2026 |
| 207 | wellnessmapper.com | CloudFlare, Inc. | 24 Dec 2023 | 24 Nov 2025 | 24 Dec 2026 |
| 208 | wellnessmapper.org | Paragon Internet Group Ltd t/a Paragon Names | 15 Dec 2015 | 15 Dec 2015 | 15 Dec 2016 |
| 209 | wellnessmapper.net | Paragon Internet Group Ltd t/a Paragon Names | 15 Dec 2015 | 15 Dec 2015 | 15 Dec 2016 |
| 210 | wellnessmapp.com | Paragon Internet Group Ltd t/a Paragon Names | 16 Dec 2015 | 14 Dec 2016 | 16 Dec 2017 |
| 211 | wellnessmaverick.com | Annulet LLC | 6 Mar 2020 | 19 Feb 2026 | 6 Mar 2027 |
| 212 | wellnessmassagerockford.com | GoDaddy.com, LLC | 27 Dec 2015 | 7 Feb 2026 | 27 Dec 2025 |
| 213 | wellnessmasterplan.com | register.com, Inc. | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 214 | wellnessmatchmaker.com | GoDaddy.com, LLC | 1 Dec 2023 | 12 Jan 2026 | 1 Dec 2026 |
| 215 | wellnessmassager.com | - | 12 Sep 2025 | 16 Oct 2025 | 12 Sep 2026 |
| 216 | wellnessmassagers.com | eNom, Inc. | 10 Jan 2016 | 9 Dec 2016 | 10 Jan 2018 |
| 217 | wellnessmakler.com | Corehub, S.R.L. | 11 Jan 2016 | 12 Jan 2025 | 11 Jan 2027 |
| 218 | wellnessmadeinamerica.com | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 219 | wellnessmassageberlin.com | DNC Holdings, Inc. | 22 Jan 2016 | 22 Jan 2016 | 22 Jan 2017 |
| 220 | wellnessmaniac.com | NameCheap, Inc. | 6 Feb 2026 | 6 Feb 2026 | 6 Feb 2027 |
| 221 | wellnessmarkets.com | NameKing.com Inc. | 20 Jun 2024 | 20 Jun 2024 | 20 Jun 2026 |
| 222 | wellnessmarketings.org | Hostinger, UAB | 14 Aug 2023 | 24 Sep 2024 | 14 Aug 2024 |
| 223 | wellnessmarketings.com | GoDaddy.com, LLC | 28 Jan 2016 | 10 Apr 2024 | 28 Jan 2024 |
| 224 | wellnessmassagecenter.info | GoDaddy.com, LLC | 31 Jan 2016 | 7 Jan 2021 | 31 Jan 2022 |
| 225 | wellnessmanage.com | GoDaddy.com, LLC | 6 Feb 2016 | 7 Feb 2026 | 6 Feb 2028 |
| 226 | wellnessmaxx.com | GoDaddy.com, LLC | 12 Feb 2016 | 12 Feb 2026 | 12 Feb 2027 |
| 227 | wellnessmagicmakers.com | FastDomain Inc. | 10 Feb 2016 | 10 Feb 2016 | 10 Feb 2017 |
| 228 | wellnessmattersrd.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Feb 2016 | 27 Mar 2017 | 18 Feb 2018 |
| 229 | wellnessmarketingclub.com | NameCheap, Inc. | 10 Jun 2017 | 14 Sep 2017 | 10 Jun 2018 |
| 230 | wellnessmarketers.com | GoDaddy.com, LLC | 3 Jun 2021 | 3 Jun 2025 | 3 Jun 2026 |
| 231 | wellnessmaketer.com | GoDaddy.com, LLC | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 232 | wellnessmagazine.online | Hostinger, UAB | 3 Sep 2025 | 8 Sep 2025 | 3 Sep 2026 |
| 233 | wellnessmarketingsummit.com | GoDaddy.com, LLC | 26 Sep 2019 | 26 Sep 2019 | 26 Sep 2021 |
| 234 | wellnessmarketingacademy.com | GoDaddy.com, LLC | 12 Oct 2025 | 12 Oct 2025 | 12 Oct 2026 |
| 235 | wellnessmatters2me.com | GoDaddy.com, LLC | 6 Mar 2016 | 6 Mar 2016 | 6 Mar 2017 |
| 236 | wellnessmassage.com | GoDaddy.com, LLC | 22 Feb 1999 | 21 Mar 2025 | 20 Mar 2026 |
| 237 | wellnessmamahq.com | eNom, Inc. | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2017 |
| 238 | wellnessmarketingretreat.com | eNom, Inc. | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 239 | wellnessmarketingpodcast.com | GoDaddy.com, LLC | 12 Mar 2020 | 13 Mar 2025 | 12 Mar 2026 |
| 240 | wellnessmarketingmasterclass.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Apr 2020 | 5 Apr 2020 | 5 Apr 2021 |
| 241 | wellnessmarketinghq.com | eNom, Inc. | 9 Mar 2016 | 9 Mar 2016 | 9 Mar 2017 |
| 242 | wellnessmadeira.com | eNom, Inc. | 11 Mar 2016 | 11 Mar 2016 | 11 Mar 2017 |
| 243 | wellnessmatt.com | GoDaddy.com, LLC | 30 Sep 2019 | 30 Sep 2019 | 30 Sep 2020 |
| 244 | wellnessmarano.com | Network Solutions, LLC | 29 Mar 2016 | 28 Jan 2022 | 29 Mar 2027 |
| 245 | wellnessmamasucks.com | Tucows Domains Inc. | 7 Apr 2016 | 6 Apr 2025 | 7 Apr 2026 |
| 246 | wellnessmamascam.com | Tucows Domains Inc. | 7 Apr 2016 | 6 Apr 2025 | 7 Apr 2026 |
| 247 | wellnessmarketingcoach.com | GoDaddy.com, LLC | 7 Apr 2016 | 7 Apr 2016 | 7 Apr 2017 |
| 248 | wellnessmarbella.com | GoDaddy.com, LLC | 9 Mar 2026 | 9 Mar 2026 | 9 Mar 2027 |
| 249 | wellnessmastery.net | FastDomain Inc. | 4 Apr 2023 | 6 May 2024 | 4 Apr 2025 |
| 250 | wellnessmana.com | GoDaddy.com, LLC | 28 Mar 2020 | 8 May 2025 | 28 Mar 2025 |
| 251 | wellnessmarketingagency.org | GoDaddy.com, LLC | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 252 | wellnessmarketingagency.net | Google, Inc. | 9 Jun 2019 | 9 Jun 2019 | 9 Jun 2020 |
| 253 | wellnessmarketingagency.info | GoDaddy.com, LLC | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 254 | wellnessmarketingagency.com | Squarespace Domains LLC | 15 Sep 2023 | 5 Sep 2025 | 15 Sep 2026 |
| 255 | wellnessmamayoga.com | Network Solutions, LLC | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 256 | wellnessmassagemallorca.com | Estrategias WebSite S.L. | 27 Apr 2016 | 10 Jan 2026 | 27 Apr 2027 |
| 257 | wellnessmagnetix.com | LCN.COM Ltd. | 3 May 2016 | 30 Mar 2017 | 3 May 2018 |
| 258 | wellnessmastergroup.com | Omnis Network, LLC | 5 May 2016 | 10 Nov 2025 | 5 May 2028 |
| 259 | wellnessmantrasindia.com | GoDaddy.com, LLC | 7 May 2016 | 7 May 2016 | 7 May 2017 |
| 260 | wellnessmassagemartina.com | eNom, Inc. | 17 May 2016 | 14 Oct 2025 | 17 May 2026 |
| 261 | wellnessmatekr.com | GoDaddy.com, LLC | 20 May 2016 | 20 May 2016 | 20 May 2017 |
| 262 | wellnessmatterstoday.com | GoDaddy.com, LLC | 22 May 2016 | 23 May 2025 | 22 May 2028 |
| 263 | wellnessmart.space | Network Solutions, LLC | 17 May 2016 | 31 Aug 2023 | 17 May 2026 |
| 264 | wellnessmama.live | - | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 265 | wellnessmate.net | Domain.com, LLC | 24 May 2016 | 24 May 2016 | 24 May 2017 |
| 266 | wellnessmasseur.com | TurnCommerce, Inc. DBA NameBright.com | 25 May 2016 | 19 May 2021 | 25 May 2026 |
| 267 | wellnessmasteries.com | GoDaddy.com, LLC | 28 May 2016 | 28 May 2016 | 28 May 2017 |
| 268 | wellnessmattersalways.com | GoDaddy.com, LLC | 5 Jun 2016 | 5 Jun 2016 | 5 Jun 2018 |
| 269 | wellnessmassagetherpy.com | eNom, Inc. | 5 Jun 2016 | 5 Jun 2016 | 5 Jun 2017 |
| 270 | wellnessmassagen.info | Deutsche Telekom AG | 11 May 2020 | 9 May 2024 | - |
| 271 | wellnessmarketingworkshop.com | GoDaddy.com, LLC | 8 Jun 2016 | 8 Jun 2016 | 8 Jun 2017 |
| 272 | wellnessmars.org | GoDaddy.com, LLC | 13 Jun 2016 | 14 Jun 2017 | 13 Jun 2018 |
| 273 | wellnessmars.com | NameCheap, Inc. | 13 Jun 2016 | 16 Jul 2025 | 13 Jun 2026 |
| 274 | wellnessmantra.org | Network Solutions, LLC | 5 May 2021 | 22 Jun 2024 | 5 May 2027 |
| 275 | wellnessmarket.org | NameCheap, Inc. | 27 Jul 2024 | 10 Sep 2025 | 27 Jul 2026 |
| 276 | wellnessmassagehuntsville.com | GoDaddy.com, LLC | 20 May 2022 | 28 Oct 2025 | 20 May 2026 |
| 277 | wellnessmaterials.com | - | 25 Jun 2016 | 25 Jun 2016 | 25 Jun 2017 |
| 278 | wellnessmaui.com | GoDaddy.com, LLC | 22 Sep 2017 | 26 Sep 2025 | 22 Sep 2026 |
| 279 | wellnessmassagehsv.com | GoDaddy.com, LLC | 5 Jul 2016 | 5 Jul 2016 | 5 Jul 2017 |
| 280 | wellnessmassage.hamburg | 1&1 Internet AG | 6 Jul 2016 | 6 Jul 2016 | 6 Jul 2018 |
| 281 | wellnessmall.in | - | 5 Mar 2013 | 6 Mar 2017 | 5 Mar 2018 |
| 282 | wellnessmantra.in | NameCheap, Inc. | 26 Apr 2025 | 29 May 2025 | - |
| 283 | wellnessmarin.com | GoDaddy.com, LLC | 3 Dec 2024 | 4 Dec 2025 | 3 Dec 2026 |
| 284 | wellnessmanagementsoftware.com | Tucows Domains Inc. | 11 Jul 2012 | 15 Jul 2016 | 11 Jul 2016 |
| 285 | wellnessmassage-tuebingen.com | - | 15 Jul 2016 | 15 Jul 2016 | 15 Jul 2017 |
| 286 | wellnessmassage.biz | Google, Inc. | 17 Jul 2019 | 16 Aug 2024 | 17 Jul 2024 |
| 287 | wellnessmark.biz | GoDaddy.com, LLC | 4 Jul 2011 | 14 Aug 2023 | 3 Jul 2023 |
| 288 | wellnessmaine.biz | GoDaddy.com, LLC | 29 Apr 2006 | 4 May 2020 | 28 Apr 2021 |
| 289 | wellnessmakescents.biz | 1&1 Internet AG | 20 Aug 2012 | 4 Oct 2019 | 19 Aug 2020 |
| 290 | wellnessmanager.biz | Register.it SPA | 17 Nov 2001 | 23 Oct 2025 | 18 Nov 2026 |
| 291 | wellnessmadesimple.biz | Tucows Domains Inc. | 21 Feb 2014 | 28 Jan 2026 | 20 Feb 2027 |
| 292 | wellnessmassagen.biz | 1&1 Internet AG | 28 Jun 2013 | 24 Oct 2025 | 27 Jun 2026 |
| 293 | wellnessman.biz | 1&1 Internet AG | 8 Aug 2003 | 22 Sep 2017 | 7 Aug 2018 |
| 294 | wellnessmatters4u.com | GoDaddy.com, LLC | 17 Jul 2016 | 22 Jul 2024 | 17 Jul 2026 |
| 295 | wellnessmattersconsulting.com | GoDaddy.com, LLC | 17 Jul 2016 | 22 Jul 2024 | 17 Jul 2026 |
| 296 | wellnessmattersonline.com | Network Solutions, LLC | 22 Jul 2016 | 22 Jun 2025 | 22 Jul 2026 |
| 297 | wellnessmagzineonline.com | GoDaddy.com, LLC | 18 Jul 2014 | 18 Jul 2014 | 18 Jul 2019 |
| 298 | wellnessmarketingcareer.com | - | 27 Jul 2016 | 27 Jul 2016 | 27 Jul 2017 |
| 299 | wellnessmassages.net | Register NV dba Register.eu | 1 Apr 2021 | 23 Nov 2025 | 1 Apr 2026 |
| 300 | wellnessmassageofcharleston.com | Network Solutions, LLC | 4 Aug 2016 | 2 Aug 2017 | 4 Aug 2018 |
| 301 | wellnessmatterspsychiatry.com | GoDaddy.com, LLC | 21 Aug 2016 | 29 Sep 2022 | 21 Aug 2027 |
| 302 | wellnessmassagepro.com | GoDaddy.com, LLC | 24 Aug 2016 | 29 Sep 2022 | 24 Aug 2026 |
| 303 | wellnessmadeforyou.com | GoDaddy.com, LLC | 5 Sep 2023 | 6 Sep 2025 | 5 Sep 2026 |
| 304 | wellnessmarketingformula.com | - | 1 Sep 2016 | 1 Sep 2016 | 1 Sep 2017 |
| 305 | wellnessmarketingbook.com | - | 1 Sep 2016 | 1 Sep 2016 | 1 Sep 2017 |
