Our database now contains whois records of 673 Million (673,279,094) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [673 Million Domains] $10,000 Details

Keyword: WAF

Reverse Whois » KEYWORD [waf ]  { 30,656 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1waf.it-29 Jan 199626 Jan 202610 Jan 2027
2waf.usGoDaddy.com, LLC28 Jul 201419 Jun 202527 Jul 2026
3waf.netNamesilo, LLC6 Mar 200030 Dec 20246 Mar 2033
4waf.coGoDaddy.com, LLC21 Jul 20109 Jul 202520 Jul 2026
5waf.asiaP.A. Viet Nam Company Limited20 Apr 202519 May 202520 Apr 2026
6waf.wangDNSPod, Inc.9 Nov 202010 Sep 20249 Nov 2026
7waf.systemsNameCheap, Inc.27 Feb 202028 Jan 2025-
8waf.tokyoGMO Internet Inc.22 Jul 20145 Feb 2026-
9waf.xyzGoDaddy.com, LLC15 Jun 201924 Sep 202515 Jun 2026
10waf.foundationGoDaddy.com, LLC12 Jan 20241 Sep 202412 Jan 2029
11waf.todayGoDaddy.com, LLC26 Aug 202531 Aug 202526 Aug 2026
12waf.expertGoDaddy.com, LLC12 Aug 202224 Aug 202312 Aug 2024
13waf.scienceAlpnames Limited5 Mar 20157 Mar 20154 Mar 2016
14waf.partyNameCheap, Inc.4 Oct 20179 Oct 20174 Oct 2022
15waf.websiteTucows Domains Inc.15 May 201525 Jun 202415 May 2024
16waf.pubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…26 May 201522 May 202526 May 2026
17waf.worksName.com, Inc.18 Jul 201516 Jul 202418 Jul 2025
18waf.linkOVH sas28 May 20196 May 202528 May 2026
19waf.onePorkbun, LLC1 Sep 202415 Oct 20251 Sep 2026
20waf.blueGandi SAS18 Aug 201518 Aug 201518 Aug 2016
21waf.redDNSPod, Inc.28 Dec 2018-28 Dec 2025
22waf.mobi-26 Jul 202526 Jul 2025-
23waf.winChengdu West Dimension Digital Technology Co., Ltd…24 Sep 201527 Aug 201623 Sep 2017
24waf.orgNetwork Solutions, LLC18 Nov 199721 Aug 202417 Nov 2026
25waf.comDomainRegistry.com, Inc.24 Jan 19993 Jan 202524 Jan 2027
26waf.renChengdu West Dimension Digital Technology Co., Ltd…5 Nov 2015-5 Nov 2016
27waf.xinAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…3 Dec 20248 Dec 20243 Dec 2026
28waf.bidChengdu West Dimension Digital Technology Co., Ltd…9 Nov 20154 Feb 20178 Nov 2017
29waf.siteChengdu West Dimension Digital Technology Co., Ltd…11 Nov 201526 Aug 201711 Nov 2017
30waf.dateChengdu West Dimension Digital Technology Co., Ltd…11 Nov 2015-10 Nov 2016
31waf.loanAlpnames Limited6 Jan 2016-5 Jan 2017
32waf.lolNameCheap, Inc.2 Oct 20241 Nov 20252 Oct 2026
33waf.world1API GmbH28 Jan 201627 Jan 202628 Jan 2027
34waf.kimGoDaddy.com, LLC29 Apr 202310 Jun 202429 Apr 2024
35waf.techWest263 International Limited21 Apr 201721 Apr 201721 Apr 2018
36waf.onlineWest263 International Limited23 Apr 201828 Apr 201823 Apr 2019
37waf.pinkWest263 International Limited29 Feb 2016-28 Feb 2017
38waf.blackWest263 International Limited29 Feb 2016-28 Feb 2017
39waf.cloudNom-iq Ltd. dba COM LAUDE11 Feb 20169 Feb 202611 Feb 2027
40waf.dogPorkbun, LLC27 Jun 201626 Jun 202527 Jun 2026
41waf.companyNetwork Solutions, LLC30 Nov 20156 Jan 201730 Nov 2017