| 306 | wellnessmassagemontreal.com | - | 29 Aug 2013 | 29 Aug 2013 | 29 Aug 2017 |
| 307 | wellnessmamareview.com | Tucows Domains Inc. | 10 Sep 2016 | 9 Sep 2025 | 10 Sep 2026 |
| 308 | wellnessmamareviews.com | Tucows Domains Inc. | 10 Sep 2016 | 9 Sep 2025 | 10 Sep 2026 |
| 309 | wellnessmarketingquiz.com | - | 13 Sep 2016 | 13 Sep 2016 | 13 Sep 2017 |
| 310 | wellnessmaideasy.com | - | 14 Sep 2016 | 14 Sep 2016 | 14 Sep 2018 |
| 311 | wellnessmarketinglab.com | Google, Inc. | 14 Feb 2023 | 6 Mar 2026 | 14 Feb 2026 |
| 312 | wellnessmarketinghub.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Mar 2025 | 17 May 2025 | 17 Mar 2026 |
| 313 | wellnessmassage.us | Dynadot, LLC | 6 Jul 2023 | 6 Jul 2024 | 6 Jul 2024 |
| 314 | wellnessmaximum.com | NameCheap, Inc. | 29 Aug 2019 | - | 29 Aug 2020 |
| 315 | wellnessmarketingblueprint.com | GoDaddy.com, LLC | 30 Sep 2020 | 1 Oct 2025 | 30 Sep 2026 |
| 316 | wellnessmarketbaobab.com | - | 16 Sep 2016 | 16 Sep 2016 | 16 Sep 2017 |
| 317 | wellnessmassageeindhoven.com | Cronon AG | 28 Sep 2016 | 17 Nov 2025 | 28 Sep 2026 |
| 318 | wellnessmassage-leipzig.com | Cronon AG | 30 Sep 2016 | 30 Sep 2016 | 30 Sep 2018 |
| 319 | wellnessmassage-leipzig.info | Cronon AG | 30 Sep 2016 | 30 Sep 2017 | 30 Sep 2018 |
| 320 | wellnessmadebyhand.com | FastDomain Inc. | 3 Oct 2016 | 3 Oct 2017 | 3 Oct 2018 |
| 321 | wellnessmarketingplatform.com | - | 5 Oct 2016 | 5 Oct 2016 | 5 Oct 2017 |
| 322 | wellnessmarkt.com | TurnCommerce, Inc. DBA NameBright.com | 22 Jan 2020 | 11 Nov 2025 | 22 Jan 2027 |
| 323 | wellnessmale.com | GoDaddy.com, LLC | 4 Feb 2005 | 20 Nov 2025 | 4 Feb 2027 |
| 324 | wellnessmadeeasy.com | GoDaddy.com, LLC | 31 Mar 2010 | 1 Apr 2024 | 31 Mar 2026 |
| 325 | wellnessmasseurs.com | NameTell.com LLC | 9 Oct 2011 | 10 Oct 2017 | 9 Oct 2018 |
| 326 | wellnessmanagedservices.com | GoDaddy.com, LLC | 17 May 2012 | 29 May 2016 | 17 May 2017 |
| 327 | wellnessmaster.com | 1&1 Internet AG | 13 Mar 2000 | 14 Mar 2020 | 13 Mar 2026 |
| 328 | wellnessmarktplatz.com | RegistryGate GmbH | 27 Jun 2000 | 24 Nov 2025 | 27 Jun 2026 |
| 329 | wellnessmail.com | CloudFlare, Inc. | 2 Dec 2008 | 1 Dec 2025 | 2 Dec 2026 |
| 330 | wellnessmadness.com | GoDaddy.com, LLC | 3 Mar 2010 | 4 Mar 2026 | 3 Mar 2027 |
| 331 | wellnessmark.com | GoDaddy.com, LLC | 21 Jun 2006 | 21 Mar 2025 | 21 Jun 2026 |
| 332 | wellnessmatsseasonscollection.com | GoDaddy.com, LLC | 17 Aug 2011 | 18 Aug 2016 | 17 Aug 2017 |
| 333 | wellnessmanagementchiro.com | GoDaddy.com, LLC | 4 May 2012 | 4 May 2016 | 4 May 2017 |
| 334 | wellnessmatratze.com | Vautron Rechenzentrum AG | 13 Oct 2001 | 15 Oct 2025 | 13 Oct 2026 |
| 335 | wellnessmary.com | 1&1 Internet AG | 7 Jun 2012 | 15 Aug 2024 | 19 Nov 2026 |
| 336 | wellnessmanagementgroup.com | DropCatch.com 1475 LLC | 16 Aug 2025 | 17 Aug 2025 | 16 Aug 2026 |
| 337 | wellnessmarketingforum.com | Network Solutions, LLC | 19 Jul 2010 | 21 Jul 2025 | 19 Jul 2026 |
| 338 | wellnessmanagementsystems.com | One.com A/S | 13 Dec 2024 | 14 Dec 2025 | 13 Dec 2026 |
| 339 | wellnessmasters.com | GoDaddy.com, LLC | 4 Oct 2004 | 30 Jul 2025 | 4 Oct 2026 |
| 340 | wellnessmagazin.com | GoDaddy.com, LLC | 4 Mar 2000 | 4 Mar 2026 | 4 Mar 2027 |
| 341 | wellnessmanagermd.com | GoDaddy.com, LLC | 21 May 2009 | 20 May 2016 | 21 May 2017 |
| 342 | wellnessmatsfitness.com | GoDaddy.com, LLC | 2 Jan 2013 | 3 Jan 2025 | 2 Jan 2027 |
| 343 | wellnessmax.com | GoDaddy.com, LLC | 8 Dec 2002 | 24 Jan 2025 | 8 Dec 2032 |
| 344 | wellnessmass.com | 1API GmbH | 17 May 2021 | 19 May 2021 | 17 May 2022 |
| 345 | wellnessmassage-saarland.com | Network Solutions, LLC | 17 Oct 2011 | 19 Oct 2017 | 17 Oct 2018 |
| 346 | wellnessmassage-breda.com | Realtime Register B.V. | 20 Sep 2013 | 22 Sep 2017 | 20 Sep 2018 |
| 347 | wellnessmastery.com | Uniregistrar Corp | 29 Oct 2018 | 30 Oct 2025 | 29 Oct 2026 |
| 348 | wellnessmattersblog.com | Amazon Registrar, Inc. | 2 Sep 2025 | 2 Sep 2025 | 2 Sep 2026 |
| 349 | wellnessmarketingpartners.com | GoDaddy.com, LLC | 11 Aug 2024 | 22 Sep 2025 | 11 Aug 2025 |
| 350 | wellnessmatters.com | GoDaddy.com, LLC | 5 Feb 2012 | 31 Mar 2025 | 30 Mar 2026 |
| 351 | wellnessmatratzen.com | Vautron Rechenzentrum AG | 13 Oct 2001 | 15 Oct 2025 | 13 Oct 2026 |
| 352 | wellnessmatsdealer.com | GoDaddy.com, LLC | 2 May 2013 | 2 May 2025 | 2 May 2027 |
| 353 | wellnessmatterz.com | GoDaddy.com, LLC | 12 Feb 2009 | 12 Feb 2026 | 12 Feb 2027 |
| 354 | wellnessmashup.com | Squarespace Domains LLC | 22 May 2024 | 7 May 2025 | 22 May 2026 |
| 355 | wellnessmarketusa.com | GoDaddy.com, LLC | 16 Sep 2013 | 17 Sep 2016 | 16 Sep 2017 |
| 356 | wellnessmassageclinics.com | Tucows Domains Inc. | 7 May 2013 | 11 May 2022 | 7 May 2022 |
| 357 | wellnessmanagementconsultants.com | GoDaddy.com, LLC | 22 Oct 2013 | 22 Oct 2025 | 22 Oct 2026 |
| 358 | wellnessmassagebreda.com | Realtime Register B.V. | 20 Sep 2013 | 22 Sep 2017 | 20 Sep 2018 |
| 359 | wellnessmatch.com | GoDaddy.com, LLC | 21 Dec 2011 | 24 Dec 2025 | 21 Dec 2026 |
| 360 | wellnessmassagevt.com | Tucows Domains Inc. | 27 Nov 2007 | 23 Jan 2026 | 27 Nov 2026 |
| 361 | wellnessmassage-praxis.com | 1&1 Internet AG | 7 Jul 2007 | 24 Nov 2015 | 7 Jul 2018 |
| 362 | wellnessmamameals.com | Tucows Domains Inc. | 13 Dec 2011 | 16 Feb 2026 | 8 Nov 2026 |
| 363 | wellnessmanifesto.com | TurnCommerce, Inc. DBA NameBright.com | 3 Apr 2014 | 28 Mar 2021 | 3 Apr 2026 |
| 364 | wellnessmatsseasons.com | GoDaddy.com, LLC | 17 Aug 2011 | 18 Aug 2016 | 17 Aug 2017 |
| 365 | wellnessmam.com | GMO Internet Inc. | 16 Jan 2023 | 28 Mar 2024 | 16 Jan 2024 |
| 366 | wellnessmanagers.com | GoDaddy.com, LLC | 10 Jul 2012 | 3 Jul 2025 | 10 Jul 2026 |
| 367 | wellnessmarket.com | Moniker Online Services LLC | 14 Mar 2003 | 25 Nov 2025 | 14 Mar 2026 |
| 368 | wellnessmaine.com | GoDaddy.com, LLC | 29 Apr 2006 | 29 Apr 2025 | 29 Apr 2026 |
| 369 | wellnessmallorca.com | GoDaddy.com, LLC | 4 Jan 2017 | 1 Jan 2026 | 4 Jan 2027 |
| 370 | wellnessmamafitness.com | Tucows Domains Inc. | 13 Dec 2011 | 16 Feb 2026 | 8 Nov 2026 |
| 371 | wellnessmanagementcenter.com | GoDaddy.com, LLC | 28 Aug 2009 | 29 Aug 2015 | 28 Aug 2017 |
| 372 | wellnessmarketingamsterdam.com | Tucows Domains Inc. | 17 May 2009 | 18 Apr 2017 | 17 May 2018 |
| 373 | wellnessman.com | Dynadot, LLC | 8 Aug 2003 | 2 Aug 2025 | 8 Aug 2026 |
| 374 | wellnessmassagebern.com | 1API GmbH | 30 Jun 2006 | 27 Apr 2017 | 30 Jun 2018 |
| 375 | wellnessmagazines.com | Realtime Register B.V. | 24 Jan 2024 | 25 Jan 2025 | 24 Jan 2026 |
| 376 | wellnessmadesimple.com | Dynadot, LLC | 26 Feb 2006 | 2 Dec 2022 | 26 Feb 2031 |
| 377 | wellnessmarketplacenapavalley.com | GoDaddy.com, LLC | 12 Sep 2011 | 13 Sep 2019 | 12 Sep 2021 |
| 378 | wellnessmarketingfriesland.com | Key-Systems GmbH | 7 Jun 2013 | 8 Jun 2016 | 7 Jun 2017 |
| 379 | wellnessmarketingusa.com | GoDaddy.com, LLC | 8 May 2013 | 9 May 2016 | 8 May 2017 |
| 380 | wellnessmaven.com | Tucows Domains Inc. | 22 Mar 2013 | 21 Mar 2025 | 22 Mar 2026 |
| 381 | wellnessmalaysia.com | TurnCommerce, Inc. DBA NameBright.com | 22 May 2012 | 16 May 2021 | 22 May 2026 |
| 382 | wellnessmartmd.com | GoDaddy.com, LLC | 26 May 2009 | 29 Sep 2022 | 9 Jul 2026 |
| 383 | wellnessmanagement.com | GoDaddy.com, LLC | 26 Jan 2000 | 26 Jan 2026 | 26 Jan 2027 |
| 384 | wellnessmatters2u.com | GoDaddy.com, LLC | 20 Jun 2013 | 21 Jun 2016 | 20 Jun 2017 |
| 385 | wellnessmassagecentre.com | OnlineNIC, Inc. | 10 Feb 2018 | 10 Feb 2018 | 10 Feb 2019 |
| 386 | wellnessmassage4women.com | Network Solutions, LLC | 12 Feb 2010 | 27 Mar 2025 | 12 Feb 2025 |
| 387 | wellnessmatsblog.com | GoDaddy.com, LLC | 16 Aug 2021 | 16 Aug 2021 | 16 Aug 2022 |
| 388 | wellnessmattress.com | GoDaddy.com, LLC | 19 May 2013 | 30 Sep 2025 | 19 May 2028 |
| 389 | wellnessmassagecenter.com | TurnCommerce, Inc. DBA NameBright.com | 11 Apr 2020 | 5 Apr 2021 | 11 Apr 2026 |
| 390 | wellnessmadepersonal.com | Dynadot, LLC | 13 Dec 2024 | 22 Jan 2026 | 13 Dec 2025 |
| 391 | wellnessmakescents.com | 1&1 Internet AG | 9 Nov 2011 | 10 Nov 2016 | 9 Nov 2018 |
| 392 | wellnessmassagehouse.com | register.com, Inc. | 10 Dec 2013 | 22 Jan 2026 | 10 Dec 2025 |
| 393 | wellnessmachines.com | eNom, Inc. | 11 Sep 2006 | 12 Sep 2025 | 11 Sep 2026 |
| 394 | wellnessmaintenance.com | Annulet LLC | 22 Sep 2013 | 23 Sep 2025 | 22 Sep 2026 |
| 395 | wellnessmalermeister.com | RegistryGate GmbH | 26 Apr 2006 | 24 Nov 2025 | 26 Apr 2026 |
| 396 | wellnessmarketingsystems.com | NameCheap, Inc. | 16 Dec 2019 | - | 16 Dec 2020 |
| 397 | wellnessmakeover.com | TurnCommerce, Inc. DBA NameBright.com | 1 Dec 2011 | 26 Aug 2021 | 1 Dec 2026 |
| 398 | wellnessmarketingwarriors.com | GoDaddy.com, LLC | 28 Nov 2012 | 29 Nov 2022 | 28 Nov 2027 |
| 399 | wellnessmasszazs.com | DotRoll Kft. | 28 Feb 2012 | 26 Feb 2026 | 28 Feb 2027 |
| 400 | wellnessmarketinggroup.com | GoDaddy.com, LLC | 22 Sep 2021 | 17 Sep 2025 | 22 Sep 2026 |
| 401 | wellnessmassagecenters.com | Wild West Domains, LLC | 22 Jan 2004 | 23 Jan 2016 | 22 Jan 2017 |
| 402 | wellnessmassage-therapies.com | PSI-USA, Inc. dba Domain Robot | 2 Sep 2020 | 2 Sep 2020 | 2 Sep 2021 |
| 403 | wellnessmadeeasystore.com | GoDaddy.com, LLC | 26 Jul 2011 | 29 Apr 2015 | 26 Jul 2017 |
| 404 | wellnessmaasbracht.com | Realtime Register B.V. | 12 Jun 2013 | 13 May 2017 | 12 Jun 2018 |
| 405 | wellnessmat.com | GoDaddy.com, LLC | 9 Jun 2006 | 10 Jun 2025 | 9 Jun 2026 |
| 406 | wellnessmaximized.com | GoDaddy.com, LLC | 21 Oct 2024 | 21 Oct 2025 | 21 Oct 2026 |
| 407 | wellnessmayor.com | GoDaddy.com, LLC | 5 Apr 2014 | 4 Apr 2016 | 5 Apr 2017 |
| 408 | wellnessmarathon.com | TurnCommerce, Inc. DBA NameBright.com | 27 Jun 2005 | 12 Apr 2023 | 27 Jun 2026 |
| 409 | wellnessmallonline.com | GoDaddy.com, LLC | 22 Nov 2023 | 23 Nov 2025 | 22 Nov 2026 |
| 410 | wellnessmarketplacenapavalleyyahoo.com | GoDaddy.com, LLC | 22 Aug 2011 | 23 Aug 2015 | 22 Aug 2017 |
| 411 | wellnessmagic.com | TurnCommerce, Inc. DBA NameBright.com | 22 Oct 2011 | 26 Aug 2021 | 22 Oct 2026 |
| 412 | wellnessmarketingnederland.com | Key-Systems GmbH | 7 Jun 2013 | 8 Jun 2016 | 7 Jun 2017 |
| 413 | wellnessmaker.com | GoDaddy.com, LLC | 14 Sep 2024 | 2 Sep 2025 | 14 Sep 2026 |
| 414 | wellnessmadefun.com | GoDaddy.com, LLC | 15 Apr 2014 | 16 Apr 2025 | 15 Apr 2026 |
| 415 | wellnessmanagementsystem.com | GoDaddy.com, LLC | 30 Jun 2005 | 1 Jul 2025 | 30 Jun 2026 |
| 416 | wellnessmarketingsolutions.com | Omnis Network, LLC | 23 Nov 2009 | 24 Jan 2025 | 23 Nov 2024 |
| 417 | wellnessmate.com | Tucows Domains Inc. | 21 Jan 2000 | 23 Dec 2025 | 21 Jan 2027 |
| 418 | wellnessmanager.com | Name.com, Inc. | 16 Dec 2001 | 20 Jan 2026 | 16 Dec 2026 |
| 419 | wellnessmall.com | GoDaddy.com, LLC | 20 Dec 1996 | 2 Oct 2025 | 13 Jan 2028 |
| 420 | wellnessmartialarts.com | Network Solutions, LLC | 21 Feb 2002 | 23 Dec 2022 | 21 Feb 2028 |
| 421 | wellnessmadenatural.com | GoDaddy.com, LLC | 13 Jan 2010 | 14 Jan 2026 | 13 Jan 2028 |
| 422 | wellnessmauritius.com | GoDaddy.com, LLC | 21 Feb 2008 | 10 Feb 2014 | 21 Feb 2017 |
| 423 | wellnessmanagements.com | Dynadot16 LLC | 10 Feb 2021 | 11 Feb 2021 | 10 Feb 2022 |
| 424 | wellnessmalpractice.com | GoDaddy.com, LLC | 10 Jul 2006 | 24 Jun 2015 | 10 Jul 2017 |
| 425 | wellnessmainstream.com | GoDaddy.com, LLC | 22 Apr 2007 | 22 Apr 2007 | 22 Apr 2017 |
| 426 | wellnessmag.com | Go Australia Domains, LLC | 24 Jun 2010 | 10 Jul 2025 | 24 Jun 2026 |
| 427 | wellnessmassages.com | TurnCommerce, Inc. DBA NameBright.com | 16 Jan 2011 | 1 Mar 2020 | 16 Jan 2027 |
| 428 | wellnessmassage06.com | OVH sas | 19 Apr 2014 | 21 Apr 2016 | 19 Apr 2017 |
| 429 | wellnessmasteruae.com | Omnis Network, LLC | 2 Sep 2007 | 8 Sep 2016 | 2 Sep 2018 |
| 430 | wellnessmarketingnijmegen.com | The Registrar Company B.V. | 19 Aug 2013 | 20 Aug 2017 | 19 Aug 2018 |
| 431 | wellnessmassagen.com | Nicco Ltd. | 3 Jun 2006 | 4 Jun 2025 | 3 Jun 2026 |
| 432 | wellnessmanagementinstitute.com | 1API GmbH | 25 Dec 2019 | 25 Dec 2019 | 25 Dec 2020 |
| 433 | wellnessmade.com | NameCheap, Inc. | 19 Feb 2013 | 20 Jan 2025 | 19 Feb 2026 |
| 434 | wellnessmassage-ebner.com | 1&1 Internet AG | 16 Dec 2013 | 28 Feb 2026 | 16 Dec 2025 |
| 435 | wellnessmarketingnetwork.com | GoDaddy.com, LLC | 17 Nov 2009 | 18 Nov 2015 | 17 Nov 2016 |
| 436 | wellnessmavenapothecary.com | Network Solutions, LLC | 25 Jul 2014 | 4 Jul 2025 | 25 Jul 2026 |
| 437 | wellnessmap.com | GoDaddy.com, LLC | 28 Jul 2017 | 29 Jul 2025 | 28 Jul 2026 |
| 438 | wellnessmakeovers.com | TurnCommerce, Inc. DBA NameBright.com | 24 Feb 2022 | 6 Apr 2025 | 24 Feb 2025 |
| 439 | wellnessmarketinginstitute.com | Network Solutions, LLC | 19 Jul 2010 | 21 Jul 2025 | 19 Jul 2026 |
| 440 | wellnessmath.com | GoDaddy.com, LLC | 30 Dec 2006 | 31 Dec 2025 | 30 Dec 2026 |
| 441 | wellnessmanagementcenters.com | Network Solutions, LLC | 6 Mar 2014 | 4 Jan 2026 | 6 Mar 2027 |
| 442 | wellnessmattersllc.com | Hostinger, UAB | 21 Apr 2025 | 28 Apr 2025 | 21 Apr 2026 |
| 443 | wellnessmarketingworks.com | GoDaddy.com, LLC | 28 Nov 2012 | 10 Dec 2015 | 28 Nov 2016 |
| 444 | wellnessmanufacturing.com | GoDaddy.com, LLC | 7 Jul 2006 | 8 Jul 2025 | 7 Jul 2026 |
| 445 | wellnessmarketing.com | Uniregistrar Corp | 25 Feb 2006 | 3 Jan 2026 | 25 Feb 2027 |
| 446 | wellnessmagazine.com | Tucows Domains Inc. | 6 Dec 2000 | 7 Nov 2025 | 6 Dec 2026 |
| 447 | wellnessmatrix.com | GoDaddy.com, LLC | 1 Jul 2003 | 1 Mar 2025 | 1 Jul 2031 |
| 448 | wellnessmassagetherapycentre.com | GoDaddy.com, LLC | 23 Jul 2012 | 5 Feb 2015 | 23 Jul 2017 |
| 449 | wellnessmaler.com | 1&1 Internet AG | 10 Dec 2005 | 14 Apr 2018 | 10 Dec 2026 |
| 450 | wellnessmassageandreflexology.com | Google, Inc. | 8 Oct 2016 | 19 Sep 2017 | 8 Oct 2018 |
| 451 | wellnessmarketingconsulting.com | eNom, Inc. | 10 Oct 2016 | 22 Nov 2017 | 10 Oct 2017 |
| 452 | wellnessmaler.info | 1&1 Internet AG | 11 Apr 2007 | 26 May 2025 | 11 Apr 2026 |
| 453 | wellnessmarketingusa.info | GoDaddy.com, LLC | 8 May 2013 | 9 May 2017 | 8 May 2018 |
| 454 | wellnessmaine.info | GoDaddy.com, LLC | 29 Apr 2006 | 30 Apr 2017 | 29 Apr 2018 |
| 455 | wellnessmarkt.info | Vautron Rechenzentrum AG | 31 Jul 2009 | 31 Jul 2017 | 31 Jul 2018 |
| 456 | wellnessmarketing.info | NameCheap, Inc. | 16 Oct 2024 | - | - |
| 457 | wellnessmama.info | eNom, Inc. | 30 Oct 2013 | 31 Oct 2017 | 30 Oct 2018 |
| 458 | wellnessmanager.info | Dynadot, LLC | 14 Mar 2019 | 14 Mar 2019 | 14 Mar 2020 |
| 459 | wellnessmakescents.info | 1&1 Internet AG | 20 Aug 2012 | 30 Aug 2017 | 20 Aug 2018 |
| 460 | wellnessmaeda.info | GMO Internet Inc. | 7 Sep 2011 | 22 Aug 2017 | 7 Sep 2018 |
| 461 | wellnessmassage-berlin.info | 1API GmbH | 19 Feb 2014 | 19 Feb 2017 | 19 Feb 2018 |
| 462 | wellnessmanagement.mobi | Mesh Digital Limited | 13 Dec 2011 | 13 Dec 2016 | 13 Dec 2017 |
| 463 | wellnessmassage.mobi | united-domains AG | 9 Sep 2010 | 9 Sep 2016 | 9 Sep 2017 |
| 464 | wellnessmatricks.com | - | 14 Oct 2016 | 14 Oct 2016 | 14 Oct 2018 |
| 465 | wellnessmadefun.net | GoDaddy.com, LLC | 15 Apr 2014 | 16 Apr 2025 | 15 Apr 2026 |
| 466 | wellnessmassagecenter.net | Tucows Domains Inc. | 28 Aug 2012 | 14 Jul 2025 | 28 Aug 2026 |
| 467 | wellnessmagazine.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Nov 2022 | 14 Nov 2025 | 21 Nov 2026 |
| 468 | wellnessmama.net | Tucows Domains Inc. | 8 Feb 2014 | 7 Feb 2026 | 8 Feb 2027 |
| 469 | wellnessmarketing.net | ZigZagNames.com LLC | 20 Nov 2024 | 23 Dec 2025 | 20 Nov 2026 |
| 470 | wellnessmarkt.net | Variomedia AG dba puredomain.com | 31 Mar 2004 | 27 Jan 2017 | 28 Sep 2018 |
| 471 | wellnessmadesimple.net | GoDaddy.com, LLC | 10 Mar 2013 | 11 Mar 2026 | 10 Mar 2027 |
| 472 | wellnessmaine.net | GoDaddy.com, LLC | 29 Apr 2006 | 29 Apr 2025 | 29 Apr 2026 |
| 473 | wellnessmassagen.net | 1API GmbH | 21 Dec 2005 | 26 Apr 2023 | 21 Dec 2023 |
| 474 | wellnessmart.net | Network Solutions, LLC | 16 Apr 2000 | 5 Aug 2024 | 16 Apr 2033 |
| 475 | wellnessmaster.net | GoDaddy.com, LLC | 2 Jun 2022 | 3 Jun 2025 | 2 Jun 2026 |
| 476 | wellnessmatrix.net | GoDaddy.com, LLC | 19 May 2006 | 20 May 2015 | 19 May 2021 |
| 477 | wellnessmarketinginstitute.net | Network Solutions, LLC | 19 Jul 2010 | 21 Jul 2025 | 19 Jul 2026 |
| 478 | wellnessmakescents.net | 1&1 Internet AG | 9 Nov 2011 | 19 Nov 2023 | 9 Nov 2024 |
| 479 | wellnessmapping.net | Easyspace LTD | 12 Mar 2014 | 11 Feb 2016 | 12 Mar 2017 |
| 480 | wellnessmag.net | Name.com, Inc. | 29 Sep 2023 | 12 Dec 2025 | 29 Sep 2025 |
| 481 | wellnessmail.net | CloudFlare, Inc. | 1 Aug 2006 | 7 Jul 2025 | 1 Aug 2026 |
| 482 | wellnessmanagedservices.net | GoDaddy.com, LLC | 17 May 2012 | 29 May 2016 | 17 May 2017 |
| 483 | wellnessmarketingforum.net | Network Solutions, LLC | 19 Jul 2010 | 21 Jul 2025 | 19 Jul 2026 |
| 484 | wellnessmanager.net | Cronon AG | 11 Dec 2005 | 12 Dec 2025 | 11 Dec 2026 |
| 485 | wellnessmatters.net | DropCatch.com 915 LLC | 18 Jul 2024 | 19 Jul 2024 | 18 Jul 2026 |
| 486 | wellnessmassage.net | PSI-USA, Inc. dba Domain Robot | 21 Jul 2004 | 10 Sep 2025 | 21 Jul 2026 |
| 487 | wellnessmauritius.net | GoDaddy.com, LLC | 21 Feb 2008 | 17 Apr 2015 | 21 Feb 2017 |
| 488 | wellnessmarketingusa.net | GoDaddy.com, LLC | 8 May 2013 | 9 May 2016 | 8 May 2017 |
| 489 | wellnessmallorca.net | 1&1 Internet AG | 28 Jul 2013 | 5 Jul 2017 | 28 Jul 2020 |
| 490 | wellnessmarketplace.net | GoDaddy.com, LLC | 19 Jul 2011 | 20 Jul 2025 | 19 Jul 2026 |
| 491 | wellnessmatratzen.net | 1&1 Internet AG | 31 Dec 2010 | 31 Dec 2016 | 31 Dec 2026 |
| 492 | wellnessmanagement.net | Network Solutions, LLC | 21 Oct 2002 | 3 Dec 2025 | 21 Oct 2025 |
| 493 | wellnessmadeeasy.net | NameCheap, Inc. | 10 Jan 2025 | 21 Feb 2026 | 10 Jan 2026 |
| 494 | wellnessmagazin.org | RegistryGate GmbH | 1 Aug 2008 | 25 Nov 2025 | 1 Aug 2026 |
| 495 | wellnessmama.org | Tucows Domains Inc. | 1 Aug 2014 | 5 Aug 2025 | 1 Aug 2026 |
| 496 | wellnessmatters.org | NameSay LLC | 7 May 2018 | 21 Jun 2025 | 7 May 2026 |
| 497 | wellnessmastermind.org | GoDaddy.com, LLC | 14 Sep 2011 | 29 Oct 2025 | 14 Sep 2026 |
| 498 | wellnessmakescents.org | 1&1 Internet AG | 20 Aug 2012 | 20 Oct 2017 | 20 Aug 2018 |
| 499 | wellnessmastery.org | GoDaddy.com, LLC | 2 Aug 2025 | 19 Aug 2025 | 2 Aug 2026 |
| 500 | wellnessmadesimple.org | GoDaddy.com, LLC | 27 Apr 2014 | 5 Jul 2024 | 27 Apr 2026 |
| 501 | wellnessmassagestudios.org | register.com, Inc. | 26 Jan 2008 | 26 Jan 2026 | 26 Jan 2027 |