42waf.sexyNameCheap, Inc.1 Apr 201414 Aug 20241 Apr 2028
43waf.bayernunited-domains AG30 Sep 201411 Dec 202530 Sep 2026
44waf.bizAscio Technologies, Inc. Danmark - Filial af Ascio…24 Jan 200224 Oct 202523 Jan 2027
45waf.digitalPSI-USA, Inc. dba Domain Robot19 Sep 20163 Nov 202519 Sep 2026
46waf.rocksPSI-USA, Inc. dba Domain Robot10 Jan 202210 Jan 202610 Jan 2027
47waf.infoPorkbun, LLC9 Mar 201817 Apr 20259 Mar 2026
48waf.bzPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 201219 Dec 20254 Nov 2026
49waf.berlinPSI-USA, Inc. dba Domain Robot21 Mar 201427 Apr 202021 Mar 2026
50waf.club1&1 Internet AG7 May 201428 Jun 20176 May 2018
51waf.fr-1 Jul 202231 Aug 20254 Jul 2026
52waf.pl-24 Jan 20106 May 2025-
53waf.li----
54waf.menAlpnames Limited28 Mar 20182 Apr 201828 Mar 2019
55waf.guruBigRock Solutions Ltd.15 May 202516 Jul 2025-
56waf.spaceAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 Dec 201622 Dec 201622 Dec 2017
57waf.saleeNom, Inc.16 Mar 20179 Oct 201716 Mar 2018
58waf.storeeNom, Inc.16 Mar 2017-16 Mar 2018
59waf.lifeCommuniGal Communication Ltd.30 Aug 20254 Sep 202530 Aug 2026
60waf.designGoDaddy.com, LLC29 Jan 202510 Feb 202629 Jan 2026
61waf.com.cn-14 Aug 2012-14 Aug 2017
62waf.churchGoDaddy.com, LLC8 Aug 20178 Aug 20178 Aug 2018
63waf.ninjaPorkbun, LLC30 Aug 201726 Aug 202530 Aug 2026
64waf.agencyGoDaddy.com, LLC12 Jul 202417 Oct 202512 Jul 2027
65waf.co.uk-9 Feb 200428 Feb 20259 Feb 2026
66waf.org.uk-18 Feb 201819 Jan 202518 Feb 2026
67waf.inkChengdu West Dimension Digital Technology Co., Ltd…5 Jun 202420 Oct 20255 Jun 2026
68waf.networkNameCheap, Inc.26 Aug 20227 Oct 202426 Aug 2024
69waf.landNameCheap, Inc.21 Apr 20232 Jun 202421 Apr 2024
70waf.industries1&1 Internet AG23 Jul 20181 Sep 202523 Jul 2025
71waf.cityName.com, Inc.30 Jul 201825 Sep 201830 Jul 2020
72waf.groupPorkbun, LLC19 Jun 202320 May 202519 Jun 2026
73waf.tipsNameCheap, Inc.15 Oct 201815 Oct 201815 Oct 2019
74waf.gmbhTucows Domains Inc.16 Oct 201815 Oct 2025-
75waf.be-20 Jan 2000--
76waf.devNameCheap, Inc.12 Jun 202413 May 2025-
77waf.zoneCloudFlare, Inc.6 May 202311 May 20236 May 2033
78waf.services10dencehispahard, S.L.14 Aug 20229 Apr 202514 Aug 2025
79waf.cymru1&1 Internet AG15 Nov 201923 Jun 202015 Nov 2020
80waf.technologyNameCheap, Inc.27 Feb 202028 Jan 2025-
81waf.solutionsNameCheap, Inc.27 Feb 202028 Jan 2025-
82waf.goldDNSPod, Inc.25 Jun 202428 Jun 202525 Jun 2026
83waf.fanDNSPod, Inc.2 Apr 2025-2 Apr 2026
84waf.nrwGlobal Village GmbH9 Jun 201724 Jul 20259 Jun 2026
85waf.plusDynadot, LLC8 Mar 202513 Mar 20258 Mar 2026
86waf.wikiAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Mar 201820 Oct 202519 Mar 2026
87waf.moneyNameCheap, Inc.2 Dec 20202 Dec 20202 Dec 2021
88waf.runNamesilo, LLC26 Sep 202319 Jan 2026-
89waf.icuAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 Aug 20251 Sep 202525 Aug 2026