| 502 | wellnessmarketplace.org | Network Solutions, LLC | 4 Jun 2014 | 9 Apr 2025 | 4 Jun 2026 |
| 503 | wellnessmarketing.org | Tucows Domains Inc. | 22 Mar 2013 | 26 Mar 2025 | 22 Mar 2026 |
| 504 | wellnessmassage.org | Annulet LLC | 14 Jun 2011 | 29 Jul 2025 | 14 Jun 2026 |
| 505 | wellnessmarkt.org | Key-Systems GmbH | 29 Oct 2015 | 29 Dec 2015 | 29 Oct 2016 |
| 506 | wellnessmagazine.org | GoDaddy.com, LLC | 5 Dec 2025 | 10 Dec 2025 | 5 Dec 2026 |
| 507 | wellnessmart.org | GoDaddy.com, LLC | 28 Apr 2016 | 19 Feb 2026 | 28 Apr 2026 |
| 508 | wellnessmarketinginstitute.org | Network Solutions, LLC | 19 Jul 2010 | 21 Jul 2025 | 19 Jul 2026 |
| 509 | wellnessmanager.org | NameCheap, Inc. | 5 Jan 2026 | 10 Jan 2026 | 5 Jan 2027 |
| 510 | wellnessmanagedservices.org | GoDaddy.com, LLC | 17 May 2012 | 5 May 2017 | 17 May 2018 |
| 511 | wellnessmassagecenter.org | Tucows Domains Inc. | 18 May 2011 | 22 May 2017 | 18 May 2018 |
| 512 | wellnessmarketingusa.org | GoDaddy.com, LLC | 8 May 2013 | 9 May 2017 | 8 May 2018 |
| 513 | wellnessmaine.org | GoDaddy.com, LLC | 29 Apr 2006 | 13 Jun 2025 | 29 Apr 2026 |
| 514 | wellnessmarketingforum.org | Network Solutions, LLC | 19 Jul 2010 | 21 Jul 2025 | 19 Jul 2026 |
| 515 | wellnessmasssage.ruhr | PSI-USA, Inc. dba Domain Robot | 24 Jun 2014 | 8 Feb 2022 | 24 Jun 2022 |
| 516 | wellnessmadeeasy.biz | GoDaddy.com, LLC | 14 Nov 2023 | 26 Dec 2024 | 14 Nov 2024 |
| 517 | wellnessmassagen.org | Cronon AG | 24 Oct 2016 | 25 Oct 2017 | 24 Oct 2018 |
| 518 | wellnessmattersalways.net | - | 25 Oct 2016 | 25 Oct 2016 | 25 Oct 2019 |
| 519 | wellnessmanagement.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 520 | wellnessmassage-online.de | - | - | 2 Nov 2009 | - |
| 521 | wellnessmassagen.de | - | - | 10 Feb 2016 | - |
| 522 | wellnessmassagen-jaeger.de | - | - | 27 Apr 2009 | - |
| 523 | wellnessmassagen-bottrop.de | - | - | 25 Feb 2026 | - |
| 524 | wellnessmassagen-in-raunheim.de | - | - | 19 Feb 2014 | - |
| 525 | wellnessmassage-aachen.de | - | - | 8 Feb 2016 | - |
| 526 | wellnessmaxx.de | - | - | 21 Jul 2017 | - |
| 527 | wellnessmacher.de | - | - | 2 Oct 2016 | - |
| 528 | wellnessmarket.eu | - | - | - | - |
| 529 | wellnessmama.mobi | Gandi SAS | 31 Oct 2016 | 14 Dec 2017 | 31 Oct 2018 |
| 530 | wellnessmassagecumming.com | GoDaddy.com, LLC | 8 Nov 2016 | 11 Oct 2025 | 8 Nov 2034 |
| 531 | wellnessmadeclear.com | GoDaddy.com, LLC | 11 Nov 2016 | 12 Nov 2025 | 11 Nov 2028 |
| 532 | wellnessmaltashop.com | GoDaddy.com, LLC | 21 Nov 2016 | 21 Nov 2016 | 21 Nov 2017 |
| 533 | wellnessmaincapital.com | Network Solutions, LLC | 24 Nov 2016 | 26 Nov 2017 | 24 Nov 2018 |
| 534 | wellnessmarketingpro.com | NameCheap, Inc. | 7 Feb 2024 | 8 Feb 2025 | 7 Feb 2026 |
| 535 | wellnessmassagelv.com | DNC Holdings, Inc. | 14 Jan 2023 | 25 Feb 2026 | 14 Jan 2026 |
| 536 | wellnessmacy.com | Tucows Domains Inc. | 12 May 2021 | 16 May 2022 | 12 May 2022 |
| 537 | wellnessmadesimpler.com | Tucows Domains Inc. | 24 Dec 2016 | 28 Dec 2017 | 24 Dec 2017 |
| 538 | wellnessmagpie.com | GoDaddy.com, LLC | 8 Jan 2017 | 9 Jan 2026 | 8 Jan 2027 |
| 539 | wellnessmadame.com | GoDaddy.com, LLC | 11 Jan 2017 | 11 Jan 2017 | 11 Jan 2018 |
| 540 | wellnessmademoiselle.com | GoDaddy.com, LLC | 18 Jan 2017 | 18 Jan 2017 | 18 Jan 2018 |
| 541 | wellnessmagnetic.com | GoDaddy.com, LLC | 5 Sep 2021 | 6 Sep 2025 | 5 Sep 2026 |
| 542 | wellnessmadesimplebyscience.com | GoDaddy.com, LLC | 27 Jan 2017 | 27 Jan 2017 | 27 Jan 2018 |
| 543 | wellnessmanifestation.com | GoDaddy.com, LLC | 27 Jan 2017 | 27 Jan 2017 | 27 Jan 2018 |
| 544 | wellnessmarketingmagazine.com | Tucows Domains Inc. | 30 Jan 2017 | 3 Feb 2018 | 30 Jan 2018 |
| 545 | wellnessmassagehk.com | DomainName Path, Inc. | 21 Apr 2019 | 21 Apr 2019 | 21 Apr 2020 |
| 546 | wellnessmassage-kassel.online | Tucows Domains Inc. | 1 Feb 2017 | 1 Feb 2017 | 1 Feb 2018 |
| 547 | wellnessmates.com | Annulet LLC | 26 Apr 2018 | 27 Apr 2025 | 26 Apr 2026 |
| 548 | wellnessmagazineonline.com | NameCheap, Inc. | 30 Jul 2024 | 30 Jun 2025 | 30 Jul 2026 |
| 549 | wellnessmassagetheraphy.com | Crazy Domains FZ-LLC | 9 Feb 2017 | 20 Feb 2019 | 9 Feb 2019 |
| 550 | wellnessmama.site | NameCheap, Inc. | 13 Feb 2017 | 2 Mar 2017 | 13 Feb 2018 |
| 551 | wellnessmastermindkc.com | GoDaddy.com, LLC | 13 Feb 2017 | 13 Feb 2017 | 13 Feb 2018 |
| 552 | wellnessmarketplacesalonandspa.com | Wix.com Ltd. | 15 Feb 2017 | 22 Jan 2026 | 15 Feb 2027 |
| 553 | wellnessmarketingpro.net | GoDaddy.com, LLC | 17 Feb 2017 | 17 Feb 2017 | 17 Feb 2018 |
| 554 | wellnessmaze.com | Annulet LLC | 11 May 2021 | 12 May 2025 | 11 May 2026 |
| 555 | wellnessmassagechair.com | GoDaddy.com, LLC | 19 Feb 2017 | 20 Feb 2026 | 19 Feb 2027 |
| 556 | wellnessmanagementsolutions.com | GoDaddy.com, LLC | 24 Nov 2025 | 24 Nov 2025 | 24 Nov 2026 |
| 557 | wellnessmarketingsecrets.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Apr 2020 | 18 Apr 2020 | 18 Apr 2021 |
| 558 | wellnessmama4.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 559 | wellnessmama3.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 560 | wellnessmama7.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 561 | wellnessmama2.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 562 | wellnessmama6.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 563 | wellnessmama1.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 564 | wellnessmama9.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 565 | wellnessmama8.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 566 | wellnessmama5.com | NameCheap, Inc. | 28 Feb 2017 | 30 Jul 2017 | 28 Feb 2018 |
| 567 | wellnessmalibu.com | Launchpad, Inc. | 6 Mar 2017 | 19 Feb 2026 | 6 Mar 2027 |
| 568 | wellnessmarketplace.info | Namesilo, LLC | 24 Dec 2025 | 6 Feb 2026 | - |
| 569 | wellnessmallorca.org | 1&1 Internet AG | 9 Mar 2017 | 9 May 2017 | 9 Mar 2019 |
| 570 | wellnessmadeeasywithfood.com | GoDaddy.com, LLC | 19 Mar 2017 | 20 Mar 2024 | 19 Mar 2026 |
| 571 | wellnessmassagetherapynow.info | Gandi SAS | 23 Mar 2017 | 22 May 2017 | 23 Mar 2018 |
| 572 | wellnessmarketingcertification.com | GoDaddy.com, LLC | 11 Apr 2017 | 11 Apr 2017 | 11 Apr 2018 |
| 573 | wellnessmarketingtraining.com | NameCheap, Inc. | 18 May 2021 | 3 May 2022 | 18 May 2023 |
| 574 | wellnessmagick.com | GoDaddy.com, LLC | 13 Apr 2017 | 13 Apr 2017 | 13 Apr 2018 |
| 575 | wellnessmassage.co.uk | - | 31 Mar 2015 | 31 Mar 2025 | 31 Mar 2027 |
| 576 | wellnessmarketingcourse.com | GoDaddy.com, LLC | 15 Apr 2017 | 15 Apr 2017 | 15 Apr 2018 |
| 577 | wellnessmaroc.com | GoDaddy.com, LLC | 15 Apr 2017 | 16 Apr 2025 | 15 Apr 2026 |
| 578 | wellnessmaharashtra.com | GoDaddy.com, LLC | 26 Apr 2017 | 26 Apr 2017 | 26 Apr 2019 |
| 579 | wellnessmarketingu.com | GoDaddy.com, LLC | 3 May 2017 | 3 May 2017 | 3 May 2018 |
| 580 | wellnessmark.net | GoDaddy.com, LLC | 3 May 2017 | 30 Jul 2017 | 3 May 2021 |
| 581 | wellnessmarketing360.com | FastDomain Inc. | 29 Jun 2021 | 11 Sep 2024 | 29 Jun 2024 |
| 582 | wellnessmatrix.org | GoDaddy.com, LLC | 11 May 2017 | 11 May 2017 | 11 May 2018 |
| 583 | wellnessmartcenter.com | GoDaddy.com, LLC | 11 May 2017 | 11 May 2017 | 11 May 2019 |
| 584 | wellnessmart.mobi | GoDaddy.com, LLC | 11 May 2017 | 12 May 2019 | 11 May 2021 |
| 585 | wellnessmartonline.com | Hostinger, UAB | 20 Oct 2025 | 20 Oct 2025 | 20 Oct 2026 |
| 586 | wellnessmart.biz | GoDaddy.com, LLC | 11 May 2017 | 16 May 2019 | 10 May 2021 |
| 587 | wellnessmart.center | GoDaddy.com, LLC | 11 May 2017 | 25 Jun 2019 | 11 May 2021 |
| 588 | wellnessmart.today | GoDaddy.com, LLC | 11 May 2017 | 11 May 2017 | 11 May 2019 |
| 589 | wellnessmart.market | GoDaddy.com, LLC | 11 May 2017 | 9 Oct 2017 | 11 May 2019 |
| 590 | wellnessmalta.com | Wix.com Ltd. | 28 Jan 2025 | 29 Dec 2025 | 28 Jan 2027 |
| 591 | wellnessmanifest.com | GoDaddy.com, LLC | 7 Jul 2023 | 8 Jul 2025 | 7 Jul 2026 |
| 592 | wellnessmassagebyerica.com | Tucows Domains Inc. | 24 May 2017 | 28 May 2022 | 24 May 2022 |
| 593 | wellnessmails.com | GoDaddy.com, LLC | 25 Oct 2022 | 25 Oct 2022 | 25 Oct 2023 |
| 594 | wellnessmartwla.com | Google, Inc. | 29 May 2017 | 29 May 2017 | 29 May 2018 |
| 595 | wellnessmarketingexperts.com | Google, Inc. | 28 Sep 2020 | 28 Oct 2024 | 28 Sep 2024 |
| 596 | wellnessmarketingninja.com | GoDaddy.com, LLC | 13 Jun 2017 | 13 Jun 2017 | 13 Jun 2018 |
| 597 | wellnessmaters.com | NameCheap, Inc. | 7 Oct 2024 | 18 Nov 2025 | 7 Oct 2025 |
| 598 | wellnessmaintenance.org | GoDaddy.com, LLC | 17 Jun 2017 | 17 Aug 2017 | 17 Jun 2018 |
| 599 | wellnessmarketingmovement.com | GoDaddy.com, LLC | 20 Jun 2017 | 20 Jun 2017 | 20 Jun 2018 |
| 600 | wellnessmarketingmachine.com | NameCheap, Inc. | 20 Apr 2020 | 21 Mar 2025 | 20 Apr 2026 |
| 601 | wellnessmate.info | Google, Inc. | 10 Sep 2019 | 10 Sep 2024 | 10 Sep 2025 |
| 602 | wellnessmamas.org | GoDaddy.com, LLC | 25 Jun 2017 | 15 Sep 2017 | 25 Jun 2018 |
| 603 | wellnessmarketing.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jul 2017 | 16 Jul 2017 | 15 Jul 2018 |
| 604 | wellnessmaxnow.com | Namesilo, LLC | 19 Jul 2017 | 20 Jul 2017 | 19 Jul 2018 |
| 605 | wellnessmartstore.com | NameCheap, Inc. | 26 Jul 2017 | 26 Jul 2017 | 26 Jul 2018 |