90waf.directMesh Digital Limited17 Nov 202121 Nov 202517 Nov 2026
91waf.wtfAmazon Registrar, Inc.6 Mar 202430 Jan 2025-
92waf.ccAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Nov 201414 Oct 20242 Nov 2028
93waf.or.id-19 Jan 201810 Mar 202219 Jan 2024
94waf.la-7 Jan 202122 Dec 20257 Jan 2027
95waf.re-29 Sep 201627 Sep 202129 Sep 2022
96waf.questPorkbun, LLC19 Jul 202231 Jul 202519 Jul 2026
97waf.toolsNameCheap, Inc.21 Jul 202221 Jul 202221 Jul 2023
98waf.appGlobal Domains International, Inc. DBA DomainCostC…26 Jul 202226 Nov 202526 Jul 2026
99waf.centerNameCheap, Inc.26 Aug 202226 Aug 202226 Aug 2023
100waf.coolDNSPod, Inc.1 Oct 2024-1 Oct 2026
101waf.teamOVH sas16 Dec 20226 Dec 202416 Dec 2025
102waf.com.plNamware.com, Inc.15 May 201825 Apr 202515 May 2026
103waf.autosDynadot, LLC16 Dec 202516 Dec 202516 Dec 2026
104waf.barNameCheap, Inc.8 Aug 202419 Sep 20258 Aug 2025
105waf.cxWest263 International Limited10 Feb 202415 Feb 202410 Feb 2029
106waf.cn-30 Jun 2005-30 Jun 2030
107waf.ltdWild West Domains, LLC12 Feb 202326 Mar 202512 Feb 2025
108waf.fyiAmazon Registrar, Inc.30 Mar 202323 Feb 2025-
109waf.ioNameCheap, Inc.21 Apr 201323 Mar 202021 Apr 2029
110waf.co.in-15 Feb 201630 May 202515 Feb 2026
111waf.jp-1 Sep 20221 Oct 202530 Sep 2026
112waf.monsterNameCheap, Inc.26 Aug 202231 Aug 202326 Aug 2024
113waf.nameNameCheap, Inc.---
114waf.org.ng-4 Apr 20198 May 20254 Apr 2026
115waf.rip1API GmbH23 Apr 20235 Jun 202523 Apr 2025
116waf.ovhOVH sas30 Aug 20201 Sep 202530 Aug 2026
117waf.uk-5 Jun 20191 Jul 20255 Jun 2026
118waf.abbCSC Corporate Domains, Inc.27 May 202018 Aug 202527 May 2026
119waf.vipGo Montenegro Domains, LLC16 Jun 201728 Jul 202316 Jun 2023
120waf.softwareInternet Invest, Ltd. dba Imena.ua31 Jul 202022 Jan 202631 Jul 2026
121waf.picsNameKing.com Inc.2 Aug 202331 Aug 20232 Aug 2024
122waf.aiNameCheap, Inc.5 May 202018 Feb 20255 May 2026
123waf.studioGoDaddy.com, LLC22 Aug 20236 Oct 202522 Aug 2026
124waf.internationalTucows Domains Inc.4 Sep 20238 Sep 2025-
125waf.socialInterNetworX Ltd. & Co. KG6 Sep 202316 Dec 2025-
126waf.venturesAtak Domain Hosting Internet d/b/a Atak Teknoloji26 Sep 202310 Nov 202426 Sep 2025
127waf.ind.inNamecroc.com LLC31 Dec 202114 Feb 202531 Dec 2025
128waf.beautyDynadot, LLC3 Jan 202413 Feb 20253 Jan 2025
129waf.emailMesh Digital Limited28 Feb 20244 Mar 202528 Feb 2026
130waf.co.nz-29 Aug 202331 Aug 2025-
131waf.bestNamesilo, LLC24 Jul 20252 Oct 202524 Jul 2026
132waf.productions1&1 Internet AG27 Mar 20246 Apr 202527 Mar 2025
133waf.proDNSPod, Inc.29 Mar 2024-29 Mar 2026
134waf.ae----
135waf.com.br-19 Mar 202031 Mar 202519 Mar 2026
136waf.im----
137waf.ru-3 Feb 2005-3 Feb 2027
138waf.se-6 Oct 201713 Aug 20256 Oct 2026
139waf.de--28 Oct 2009-
140waf.sk-31 Jan 20224 Jun 202531 Jan 2035
141waf.su-25 Oct 2022-25 Oct 2026
142waf.eu----
143waf.capitalGoDaddy.com, LLC15 May 202426 Jun 202515 May 2025
144waf.com.au--2 Nov 2025-
145waf.amsterdamRealtime Register B.V.6 Oct 202417 Oct 20246 Oct 2025
146waf.shNamesilo, LLC16 May 20208 Apr 202116 May 2030
147waf.org.cn????????????25 Mar 2022-25 Mar 2026
148waf.latDynadot, LLC15 Nov 202425 Jan 202615 Nov 2025
149waf.reportNameCheap, Inc.18 Nov 2024--
150waf.net.cn-20 Sep 2020-20 Sep 2026
151waf.meDynadot, LLC3 May 201812 Jul 20253 May 2026
152waf.nz-24 Jan 202529 Jan 2025-
153waf.net.au--25 Nov 2025-
154waf.babyNameCheap, Inc.1 Mar 20251 Apr 20251 Mar 2026
155waf.hr-23 Feb 202524 Feb 202524 Feb 2026
156waf.co.jp-16 Apr 20181 May 2025-
157waf.mom1API GmbH21 Apr 202520 Nov 202521 Apr 2026
158waf.uk.comGoDaddy.com, LLC25 Mar 202510 Feb 202625 Mar 2027
159waf.topALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED9 May 2025-9 May 2026
160waf.idReserved27 Aug 20246 Oct 202527 Aug 2025
161waf.co.idReserved29 Mar 20181 Apr 202529 Mar 2026
162waf.ms-17 Aug 202216 Jul 202517 Aug 2026
163waf.qa--21 Nov 2025-
164waf.yuneName Technology Co., Ltd.20 Nov 202525 Nov 202520 Nov 2026
165waf.moePorkbun, LLC3 Dec 20251 Feb 20263 Dec 2026
166waf.ca-1 Dec 20101 Dec 20251 Dec 2026
167waffen.netNameCheap, Inc.8 Dec 20008 Nov 20258 Dec 2026
168wafb.comBrandsight, Inc.24 Jan 19979 Jan 202625 Jan 2027
169waffentipp.de--12 Jul 2012-
170wafflehouse.comAmazon Registrar, Inc.9 Apr 19995 Mar 20259 Apr 2026
171waffarha.comCloudFlare, Inc.22 Sep 201116 Jan 202522 Sep 2031
172wafl.netDynadot, LLC23 Apr 20223 Jun 202523 Apr 2026
173wafstudio.netGoDaddy.com, LLC28 May 201828 May 201828 May 2019
174waff.comBrandsight, Inc.15 May 199615 Apr 202516 May 2026
175waffenschrank24.de--22 Jul 2016-
176wafa.ae----
177waffa.coNameCheap, Inc.18 Jun 201718 Jun 201717 Jun 2018
178waffenostheimer.de--3 May 2023-
179waffleboy.com.cn-19 Jan 2002-19 Jan 2028
180wafflesoftware.netBeijing Lanhai Jiye Technology Co., Ltd14 Jan 202427 Jan 202614 Jan 2027
181waffen-centrale.de--26 Sep 2014-
182waffle1999.comGMO Internet Inc.16 Sep 200419 Sep 202316 Sep 2032
183waffles.fmKey-Systems, LLC28 Oct 200712 Jan 201727 Oct 2017
184wafflesatnoon.comDNC Holdings, Inc.3 Mar 200811 Nov 20253 Mar 2026
185waffu.netGoogle, Inc.5 Feb 202321 Jan 20265 Feb 2027
186wafilmz.com1API GmbH27 Jun 202310 Sep 202427 Jun 2024
187wafukeylesslocks.comGoDaddy.com, LLC21 Oct 201422 Oct 202521 Oct 2026
188wafukeylesslock.comGoDaddy.com, LLC21 Oct 201422 Oct 202521 Oct 2026
189wafturetechnology.comGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2015
190wafmb.comWest263 International Limited9 Mar 20199 Mar 20199 Mar 2020
191waffmusic.comNameCheap, Inc.12 Jan 202313 Jan 202612 Jan 2027
192wafflesonly.comGoDaddy.com, LLC26 Nov 20217 Feb 202426 Nov 2023
193wafflewings.comTurnCommerce, Inc. DBA NameBright.com22 Oct 201416 Oct 202022 Oct 2026
194waffledomains.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2015