| 606 | wellnessmaketheleap.com | NameCheap, Inc. | 28 Jul 2017 | 28 Jul 2017 | 28 Jul 2018 |
| 607 | wellnessmar.com | Instra Corporation Pty Ltd. | 15 Oct 2020 | 22 Nov 2025 | 15 Oct 2026 |
| 608 | wellnessmakerbaker.com | Tucows Domains Inc. | 31 Jul 2017 | 17 Jul 2019 | 31 Jul 2020 |
| 609 | wellnessmassagevt.net | Network Solutions, LLC | 19 Aug 2017 | 19 Aug 2017 | 19 Aug 2018 |
| 610 | wellnessmama.today | NameCheap, Inc. | 19 Aug 2017 | 19 Aug 2017 | 19 Aug 2018 |
| 611 | wellnessmassage-tuebingen.de | - | - | 8 Jun 2016 | - |
| 612 | wellnessmadeaffordable.com | Domain.com, LLC | 29 Aug 2017 | 29 Aug 2017 | 29 Aug 2018 |
| 613 | wellnessmadeforyou.net | FastDomain Inc. | 31 Aug 2017 | 17 Aug 2019 | 31 Aug 2020 |
| 614 | wellnessmagazin.net | Name.com, Inc. | 31 Aug 2017 | 13 Nov 2023 | 31 Aug 2023 |
| 615 | wellnessmamagroup.com | Tucows Domains Inc. | 12 Sep 2017 | 11 Sep 2025 | 12 Sep 2026 |
| 616 | wellnessmac.com | NameCheap, Inc. | 22 Sep 2017 | 22 Sep 2017 | 22 Sep 2018 |
| 617 | wellnessmag.info | GoDaddy.com, LLC | 26 Sep 2017 | 26 Sep 2017 | 26 Sep 2018 |
| 618 | wellnessmarkets.men | URL Solutions, Inc. | 26 Sep 2017 | 26 Sep 2017 | 26 Sep 2018 |
| 619 | wellnessmassage.life | NameCheap, Inc. | 25 Apr 2020 | 25 Apr 2020 | 25 Apr 2021 |
| 620 | wellnessmariana.com | DreamHost, LLC | 30 Sep 2017 | 30 Sep 2017 | 30 Sep 2018 |
| 621 | wellnessmama.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2024 | 5 Nov 2025 | 4 Nov 2026 |
| 622 | wellnessmadeeasyrdn.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Nov 2017 | 6 Nov 2017 | 6 Nov 2018 |
| 623 | wellnessmase.com | NameCheap, Inc. | 13 Nov 2017 | 14 Nov 2017 | 13 Nov 2018 |
| 624 | wellnessmassagetherapiesandboutique.com | Network Solutions, LLC | 14 Nov 2017 | 14 Nov 2017 | 14 Nov 2019 |
| 625 | wellnessmarketingpower.com | Server Plan Srl | 14 Nov 2017 | 14 Nov 2025 | 14 Nov 2026 |
| 626 | wellnessmaneuver.com | Dynadot, LLC | 15 Nov 2017 | 15 Nov 2017 | 15 Nov 2018 |
| 627 | wellnessmassagetherapyandboutique.com | Network Solutions, LLC | 18 Nov 2017 | 18 Nov 2017 | 18 Nov 2019 |
| 628 | wellnessmassagenova.com | Domain.com, LLC | 20 Nov 2017 | 5 Nov 2025 | 20 Nov 2026 |
| 629 | wellnessmassage-excellence.com | Automattic Inc. | 26 Nov 2017 | 24 Nov 2025 | 26 Nov 2026 |
| 630 | wellnessmatters.online | GoDaddy.com, LLC | 10 Sep 2025 | 23 Oct 2025 | 10 Sep 2026 |
| 631 | wellnessmarket.review | NameCheap, Inc. | 19 Dec 2017 | 19 Dec 2017 | 19 Dec 2018 |
| 632 | wellnessmanufaktur.com | Cronon AG | 26 Dec 2017 | 14 Feb 2026 | 26 Dec 2026 |
| 633 | wellnessmatters.co.uk | - | 1 May 2023 | 24 Nov 2025 | 1 May 2026 |
| 634 | wellnessmarketplace.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 29 Nov 2016 | 29 Nov 2016 | 29 Nov 2019 |
| 635 | wellnessmarket.co.uk | - | 6 Nov 2025 | 6 Mar 2026 | 6 Nov 2026 |
| 636 | wellnessmanagement.co.uk | - | 5 Oct 2022 | 3 Jan 2026 | 5 Oct 2026 |
| 637 | wellnessmatters.org.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 16 May 2014 | 9 May 2017 | 16 May 2018 |
| 638 | wellnessmanagementsoftware.co.uk | - | 11 Jul 2012 | 1 Jul 2024 | 11 Jul 2026 |
| 639 | wellnessmap.co.uk | Hello Internet Corp. | 13 Aug 2014 | 13 Aug 2017 | 13 Aug 2018 |
| 640 | wellnessmanagementcommunity.co.uk | - | 3 Jan 2005 | 5 Dec 2024 | 3 Jan 2027 |
| 641 | wellnessmag.co.uk | - | 7 Sep 2011 | 9 Aug 2017 | 7 Sep 2019 |
| 642 | wellnessmanagement.uk | - | 10 Jun 2014 | 15 Jul 2024 | 10 Jun 2026 |
| 643 | wellnessmarathon.co.uk | - | 9 Jun 2016 | 9 Jun 2017 | 9 Jun 2018 |
| 644 | wellnessmakeover.co.uk | - | 1 Aug 2017 | 28 Sep 2017 | 1 Aug 2018 |
| 645 | wellnessmap.uk | - | 17 Dec 2015 | 16 Dec 2016 | 17 Dec 2017 |
| 646 | wellnessmarketplace.org.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 29 Nov 2016 | 29 Nov 2016 | 29 Nov 2019 |
| 647 | wellnessmanagementcommunity.org.uk | - | 7 Jun 2006 | 3 Jun 2017 | 7 Jun 2018 |
| 648 | wellnessmart.co.uk | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 6 Jun 2009 | 26 Jul 2017 | 6 Jun 2018 |
| 649 | wellnessmassagetherapy.co.uk | - | 28 Jul 2015 | 29 Jul 2025 | 28 Jul 2027 |
| 650 | wellnessmanager.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 22 Sep 2017 | 22 Sep 2017 | 22 Sep 2019 |
| 651 | wellnessmapping.co.uk | - | 12 Mar 2014 | 11 Feb 2016 | 12 Mar 2018 |
| 652 | wellnessmadeeasyrd.com | Tucows Domains Inc. | 8 Jan 2018 | 12 Jan 2020 | 8 Jan 2020 |
| 653 | wellnessmamauk.com | NameCheap, Inc. | 28 Aug 2025 | 28 Aug 2025 | 28 Aug 2026 |
| 654 | wellnessmamauk.co.uk | eNom, Inc. | 3 Feb 2018 | 3 Feb 2018 | 3 Feb 2019 |
| 655 | wellnessmanagementcenters.net | Network Solutions, LLC | 10 Feb 2018 | 11 Feb 2018 | 10 Feb 2019 |
| 656 | wellnessmale.info | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 18 Feb 2018 | - | 18 Feb 2019 |
| 657 | wellnessmakesadifference.com | NameCheap, Inc. | 12 Mar 2018 | 12 Mar 2018 | 12 Mar 2019 |
| 658 | wellnessmarketing.co.uk | - | 3 Nov 2023 | 2 Nov 2025 | 3 Nov 2026 |
| 659 | wellnessmantraa.com | Tucows Domains Inc. | 27 Jun 2020 | 23 Jun 2025 | 27 Jun 2026 |
| 660 | wellnessmarketingpros.com | Wix.com Ltd. | 3 Aug 2024 | 13 Sep 2025 | 3 Aug 2025 |
| 661 | wellnessmassage22.com | Network Solutions, LLC | 22 Apr 2018 | 22 Apr 2018 | 22 Apr 2019 |
| 662 | wellnessmapping.com | TurnCommerce, Inc. DBA NameBright.com | 15 Jul 2019 | 9 Jul 2020 | 15 Jul 2026 |
| 663 | wellnessmachines.net | Amazon Registrar, Inc. | 1 May 2018 | 1 May 2018 | 1 May 2019 |
| 664 | wellnessmadereal.com | Name.com, Inc. | 30 Dec 2024 | 11 Feb 2026 | 30 Dec 2025 |
| 665 | wellnessmaintain.com | Google, Inc. | 26 May 2018 | 26 Jul 2024 | 26 May 2024 |
| 666 | wellnessmadesimple.ca | - | 28 Sep 2014 | 31 Jul 2019 | 28 Sep 2026 |
| 667 | wellnessmarketpro.com | GoDaddy.com, LLC | 11 Feb 2025 | 12 Feb 2026 | 11 Feb 2027 |
| 668 | wellnessmas.com | GoDaddy.com, LLC | 11 Jun 2018 | 11 Jun 2025 | 11 Jun 2026 |
| 669 | wellnessmadeasy.com | Wix.com Ltd. | 19 May 2022 | 19 Apr 2024 | 19 May 2026 |
| 670 | wellnessmatrixedge.com | GoDaddy.com, LLC | 19 Jun 2018 | 19 Jun 2018 | 19 Jun 2019 |
| 671 | wellnessmanagementservices.com | Dynadot, LLC | 25 Feb 2024 | 26 Feb 2026 | 25 Feb 2027 |
| 672 | wellnessmattress.net | FastDomain Inc. | 19 Jun 2018 | 19 Jun 2018 | 19 Jun 2019 |
| 673 | wellnessmarketllc.com | NameCheap, Inc. | 21 Jun 2018 | 21 Jun 2018 | 21 Jun 2019 |
| 674 | wellnessmassagesalisbury.com | Network Solutions, LLC | 25 Jun 2018 | 25 Jun 2018 | 25 Jun 2019 |
| 675 | wellnessmatrix.group | GoDaddy.com, LLC | 25 Jun 2018 | 25 Jun 2018 | 25 Jun 2019 |
| 676 | wellnessmatrix.info | Tucows Domains Inc. | 13 Feb 2024 | 7 Feb 2026 | - |
| 677 | wellnessmatrixsolutions.com | GoDaddy.com, LLC | 25 Jun 2018 | 25 Jun 2018 | 25 Jun 2019 |
| 678 | wellnessmatrixgroup.info | GoDaddy.com, LLC | 25 Jun 2018 | 25 Jun 2018 | 25 Jun 2019 |
| 679 | wellnessmandan.com | GoDaddy.com, LLC | 26 Jun 2018 | 26 Jun 2018 | 26 Jun 2019 |
| 680 | wellnessmatrixgroup.net | GoDaddy.com, LLC | 25 Jun 2018 | 26 Jun 2019 | 25 Jun 2020 |
| 681 | wellnessmatrix.biz | GoDaddy.com, LLC | 25 Jun 2018 | 1 Jul 2019 | 25 Jun 2020 |
| 682 | wellnessmassagespa.com | - | 19 Sep 2025 | 9 Nov 2025 | 20 Sep 2026 |
| 683 | wellnessmamatoothpaste.com | Tucows Domains Inc. | 13 Jul 2018 | 12 Jul 2025 | 13 Jul 2026 |
| 684 | wellnessmavin.com | GoDaddy.com, LLC | 24 Jul 2018 | 24 Jul 2018 | 24 Jul 2019 |
| 685 | wellnessmadebetter.com | GoDaddy.com, LLC | 13 Feb 2025 | 14 Feb 2026 | 13 Feb 2027 |
| 686 | wellnessmasterstechnology.com | GoDaddy.com, LLC | 29 Jul 2018 | 29 Jul 2018 | 29 Jul 2020 |
| 687 | wellnessmasterstech.com | GoDaddy.com, LLC | 29 Jul 2018 | 29 Jul 2018 | 29 Jul 2020 |
| 688 | wellnessmarketingbundle.com | Google, Inc. | 31 Jul 2018 | 31 Jul 2018 | 31 Jul 2019 |
| 689 | wellnessmanuela.com | Tucows Domains Inc. | 11 Aug 2018 | 11 Aug 2018 | 11 Aug 2019 |
| 690 | wellnessmanufacture.com | Google, Inc. | 14 Aug 2018 | 14 Aug 2018 | 14 Aug 2019 |
| 691 | wellnessmagnets.com | - | 20 Nov 2021 | 11 Dec 2023 | 20 Nov 2026 |
| 692 | wellnessmarketing.coach | Uniregistrar Corp | 7 Sep 2018 | 7 Sep 2018 | 7 Sep 2019 |
| 693 | wellnessmarketingqueen.com | GoDaddy.com, LLC | 14 Sep 2018 | 14 Sep 2018 | 14 Sep 2019 |
| 694 | wellnessmarketingstudio.com | GoDaddy.com, LLC | 16 Dec 2024 | 18 Dec 2025 | 16 Dec 2026 |
| 695 | wellnessmamarx.com | FastDomain Inc. | 23 Sep 2018 | 23 Sep 2018 | 23 Sep 2019 |
| 696 | wellnessmattersgroup.com | GoDaddy.com, LLC | 29 Sep 2018 | 29 Sep 2018 | 29 Sep 2019 |
| 697 | wellnessmatterz.info | Network Solutions, LLC | 6 Oct 2018 | 6 Oct 2018 | 6 Oct 2019 |
| 698 | wellnessmassagegroup.com | Network Solutions, LLC | 6 Oct 2018 | 6 Sep 2024 | 6 Oct 2026 |
| 699 | wellnessmassagecornol.com | 1&1 Internet AG | 12 Oct 2018 | 12 Oct 2018 | 12 Oct 2019 |
| 700 | wellnessmarket.store | GoDaddy.com, LLC | 23 Dec 2025 | 22 Jan 2026 | 23 Dec 2026 |
| 701 | wellnessmagnolia.com | Google, Inc. | 25 Oct 2018 | 25 Oct 2018 | 25 Oct 2019 |
| 702 | wellnessmassage.guru | Cronon AG | 26 Oct 2018 | 10 Dec 2021 | 26 Oct 2022 |
| 703 | wellnessmary.info | GoDaddy.com, LLC | 31 Oct 2018 | 31 Oct 2018 | 31 Oct 2019 |
| 704 | wellnessmassagendegenhardt.com | Name.com, Inc. | 1 Nov 2018 | 1 Nov 2018 | 1 Nov 2019 |
| 705 | wellnessmama.wtf | Tucows Domains Inc. | 2 Nov 2018 | 16 Feb 2026 | - |
| 706 | wellnessmama.wine | 1API GmbH | 2 Nov 2018 | 17 Dec 2024 | 2 Nov 2026 |
| 707 | wellnessmassageodyssey.com | GoDaddy.com, LLC | 12 Nov 2018 | 14 Nov 2025 | 12 Nov 2026 |
| 708 | wellnessmarks.com | GoDaddy.com, LLC | 28 Nov 2018 | 28 Nov 2025 | 28 Nov 2026 |
| 709 | wellnessmasturismo.com | GoDaddy.com, LLC | 5 Dec 2018 | 5 Dec 2018 | 5 Dec 2019 |
| 710 | wellnessmastienda.com | GoDaddy.com, LLC | 4 Dec 2018 | 5 Dec 2025 | 4 Dec 2026 |
| 711 | wellnessmanifested.com | NameCheap, Inc. | 7 Dec 2018 | 22 Nov 2025 | 7 Dec 2026 |
| 712 | wellnessmarketingco.com | CloudFlare, Inc. | 18 Dec 2018 | 18 Nov 2025 | 18 Dec 2026 |
| 713 | wellnessmassage-bonn.info | 1&1 Internet AG | 18 Dec 2018 | 18 Dec 2018 | 18 Dec 2019 |
| 714 | wellnessmarketingstrategy.com | GoDaddy.com, LLC | 19 Dec 2018 | 20 Dec 2025 | 19 Dec 2026 |
| 715 | wellnessmarketstore.com | NameCheap, Inc. | 11 Oct 2020 | 22 Dec 2023 | 11 Oct 2023 |
| 716 | wellnessmanagementpractice.com | Network Solutions, LLC | 4 Jan 2019 | 5 Dec 2024 | 4 Jan 2027 |
| 717 | wellnessmanufaktur.info | PSI-USA, Inc. dba Domain Robot | 9 Jan 2019 | 9 Jan 2019 | 9 Jan 2020 |
| 718 | wellnessmakingcents.com | FastDomain Inc. | 10 Jan 2019 | 10 Jan 2019 | 10 Jan 2020 |
| 719 | wellnessmanor.com | Dynadot, LLC | 7 Jun 2023 | 30 Jun 2025 | 7 Jun 2026 |
| 720 | wellnessmanager.institute | GoDaddy.com, LLC | 22 Jan 2019 | 27 Jan 2020 | 22 Jan 2021 |
| 721 | wellnessmask.com | DropCatch.com 1475 LLC | 30 Jun 2025 | 1 Jul 2025 | 30 Jun 2026 |
| 722 | wellnessmasaje.com | GoDaddy.com, LLC | 27 Jan 2019 | 27 Jan 2019 | 27 Jan 2021 |
| 723 | wellnessmarketingsecret.com | GoDaddy.com, LLC | 28 Jan 2019 | 28 Jan 2019 | 28 Jan 2020 |
| 724 | wellnessmarksol.com | GoDaddy.com, LLC | 28 Jan 2019 | 25 Jan 2026 | 28 Jan 2027 |
| 725 | wellnessmaryam.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Feb 2019 | 8 Feb 2019 | 8 Feb 2020 |
| 726 | wellnessmatrixsoup.com | GoDaddy.com, LLC | 8 Feb 2019 | 8 Feb 2019 | 8 Feb 2020 |
| 727 | wellnessmarketingwhiz.com | GoDaddy.com, LLC | 10 Feb 2019 | 10 Feb 2019 | 10 Feb 2020 |
| 728 | wellnessmalli.com | Wix.com Ltd. | 15 Feb 2019 | 15 Feb 2019 | 15 Feb 2020 |
| 729 | wellnessmaxinc.com | GoDaddy.com, LLC | 15 Feb 2019 | 15 Feb 2019 | 15 Feb 2020 |
| 730 | wellnessmarketingroadmapreviews.com | GoDaddy.com, LLC | 19 Feb 2019 | 19 Feb 2019 | 19 Feb 2020 |
| 731 | wellnessmarketingroadmap.com | GoDaddy.com, LLC | 19 Feb 2019 | 19 Feb 2019 | 19 Feb 2020 |
| 732 | wellnessmariss.com | Network Solutions, LLC | 7 Mar 2019 | 7 Mar 2019 | 7 Mar 2020 |
| 733 | wellnessmanagementassociates.com | register.com, Inc. | 11 Mar 2019 | 3 Feb 2026 | 11 Mar 2027 |
| 734 | wellnessmamafamily.club | NameCheap, Inc. | 4 Mar 2019 | 9 Mar 2019 | 4 Mar 2020 |
| 735 | wellnessmallusa.com | Tucows Domains Inc. | 15 Mar 2019 | 19 Mar 2020 | 15 Mar 2020 |
| 736 | wellnessmalaga.com | 1&1 Internet AG | 26 Jul 2022 | 26 Jul 2022 | 26 Jul 2026 |
| 737 | wellnessmacro.com | NameCheap, Inc. | 24 Mar 2019 | 24 Mar 2019 | 24 Mar 2020 |
| 738 | wellnessmarketing.solutions | CloudFlare, Inc. | 25 Mar 2019 | 25 Mar 2023 | 25 Mar 2024 |
| 739 | wellnessmassageandbodywork.com | Wild West Domains, LLC | 27 Mar 2019 | 27 Mar 2019 | 27 Mar 2020 |
| 740 | wellnessmassagepty.com | GoDaddy.com, LLC | 1 Apr 2019 | 1 Apr 2019 | 1 Apr 2020 |
| 741 | wellnessmacao.com | TurnCommerce, Inc. DBA NameBright.com | 28 Nov 2023 | 15 Mar 2025 | 28 Nov 2026 |
| 742 | wellnessmatters4unow.com | GoDaddy.com, LLC | 7 Apr 2019 | 7 Apr 2019 | 7 Apr 2020 |
| 743 | wellnessmatters2.com | GoDaddy.com, LLC | 7 Apr 2019 | 7 Apr 2019 | 7 Apr 2020 |
| 744 | wellnessmattershq.com | NameCheap, Inc. | 10 Apr 2019 | 10 Apr 2019 | 10 Apr 2020 |
| 745 | wellnessmatterscoach.com | GoDaddy.com, LLC | 14 Apr 2019 | 25 Jun 2025 | 14 Apr 2025 |
| 746 | wellnessmassageforesthills.com | Tucows Domains Inc. | 16 Apr 2019 | 31 Jan 2026 | 16 Apr 2026 |
| 747 | wellnessmamam.com | Cloud Yuqu LLC | 29 Dec 2022 | 11 Mar 2024 | 29 Dec 2023 |
| 748 | wellnessmarketingadvocates.com | 1&1 Internet AG | 23 Apr 2019 | 23 Apr 2019 | 23 Apr 2020 |
| 749 | wellnessmattersshropshire.com | 1&1 Internet AG | 3 May 2019 | 3 May 2019 | 3 May 2020 |
| 750 | wellnessmakeoverdoctor.com | GoDaddy.com, LLC | 3 May 2019 | 4 May 2025 | 3 May 2027 |
| 751 | wellnessmakeoverdr.com | GoDaddy.com, LLC | 3 May 2019 | 3 May 2019 | 3 May 2021 |
| 752 | wellnessmatters.network | Name.com, Inc. | 6 May 2019 | 6 May 2020 | 6 May 2021 |
| 753 | wellnessmatters.institute | Name.com, Inc. | 6 May 2019 | 19 Jun 2020 | 6 May 2020 |
| 754 | wellnessmatrixmall.com | Above.com Pty Ltd. | 21 May 2023 | 21 May 2023 | 21 May 2024 |
| 755 | wellnessmarie.com | Tucows Domains Inc. | 8 Jun 2019 | 9 Jun 2019 | 8 Jun 2020 |
| 756 | wellnessmattersyl.com | GoDaddy.com, LLC | 11 Jun 2019 | 11 Jun 2019 | 11 Jun 2020 |
| 757 | wellnessmattershealth.com | Tucows Domains Inc. | 22 Jun 2019 | 24 Jun 2024 | 22 Jun 2026 |
| 758 | wellnessmassage-lima.com | 1&1 Internet AG | 24 Jun 2019 | 24 Jun 2019 | 24 Jun 2026 |
| 759 | wellnessmarketingmatters.com | Google, Inc. | 26 Jun 2019 | 26 Jul 2024 | 26 Jun 2024 |
| 760 | wellnessmatterswy.com | Wild West Domains, LLC | 27 Jun 2019 | 26 Jun 2025 | 27 Jun 2026 |
| 761 | wellnessmadecollective.com | GoDaddy.com, LLC | 3 Jul 2019 | 4 Jul 2025 | 3 Jul 2026 |
| 762 | wellnessmattersbiz.com | Automattic Inc. | 4 Jul 2019 | 4 Jul 2019 | 4 Jul 2020 |
| 763 | wellnessmassagesc.com | GoDaddy.com, LLC | 9 Jul 2019 | 9 Jul 2019 | 9 Jul 2020 |
| 764 | wellnessmasteracademy.com | Network Solutions, LLC | 10 Jul 2019 | 10 Jul 2019 | 10 Jul 2020 |
| 765 | wellnessmarketinggurus.com | GoDaddy.com, LLC | 12 Jul 2019 | 12 Jul 2019 | 12 Jul 2020 |
| 766 | wellnessmall.net | Gabia, Inc. | 15 Jul 2019 | 15 Jul 2019 | 15 Jul 2020 |
| 767 | wellnessmasterminds.net | GoDaddy.com, LLC | 17 Jul 2019 | 18 Jul 2025 | 17 Jul 2026 |
| 768 | wellnessmaestro.com | GoDaddy.com, LLC | 9 Feb 2021 | 14 Feb 2025 | 9 Feb 2027 |
| 769 | wellnessmarketingfunnels.com | NameCheap, Inc. | 19 Aug 2019 | - | 19 Aug 2020 |
| 770 | wellnessmarkets.net | GoDaddy.com, LLC | 24 Aug 2019 | 24 Aug 2019 | 24 Aug 2022 |
| 771 | wellnessmaditation.com | GMO Internet Inc. | 2 Sep 2019 | 21 Aug 2025 | 2 Sep 2026 |
| 772 | wellnessmassageclinic.com | Squarespace Domains LLC | 10 Feb 2026 | 10 Feb 2026 | 10 Feb 2027 |
| 773 | wellnessmarch.com | GoDaddy.com, LLC | 8 Sep 2019 | 9 Sep 2025 | 8 Sep 2027 |
| 774 | wellnessmaximus.com | Dynadot, LLC | 2 Dec 2025 | 8 Dec 2025 | 2 Dec 2026 |
| 775 | wellnessmarket.ca | - | 8 Dec 2017 | 9 Dec 2024 | 8 Dec 2026 |
| 776 | wellnessmaxxnow.com | NameCheap, Inc. | 7 Oct 2019 | - | 7 Oct 2020 |
| 777 | wellnessmanner.com | NameCheap, Inc. | 16 Jul 2024 | 27 Aug 2025 | 16 Jul 2025 |
| 778 | wellnessmassagewa.club | GoDaddy.com, LLC | 16 Oct 2019 | 16 Oct 2019 | 16 Oct 2020 |
| 779 | wellnessmasterymethod.com | GoDaddy.com, LLC | 22 Oct 2019 | 22 Oct 2019 | 22 Oct 2021 |
| 780 | wellnessmarketing.co | GoDaddy.com, LLC | 9 Apr 2018 | 15 Apr 2025 | 9 Apr 2026 |
| 781 | wellnessmamapro.com | Wix.com Ltd. | 5 Nov 2019 | 5 Nov 2019 | 5 Nov 2020 |
| 782 | wellnessmarg.com | GoDaddy.com, LLC | 6 Nov 2019 | 6 Nov 2019 | 6 Nov 2020 |
| 783 | wellnessmarketing.agency | NameCheap, Inc. | 18 Nov 2019 | 19 Oct 2025 | - |
| 784 | wellnessmarketingexi.com | Hosting Concepts B.V. dba Openprovider | 3 Dec 2019 | 3 Dec 2019 | 3 Dec 2020 |
| 785 | wellnessmatters.pro | EvoPlus Ltd. | 4 Dec 2019 | 2 Feb 2020 | 4 Dec 2020 |
| 786 | wellnessmasteryfortheaveragejoe.com | GoDaddy.com, LLC | 5 Dec 2019 | 5 Dec 2019 | 5 Dec 2020 |
| 787 | wellnessmassageshiatsu.com | GoDaddy.com, LLC | 4 Dec 2019 | 4 Dec 2019 | 4 Dec 2020 |
| 788 | wellnessmarketsystems.com | MidWestDomains, LLC | 4 Mar 2021 | 4 Mar 2021 | 4 Mar 2022 |
| 789 | wellnessmamaproject.com | Tucows Domains Inc. | 21 Dec 2019 | 20 Dec 2025 | 21 Dec 2026 |
| 790 | wellnessmagician.com | Google, Inc. | 27 Dec 2019 | 27 Dec 2019 | 27 Dec 2020 |
| 791 | wellnessmamaclub.com | NameCheap, Inc. | 28 Dec 2019 | - | 28 Dec 2020 |
| 792 | wellnessmacau.com | GMO Internet Inc. | 8 Jan 2020 | 8 Jan 2020 | 8 Jan 2021 |
| 793 | wellnessmaldives.com | Dynadot, LLC | 15 Jan 2020 | 10 Nov 2025 | 15 Jan 2027 |
| 794 | wellnessmakesyouwhole.com | eNom, Inc. | 17 Jan 2020 | 17 Jan 2020 | 17 Jan 2021 |
| 795 | wellnessmarketing-unlimited.com | GoDaddy.com, LLC | 31 Jan 2020 | 31 Jan 2020 | 31 Jan 2021 |
| 796 | wellnessmakessense.com | - | 20 Apr 2025 | 3 Mar 2026 | 20 Apr 2026 |
| 797 | wellnessmarketcr.com | Launchpad, Inc. | 31 Jan 2020 | 31 Jan 2020 | 31 Jan 2021 |
| 798 | wellnessmassagehome.com | Squarespace Domains LLC | 7 Feb 2020 | 23 Jan 2026 | 7 Feb 2027 |
| 799 | wellnessmasks.com | GoDaddy.com, LLC | 11 Feb 2020 | 11 Feb 2020 | 11 Feb 2021 |
| 800 | wellnessmastercourse.net | GoDaddy.com, LLC | 20 Feb 2020 | 20 Feb 2026 | 20 Feb 2027 |
| 801 | wellnessmastercourse.com | GoDaddy.com, LLC | 20 Feb 2020 | 20 Feb 2026 | 20 Feb 2027 |
| 802 | wellnessmarketingmag.com | Tucows Domains Inc. | 20 Feb 2020 | 24 Feb 2026 | 20 Feb 2027 |
| 803 | wellnessmarketermag.com | Domaingazelle.com LLC | 10 May 2025 | 13 May 2025 | 10 May 2026 |
| 804 | wellnessmassagekoeln.de | - | - | 9 May 2018 | - |