195waffledomain.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2015
196wafa.ps-24 Jan 200516 Feb 202025 Feb 2025
197wafaimages.ps-19 Mar 201030 Mar 202119 Mar 2024
198wafainfo.ps-4 Apr 201030 Mar 20214 Apr 2024
199wafc.orgNetwork Solutions, LLC20 Sep 199628 Jul 202419 Sep 2029
200wafelsanddinges.comGoDaddy.com, LLC13 Jul 200714 Jul 202513 Jul 2026
201waferlock.comTucows Domains Inc.25 Feb 200311 Mar 202325 Feb 2033
202waferlock.com.tw-26 Mar 2007-27 Mar 2025
203waferwire.comGoDaddy.com, LLC8 Mar 201022 Feb 20258 Mar 2030
204waferwire.in-14 Sep 201216 Sep 201614 Sep 2017
205waff.at--4 Apr 2011-
206waffar.comGoDaddy.com, LLC2 May 200029 Apr 20252 May 2026
207waffeleisen-ratgeber.de--28 Feb 2015-
208waffen-braun-shop.de--8 Dec 2010-
209waffen-ferkinghoff.de--8 May 2020-
210waffen-online.de--8 Jun 2017-
211waffen-schlottmann.de--23 Jul 2019-
212waffen-welt.de--12 Apr 2025-
213waffenboerse.ch----
214waffenfuzzi.de--12 Mar 2024-
215waffengebraucht.at--25 Nov 2025-
216waffenschrankshop.de--20 Apr 2020-
217waffenschumacher.com1API GmbH15 Nov 200126 Dec 202515 Nov 2026
218waffenzimmi.ch----
219waffiliation.comOnline SAS26 Aug 202325 Sep 202426 Aug 2024
220waffle.ioCSC Corporate Domains, Inc.19 Jun 201313 Jun 202519 Jun 2026
221waffleflower.comregister.com, Inc.23 Nov 201123 Nov 202523 Nov 2035
222wafflegirl.comMoniker Online Services LLC1 Jul 201125 Nov 20251 Jul 2026
223wafflemould.netGoogle, Inc.17 Dec 201316 Dec 202517 Dec 2026
224wafflemouldnigeria.comNamesilo, LLC13 Aug 20187 Aug 202513 Aug 2026
225wafi.comGoDaddy.com, LLC20 Jun 199619 Jun 202519 Jun 2026
226wafiqfx.comCircle of Domains LLC4 Mar 20165 Mar 20174 Mar 2018
227wafmedia2.comGoDaddy.com, LLC7 Apr 20207 Apr 20207 Apr 2021
228wafooded.comGoDaddy.com, LLC15 Nov 201415 Nov 201415 Nov 2015
229wafrafx.comTucows Domains Inc.16 Aug 20102 Aug 202516 Aug 2026
230waframedia.comGoDaddy.com, LLC12 Jan 201313 Jan 202512 Jan 2027
231waftr.comGoDaddy.com, LLC1 May 20132 Dec 20251 May 2026
232waftureworldwide.comGoDaddy.com, LLC28 Mar 201330 Mar 201528 Mar 2016
233waferbars.comGoDaddy.com, LLC7 Feb 20251 Mar 20257 Feb 2027
234wafmb.orgGoDaddy.com, LLC21 Oct 201422 Oct 201621 Oct 2017
235waffeleisen-test.euRegistryGate GmbH---
236wafflecell.comGMO Internet Inc.28 Dec 20112 Oct 202328 Dec 2028
237wafmedia3.comWeb Commerce Communications Limited dba WebNic.cc18 May 202128 Jul 202218 May 2022
238waframedia1.comHangzhou Best Domain Technology Co., LTD23 Feb 202226 Mar 202323 Feb 2023
239wafmedia5.comGoDaddy.com, LLC18 Jan 201517 Apr 201518 Jan 2016
240wafika.comGoDaddy.com, LLC21 Nov 202322 Nov 202521 Nov 2026
241waffensachkunde-deutschland.com1&1 Internet AG24 Oct 201424 Oct 201624 Oct 2018
242wafl.com.au--20 Dec 2025-
243waffen-ferkinghoff.comRegistryGate GmbH25 May 200025 Nov 202525 May 2026
244waffleplanet.netNETIM SARL12 Mar 202212 Mar 202212 Mar 2026
245wafx.netRegister.it SPA18 Aug 200622 Aug 202518 Aug 2028
246waffencenter-gotha.de--5 Jan 2016-
247wafzgvkfoaw.biz-24 Oct 2014-23 Oct 2015
248wafu-herb.comGMO Internet Inc.25 Oct 201411 Oct 201625 Oct 2021
249wafishfarmers.comDomeneshop AS dba domainnameshop.com24 Oct 20141 Jan 202624 Oct 2026
250wafdqc.comGMO Internet Inc.25 Feb 20228 May 202325 Feb 2023
251waficsaab.comGoDaddy.com, LLC9 Jan 201410 Jan 20269 Jan 2027
252waffen-teile.de--25 Aug 2022-
253wafilife.comCloudFlare, Inc.4 Dec 20149 Nov 20254 Dec 2026
254wafanli.cnDagnabit, Incorporated14 Nov 2014-14 Nov 2015
255waffenstube-kurus.at--23 Jan 2013-
256wafflemag.comTurnCommerce, Inc. DBA NameBright.com24 Apr 20157 Sep 202524 Apr 2026
257wafacash.comCSC Corporate Domains, Inc.13 Jan 20039 Jan 202613 Jan 2027
258wafflemakershq.comOldTownDomains.com LLC2 Sep 20165 Jan 20172 Sep 2017
259waferstar.comHiChina Zhicheng Technology Limited2 Jun 20054 Jun 20252 Jun 2028
260wafootball.com.au--19 Apr 2025-
261wafj.comGoDaddy.com, LLC20 Jan 200022 Oct 202520 Jan 2027
262waflow.netGoDaddy.com, LLC25 Oct 202428 Oct 202525 Oct 2026
263wafaghnaim.comWild West Domains, LLC24 May 201425 May 201524 May 2016
264waffleonwheels.comGoDaddy.com, LLC20 Nov 202520 Nov 202520 Nov 2026
265wafut.comGoDaddy.com, LLC25 Oct 20143 Nov 202525 Oct 2026
266wafisherinterative.comCosmotown, Inc.15 Jan 202616 Jan 202615 Jan 2027
267waffles.bizGoogle, Inc.7 May 201912 May 20197 May 2020
268waffalikewaffle.comMarcaria.com International, Inc.25 Oct 201425 Oct 201425 Oct 2015
269wafflerito.comGoDaddy.com, LLC8 Mar 20178 Mar 20178 Mar 2018
270wafflegato.comGoDaddy.com, LLC27 May 201427 May 201527 May 2016
271wafgidi.comGoDaddy.com, LLC26 May 201427 May 201526 May 2016
272wafers.infoNameCheap, Inc.25 May 201725 Sep 201725 May 2018
273wafflez.orgGoDaddy.com, LLC28 May 20149 Jun 201528 May 2016
274wafurs.netTucows Domains Inc.21 Oct 201125 Oct 201421 Oct 2015
275waffenrecht.info-15 Mar 202514 May 202515 Mar 2026
276wafiyzamree.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Aug 202124 Sep 202313 Aug 2023
277waffleprinters.comeNom, Inc.26 Oct 201426 Oct 201426 Oct 2015
278wafafashion.comTucows Domains Inc.20 Apr 20241 Jul 202520 Apr 2025
279wafertrading.comGoDaddy.com, LLC17 Dec 201818 Dec 202417 Dec 2026
280wafflerealm.comGoDaddy.com, LLC3 Jun 20134 Jun 20153 Jun 2016
281waffleback.comGoDaddy.com, LLC18 Apr 202518 Apr 202518 Apr 2026
282wafabec.comGoDaddy.com, LLC23 May 201424 May 201523 May 2016
283wafran.comTucows Domains Inc.27 Oct 20147 Jan 202627 Oct 2025
284wafflebomb.comWix.com Ltd.8 Sep 20209 Aug 20258 Sep 2026
285wafapress.comTurnCommerce, Inc. DBA NameBright.com13 Jan 201612 Feb 202613 Jan 2026
286wafferapp.netGoDaddy.com, LLC5 Jun 20146 Jun 20155 Jun 2016
287waforeclosurehelp.mobiGoDaddy.com, LLC5 Jun 20135 Jun 20155 Jun 2016
288waffe24.comCronon AG6 May 20247 May 20256 May 2026
289waffenhandel.net1&1 Internet AG14 Aug 201914 