| 805 | wellnessmake.com | NameCheap, Inc. | 6 Dec 2025 | 6 Jan 2026 | 6 Dec 2026 |
| 806 | wellnessmarketingltd.com | GoDaddy.com, LLC | 28 Feb 2020 | 12 Feb 2026 | 28 Feb 2027 |
| 807 | wellnessmalin.com | Tucows Domains Inc. | 3 Mar 2020 | 7 Mar 2021 | 3 Mar 2021 |
| 808 | wellnessmafialife.com | Tucows Domains Inc. | 6 Mar 2020 | 6 Mar 2020 | 6 Mar 2021 |
| 809 | wellnessmassage-ravensburg.com | RegistryGate GmbH | 14 Mar 2020 | 24 Nov 2025 | 14 Mar 2026 |
| 810 | wellnessmadesimpleandeasy.com | GoDaddy.com, LLC | 20 Mar 2020 | 21 Mar 2025 | 20 Mar 2026 |
| 811 | wellnessmatrrixgroup.com | GoDaddy.com, LLC | 9 Apr 2020 | 9 Apr 2020 | 9 Apr 2021 |
| 812 | wellnessmarketingcr.com | GoDaddy.com, LLC | 29 Mar 2020 | 10 May 2024 | 29 Mar 2024 |
| 813 | wellnessmadeco.com | GoDaddy.com, LLC | 28 Mar 2020 | 29 Mar 2025 | 28 Mar 2026 |
| 814 | wellnessmatrixtalks.com | GoDaddy.com, LLC | 29 Mar 2020 | 29 Mar 2020 | 29 Mar 2021 |
| 815 | wellnessmason.com | GoDaddy.com, LLC | 3 Apr 2020 | 3 Apr 2020 | 3 Apr 2021 |
| 816 | wellnessmatrixgroupiq.com | GoDaddy.com, LLC | 3 Apr 2020 | 3 Apr 2020 | 3 Apr 2021 |
| 817 | wellnessmatrixiq.com | GoDaddy.com, LLC | 3 Apr 2020 | 3 Apr 2020 | 3 Apr 2021 |
| 818 | wellnessmatters-inc.com | GoDaddy.com, LLC | 6 Apr 2020 | 6 Apr 2020 | 6 Apr 2021 |
| 819 | wellnessmania.club | eNom, Inc. | 18 Apr 2020 | - | 18 Apr 2021 |
| 820 | wellnessmakerchallenge.com | Name.com, Inc. | 21 Apr 2020 | 21 Apr 2020 | 21 Apr 2021 |
| 821 | wellnessmassagen.nrw | 1&1 Internet AG | 1 May 2018 | 2 May 2018 | 1 May 2021 |
| 822 | wellnessmaverik.com | GoDaddy.com, LLC | 3 Aug 2024 | 9 Jul 2025 | 3 Aug 2026 |
| 823 | wellnessmatters.biz | GoDaddy.com, LLC | 12 Dec 2017 | 10 Dec 2025 | 12 Dec 2026 |
| 824 | wellnessmagichk.com | eNom, Inc. | 4 May 2020 | 4 May 2020 | 4 May 2021 |
| 825 | wellnessmattersbyala.com | GoDaddy.com, LLC | 9 May 2020 | 10 May 2024 | 9 May 2026 |
| 826 | wellnessmagik.com | GoDaddy.com, LLC | 13 May 2020 | 13 May 2020 | 13 May 2021 |
| 827 | wellnessmag.club | NameCheap, Inc. | 8 May 2020 | 13 May 2020 | 8 May 2021 |
| 828 | wellnessmasterminded.com | Melbourne IT, Ltd | 19 May 2020 | 19 May 2020 | 19 May 2021 |
| 829 | wellnessmakesmoney.net | GoDaddy.com, LLC | 24 May 2018 | 8 May 2019 | 24 May 2020 |
| 830 | wellnessmanifesting.com | GoDaddy.com, LLC | 7 Jun 2020 | 7 Jun 2020 | 7 Jun 2021 |
| 831 | wellnessmalls.com | GoDaddy.com, LLC | 24 Jan 2025 | 27 Jan 2026 | 24 Jan 2028 |
| 832 | wellnessmadehome.com | GoDaddy.com, LLC | 20 Jun 2020 | 21 Jun 2025 | 20 Jun 2026 |
| 833 | wellnessmassage.website | 1&1 Internet AG | 12 Sep 2022 | 11 Nov 2025 | 12 Sep 2026 |
| 834 | wellnessmagazine.space | NameCheap, Inc. | 3 Jul 2020 | 3 Jul 2020 | 3 Jul 2021 |
| 835 | wellnessmatters.asia | GoDaddy.com, LLC | 6 Jul 2020 | 20 Aug 2025 | 6 Jul 2026 |
| 836 | wellnessmatts.com | GoDaddy.com, LLC | 15 Jun 2020 | 27 Aug 2023 | 15 Jun 2023 |
| 837 | wellnessmasculino.com | GoDaddy.com, LLC | 16 Jun 2020 | 16 Jun 2020 | 16 Jun 2021 |
| 838 | wellnessmamanewsletter.com | Tucows Domains Inc. | 12 Jul 2020 | 11 Jul 2025 | 12 Jul 2026 |
| 839 | wellnessmastership.com | TurnCommerce, Inc. DBA NameBright.com | 15 Jul 2020 | 25 Aug 2025 | 15 Jul 2025 |
| 840 | wellnessmarketinghacks.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jul 2020 | 15 Jul 2020 | 15 Jul 2021 |
| 841 | wellnessmaven.online | GoDaddy.com, LLC | 23 Jul 2020 | 23 Jul 2020 | 23 Jul 2021 |
| 842 | wellnessmaven.info | GoDaddy.com, LLC | 23 Jul 2020 | 23 Jul 2020 | 23 Jul 2021 |
| 843 | wellnessmaven.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Jul 2023 | 7 Jul 2024 | 7 Jul 2025 |
| 844 | wellnessmassageal.club | NameCheap, Inc. | 29 Jul 2020 | 29 Jul 2020 | 29 Jul 2021 |
| 845 | wellnessmassedeluxewuppertal.com | PSI-USA, Inc. dba Domain Robot | 2 Aug 2020 | 20 Nov 2024 | 2 Aug 2025 |
| 846 | wellnessmatchinc.com | Tucows Domains Inc. | 4 Aug 2020 | 8 Aug 2021 | 4 Aug 2021 |
| 847 | wellnessmastershub.com | Domaingazelle.com LLC | 23 Oct 2023 | 6 Dec 2024 | 23 Oct 2024 |
| 848 | wellnessmastershub.info | eNom, Inc. | 5 Aug 2020 | 6 Aug 2023 | 5 Aug 2024 |
| 849 | wellnessmastershub.net | eNom, Inc. | 5 Aug 2020 | 17 Oct 2023 | 5 Aug 2023 |
| 850 | wellnessmatters33.com | GoDaddy.com, LLC | 16 Aug 2020 | 16 Aug 2020 | 16 Aug 2021 |
| 851 | wellnessmatterscoaching.com | Google, Inc. | 28 Aug 2020 | 14 Aug 2025 | 28 Aug 2026 |
| 852 | wellnessmallnepal.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Nov 2022 | 19 Dec 2024 | 17 Nov 2024 |
| 853 | wellnessmadeinitaly.com | Tucows Domains Inc. | 31 Aug 2020 | 11 Nov 2024 | 31 Aug 2024 |
| 854 | wellnessmastercourse.info | GoDaddy.com, LLC | 20 Feb 2020 | 21 Feb 2026 | 20 Feb 2027 |
| 855 | wellnessmarketingcoaching.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Sep 2020 | 23 Sep 2020 | 23 Sep 2021 |
| 856 | wellnessmanagementteam.com | GoDaddy.com, LLC | 24 Sep 2020 | 25 Sep 2024 | 24 Sep 2026 |
| 857 | wellnessmassagen-at-home.com | Cronon AG | 26 Sep 2020 | 26 Nov 2023 | 26 Sep 2023 |
| 858 | wellnessmatters.today | Google, Inc. | 11 Jan 2023 | 11 Jan 2024 | 11 Jan 2025 |
| 859 | wellnessmax.net | Uniregistrar Corp | 3 Oct 2020 | 4 Oct 2025 | 3 Oct 2026 |
| 860 | wellnessmasterycoach.com | GoDaddy.com, LLC | 5 Oct 2020 | 5 Oct 2020 | 5 Oct 2021 |
| 861 | wellnessmasterycoaching.com | GoDaddy.com, LLC | 5 Oct 2020 | 5 Oct 2020 | 5 Oct 2021 |
| 862 | wellnessmagic.net | LiquidNet Ltd. | 6 Oct 2020 | 6 Oct 2020 | 6 Oct 2021 |
| 863 | wellnessmania.xyz | NameCheap, Inc. | 7 Oct 2020 | 7 Oct 2020 | 7 Oct 2021 |
| 864 | wellnessmarketcleanse.com | NameCheap, Inc. | 11 Oct 2020 | 11 Sep 2022 | 11 Oct 2023 |
| 865 | wellnessmasterfl.com | Network Solutions, LLC | 12 Oct 2020 | 25 Dec 2023 | 12 Oct 2023 |
| 866 | wellnessmarket.site | Hostinger, UAB | 10 Feb 2024 | 26 Mar 2025 | 10 Feb 2025 |
| 867 | wellnessmarket-testo.com | NameCheap, Inc. | 20 Oct 2020 | 20 Sep 2022 | 20 Oct 2023 |
| 868 | wellnessmarketstoremuscle.com | NameCheap, Inc. | 20 Oct 2020 | 20 Sep 2022 | 20 Oct 2023 |
| 869 | wellnessmarketstoretesto.com | NameCheap, Inc. | 20 Oct 2020 | 20 Sep 2022 | 20 Oct 2023 |
| 870 | wellnessmadeez.com | Tucows Domains Inc. | 22 Dec 2023 | 1 Feb 2026 | 22 Dec 2025 |
| 871 | wellnessmagnified.com | NameCheap, Inc. | 25 Jan 2025 | 26 Dec 2025 | 25 Jan 2027 |
| 872 | wellnessmanagementservices.net | GoDaddy.com, LLC | 27 Oct 2020 | 7 Jan 2024 | 27 Oct 2023 |
| 873 | wellnessmavenblog.com | GoDaddy.com, LLC | 28 Oct 2020 | 28 Oct 2020 | 28 Oct 2021 |
| 874 | wellnessmatterscounselling.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Nov 2020 | 5 Nov 2025 | 9 Nov 2026 |
| 875 | wellnessmadesimplewv.com | GoDaddy.com, LLC | 9 Nov 2020 | 9 Nov 2025 | 9 Nov 2026 |
| 876 | wellnessmarketingconsultants.com | GoDaddy.com, LLC | 13 Nov 2020 | 13 Nov 2020 | 13 Nov 2021 |
| 877 | wellnessmassage-harz.net | Deutsche Telekom AG | 30 Nov 2020 | 2 Nov 2025 | 30 Nov 2026 |
| 878 | wellnessmartnetwork.com | GoDaddy.com, LLC | 5 Dec 2020 | 5 Dec 2020 | 5 Dec 2022 |
| 879 | wellnessmagic1.com | NameCheap, Inc. | 12 Dec 2020 | - | 12 Dec 2021 |
| 880 | wellnessmagic2.com | NameCheap, Inc. | 12 Dec 2020 | - | 12 Dec 2021 |
| 881 | wellnessmart-bd.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Dec 2020 | 16 Dec 2020 | 16 Dec 2021 |
| 882 | wellnessmagazine.site | NameCheap, Inc. | 8 May 2020 | 21 Jun 2020 | 8 May 2021 |
| 883 | wellnessmarket.xyz | GMO Internet Inc. | 26 Feb 2026 | 3 Mar 2026 | 26 Feb 2027 |
| 884 | wellnessmantrabygunjan.com | FastDomain Inc. | 18 Dec 2020 | 1 Mar 2024 | 18 Dec 2023 |
| 885 | wellnessmarketer.site | Network Solutions, LLC | 21 Dec 2020 | 21 Dec 2020 | 21 Dec 2021 |
| 886 | wellnessmadesimple.info | GoDaddy.com, LLC | 24 Dec 2020 | 27 Dec 2025 | 24 Dec 2026 |
| 887 | wellnessmatters.xyz | - | 6 Apr 2022 | 20 Apr 2022 | 6 Apr 2024 |
| 888 | wellnessmatters.club | GoDaddy.com, LLC | 16 Jan 2021 | 16 Jan 2021 | 16 Jan 2022 |
| 889 | wellnessmasteryguild.com | NameCheap, Inc. | 17 Jan 2021 | 30 Mar 2024 | 17 Jan 2024 |
| 890 | wellnessmadesimple.club | GoDaddy.com, LLC | 25 Apr 2025 | 22 Oct 2025 | 25 Apr 2026 |
| 891 | wellnessmatters-shop.com | Launchpad, Inc. | 23 Jan 2021 | 23 Jan 2021 | 23 Jan 2022 |
| 892 | wellnessmaids.com | GoDaddy.com, LLC | 27 Jan 2021 | 21 Sep 2025 | 27 Jan 2027 |
| 893 | wellnessmamas1.com | GoDaddy.com, LLC | 27 Jan 2021 | 10 Mar 2025 | 27 Jan 2025 |
| 894 | wellnessmassage-kosmetik-imfrechnhaus.de | - | - | 24 Jul 2008 | - |
| 895 | wellnessmallorcafestival.com | GoDaddy.com, LLC | 29 Jan 2021 | 11 Apr 2024 | 29 Jan 2024 |
| 896 | wellnessmail.xyz | NameCheap, Inc. | 2 Feb 2021 | 2 Feb 2021 | 2 Feb 2022 |
| 897 | wellnessmainstay.com | NameCheap, Inc. | 3 Feb 2021 | - | 3 Feb 2022 |
| 898 | wellnessmarketing.club | Webnames.ca Inc. | 11 Feb 2021 | 6 Feb 2025 | 11 Feb 2025 |
| 899 | wellnessmadesimply.com | GoDaddy.com, LLC | 19 Feb 2021 | 2 May 2024 | 19 Feb 2024 |
| 900 | wellnessmall.asia | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Feb 2021 | 28 Mar 2023 | 23 Feb 2027 |
| 901 | wellnessmanagementnetwork.com | Google, Inc. | 10 Mar 2021 | 10 May 2023 | 10 Mar 2023 |
| 902 | wellnessmasterclasses.com | GoDaddy.com, LLC | 12 Mar 2021 | 13 Mar 2025 | 12 Mar 2027 |
| 903 | wellnessmale-shop.com | NameCheap, Inc. | 17 Mar 2021 | 29 May 2024 | 17 Mar 2024 |
| 904 | wellnessmakar.com | GoDaddy.com, LLC | 17 Mar 2021 | 28 Apr 2025 | 17 Mar 2025 |
| 905 | wellnessmajor.com | GoDaddy.com, LLC | 27 Mar 2021 | 10 Nov 2025 | 27 Mar 2027 |
| 906 | wellnessmasseuse.com | Dynadot, LLC | 31 Mar 2021 | 31 Mar 2021 | 31 Mar 2022 |
| 907 | wellnessmarketing.site | GoDaddy.com, LLC | 9 Jul 2024 | 20 Aug 2025 | 9 Jul 2025 |
| 908 | wellnessmarket.online | Hostinger, UAB | 28 Jan 2026 | 28 Jan 2026 | 28 Jan 2027 |
| 909 | wellnessmassagen-mit-edelsteinen.com | PSI-USA, Inc. dba Domain Robot | 12 Apr 2021 | 1 Jun 2025 | 12 Apr 2026 |
| 910 | wellnessmartvillage.com | GoDaddy.com, LLC | 20 Apr 2021 | 2 Jul 2023 | 20 Apr 2023 |
| 911 | wellnessmadesimple.online | GoDaddy.com, LLC | 1 May 2021 | 29 Jul 2025 | 1 May 2026 |
| 912 | wellnessmassagefreiburg.com | RegistryGate GmbH | 7 May 2021 | 6 Jun 2023 | 7 May 2023 |
| 913 | wellnessmall.site | Crazy Domains FZ-LLC | 18 May 2021 | 18 May 2021 | 18 May 2022 |
| 914 | wellnessmatters4you.com | Media Elite Holdings Limited | 18 May 2021 | 18 May 2021 | 18 May 2022 |
| 915 | wellnessmassagemeunchen.com | Cronon AG | 19 May 2021 | 8 Jul 2025 | 19 May 2026 |
| 916 | wellnessmanufaktur.de | - | - | 4 Sep 2018 | - |
| 917 | wellnessmasajes.com | Arsys Internet, S.L. dba NICLINE.COM | 27 May 2021 | 27 May 2021 | 27 May 2022 |
| 918 | wellnessmates.net | Tucows Domains Inc. | 7 Aug 2024 | 17 Sep 2025 | 7 Aug 2025 |
| 919 | wellnessmassagemuenchen.com | Cronon AG | 5 Jun 2021 | 25 Jul 2025 | 5 Jun 2026 |
| 920 | wellnessmagssagemuenchen.com | Cronon AG | 5 Jun 2021 | 25 Jul 2025 | 5 Jun 2026 |
| 921 | wellnessmadecommon.com | Google, Inc. | 18 Jun 2021 | 18 Aug 2024 | 18 Jun 2024 |
| 922 | wellnessmartindia.com | GoDaddy.com, LLC | 18 Jun 2021 | 18 Jun 2021 | 18 Jun 2022 |
| 923 | wellnessmassagetherapy.ca | - | 22 May 2021 | 23 May 2025 | 22 May 2027 |
| 924 | wellnessmanagementtips.com | 1API GmbH | 20 Jun 2021 | 20 Jun 2021 | 20 Jun 2022 |
| 925 | wellnessmapa.online | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 28 Jun 2021 | 28 Jun 2021 | 28 Jun 2022 |
| 926 | wellnessmain.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Sep 2024 | 25 Sep 2025 | 27 Sep 2026 |
| 927 | wellnessmatakana.com | 1API GmbH | 9 Jul 2021 | 22 Aug 2024 | 9 Jul 2024 |
| 928 | wellnessmade101.com | Tucows Domains Inc. | 11 Jul 2021 | 15 Jul 2022 | 11 Jul 2022 |
| 929 | wellnessmarina.com | Tucows Domains Inc. | 17 Jul 2021 | 27 Aug 2025 | 17 Jul 2025 |
| 930 | wellnessmattersng.com | NameCheap, Inc. | 20 Jul 2021 | - | 20 Jul 2022 |
| 931 | wellnessmassagemichaela.com | Cronon AG | 26 Jul 2021 | 26 Jul 2024 | 26 Jul 2024 |
| 932 | wellnessmassage.xyz | - | 15 Oct 2022 | 29 Dec 2023 | 15 Oct 2023 |
| 933 | wellnessmassage.fitness | Tucows Domains Inc. | 28 Jul 2021 | 19 Jul 2024 | - |
| 934 | wellnessmappingtest.com | GoDaddy.com, LLC | 31 Jul 2021 | 11 Sep 2024 | 31 Jul 2024 |
| 935 | wellnessmarketingteam.com | NameCheap, Inc. | 12 Aug 2021 | 13 Jul 2023 | 12 Aug 2024 |
| 936 | wellnessmasteryinstitute.com | GoDaddy.com, LLC | 14 Aug 2021 | 25 Sep 2023 | 14 Aug 2023 |
| 937 | wellnessmasteryacademy.com | GoDaddy.com, LLC | 14 Aug 2021 | 25 Sep 2023 | 14 Aug 2023 |
| 938 | wellnessmatters.site | GoDaddy.com, LLC | 18 Aug 2021 | 18 Aug 2021 | 18 Aug 2022 |
| 939 | wellnessmadesimple.us | GoDaddy.com, LLC | 22 Apr 2021 | 28 Apr 2025 | 22 Apr 2026 |
| 940 | wellnessmarket-online.com | Limited Liability Company "Registrar of domain nam… | 26 Aug 2021 | 26 Aug 2021 | 26 Aug 2022 |
| 941 | wellnessmarketingnm.com | Launchpad, Inc. | 3 Sep 2021 | 3 Sep 2021 | 3 Sep 2022 |
| 942 | wellnessmatchmaker.club | NameCheap, Inc. | 7 Sep 2021 | - | 7 Sep 2022 |
| 943 | wellnessmatch.club | NameCheap, Inc. | 7 Sep 2021 | - | 7 Sep 2022 |
| 944 | wellnessmatcher.club | NameCheap, Inc. | 7 Sep 2021 | - | 7 Sep 2022 |
| 945 | wellnessmatcher.com | NameCheap, Inc. | 13 May 2025 | 13 May 2025 | 13 May 2026 |
| 946 | wellnessmamacbd.com | GoDaddy.com, LLC | 10 Sep 2021 | 10 Sep 2021 | 10 Sep 2022 |
| 947 | wellnessmanhattan.com | GoDaddy.com, LLC | 12 Sep 2021 | 24 Nov 2023 | 12 Sep 2023 |
| 948 | wellnessmassage-berlin.com | RegistryGate GmbH | 15 Sep 2021 | 15 Sep 2021 | 15 Sep 2022 |
| 949 | wellnessmassagelexington.com | GoDaddy.com, LLC | 16 Sep 2021 | 27 Nov 2025 | 16 Sep 2025 |
| 950 | wellnessmanual.info | Google, Inc. | 23 Sep 2021 | 23 Sep 2021 | 23 Sep 2022 |
| 951 | wellnessmarvels.com | NameCheap, Inc. | 7 Oct 2021 | 19 Dec 2023 | 7 Oct 2023 |
| 952 | wellnessmarketingfestival.com | Tucows Domains Inc. | 11 Oct 2021 | 26 Sep 2025 | 11 Oct 2026 |
| 953 | wellnessmart.xyz | GoDaddy.com, LLC | 18 Oct 2021 | 19 Oct 2021 | 18 Oct 2022 |
| 954 | wellnessmanuals.com | Key-Systems GmbH | 31 Jan 2023 | 14 Mar 2024 | 31 Jan 2024 |
| 955 | wellnessmains.com | Launchpad, Inc. | 22 Oct 2021 | 22 Oct 2021 | 22 Oct 2022 |
| 956 | wellnessmanthra.online | GoDaddy.com, LLC | 1 Nov 2021 | 12 Jan 2026 | 1 Nov 2025 |
| 957 | wellnessmandra.online | GoDaddy.com, LLC | 1 Nov 2021 | 12 Jan 2026 | 1 Nov 2025 |
| 958 | wellnessmarketinc.com | GoDaddy.com, LLC | 8 Nov 2021 | 9 Nov 2024 | 8 Nov 2027 |
| 959 | wellnessmag.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Dec 2021 | 9 Dec 2021 | 9 Dec 2022 |
| 960 | wellnessmamma.com | Dynadot, LLC | 12 Dec 2021 | 12 Dec 2025 | 12 Dec 2026 |
| 961 | wellnessmarketingmedia.com | Cosmotown, Inc. | 29 May 2023 | 8 Aug 2024 | 29 May 2024 |
| 962 | wellnessmap.co | GoDaddy.com, LLC | 4 Aug 2021 | 10 Aug 2025 | 4 Aug 2026 |
| 963 | wellnessmastery4life.com | Google, Inc. | 31 Dec 2021 | 16 Dec 2025 | 31 Dec 2026 |
| 964 | wellnessmassage.club | Automattic Inc. | 4 Jan 2022 | 20 Dec 2022 | 4 Jan 2024 |
| 965 | wellnessmasale.com | NameCheap, Inc. | 2 Feb 2022 | 2 Feb 2026 | 2 Feb 2027 |
| 966 | wellnessmarketcolombia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Feb 2022 | 30 Apr 2023 | 17 Feb 2023 |
| 967 | wellnessmastermind.com | Dynadot, LLC | 14 May 2025 | 18 Feb 2026 | 14 May 2027 |
| 968 | wellnessmassagetherapyandspa.com | - | 20 May 2025 | 23 Jan 2026 | 20 May 2026 |
| 969 | wellnessmarketing.store | Key-Systems, LLC | 29 Jul 2024 | 11 Oct 2025 | 29 Jul 2025 |
| 970 | wellnessmaniacs.com | NameCheap, Inc. | 12 Mar 2022 | 23 May 2023 | 12 Mar 2023 |
| 971 | wellnessmassage-mobil.com | Cronon AG | 19 Mar 2022 | 20 Mar 2025 | 19 Mar 2026 |
| 972 | wellnessmatters.care | GoDaddy.com, LLC | 22 Mar 2022 | 5 Sep 2024 | 22 Mar 2027 |
| 973 | wellnessmax.xyz | GoDaddy.com, LLC | 22 Mar 2022 | 3 Apr 2023 | 22 Mar 2024 |
| 974 | wellnessmat.pro | GoDaddy.com, LLC | 24 Mar 2022 | 8 May 2025 | 24 Mar 2026 |
| 975 | wellnessmatpro.com | GoDaddy.com, LLC | 24 Mar 2022 | 25 Mar 2025 | 24 Mar 2026 |
| 976 | wellnessmattspro.com | GoDaddy.com, LLC | 24 Mar 2022 | 25 Mar 2025 | 24 Mar 2026 |
| 977 | wellnessmatpro.store | GoDaddy.com, LLC | 25 Mar 2022 | 24 Jun 2025 | 25 Mar 2026 |
| 978 | wellnessmatshop.com | GoDaddy.com, LLC | 25 Mar 2022 | 26 Mar 2025 | 25 Mar 2026 |
| 979 | wellnessmatpro.biz | GoDaddy.com, LLC | 25 Mar 2022 | 23 Oct 2025 | 25 Mar 2026 |
| 980 | wellnessmarkettoday.com | Google, Inc. | 10 Dec 2024 | 25 Nov 2025 | 10 Dec 2026 |
| 981 | wellnessmarketermia.com | FastDomain Inc. | 1 Apr 2022 | 4 May 2023 | 1 Apr 2023 |
| 982 | wellnessmatpro.us | GoDaddy.com, LLC | 24 Mar 2022 | 30 Mar 2025 | 24 Mar 2026 |
| 983 | wellnessmall.xyz | NameCheap, Inc. | 13 Apr 2022 | 28 Apr 2023 | 13 Apr 2024 |
| 984 | wellnessmatterstoday.net | 1API GmbH | 21 Apr 2022 | 4 Jun 2023 | 21 Apr 2023 |
| 985 | wellnessmansion.com | ReclaimDomains LLC | 6 Apr 2025 | 14 Apr 2025 | 6 Apr 2026 |
| 986 | wellnessmatters.store | Hostinger, UAB | 24 Jun 2025 | 29 Jun 2025 | 24 Jun 2026 |
| 987 | wellnessmarketingco.info | Google, Inc. | 26 Apr 2022 | 7 Jun 2025 | 26 Apr 2025 |
| 988 | wellnessmaster.tel | Arsys Internet, S.L. dba NICLINE.COM | 2 May 2022 | 7 May 2023 | 2 May 2023 |
| 989 | wellnessmanny.com | Google, Inc. | 2 May 2022 | 17 Apr 2025 | 2 May 2026 |
| 990 | wellnessmadebasic.com | eNom, Inc. | 2 May 2022 | 14 Jun 2024 | 2 May 2024 |
| 991 | wellnessmassagetherapists.com | GoDaddy.com, LLC | 6 May 2022 | 18 Jul 2024 | 6 May 2024 |
| 992 | wellnessmahotsav.com | GoDaddy.com, LLC | 7 May 2022 | 10 Aug 2024 | 7 May 2027 |
| 993 | wellnessmap.coach | Google, Inc. | 12 May 2022 | 23 Jun 2025 | 12 May 2025 |
| 994 | wellnessmarketing.xyz | Dynadot, LLC | 13 May 2022 | 14 May 2023 | 13 May 2024 |
| 995 | wellnessmarketingsolution.com | Name.com, Inc. | 18 May 2022 | 31 Jul 2024 | 18 May 2024 |
| 996 | wellnessmassage-hk.com | Shanghai Meicheng Technology Information Co., Ltd | 19 May 2022 | 21 Jul 2023 | 19 May 2023 |
| 997 | wellnessmadesimple.life | GoDaddy.com, LLC | 23 May 2022 | 23 May 2023 | 23 May 2024 |
| 998 | wellnessmaison.com | Netowl, Inc. | 23 May 2022 | 20 Apr 2025 | 23 May 2026 |
| 999 | wellnessmallng.xyz | Limited Liability Company "Registrar of domain nam… | 12 Aug 2023 | 20 Sep 2024 | 12 Aug 2024 |
| 1000 | wellnessmartialarts.online | Network Solutions, LLC | 28 May 2022 | 9 Aug 2023 | 28 May 2023 |
Displaying 1,000 out of 1,757 domains starting with the keyword "WELLNESSMA". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=wellnessma
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |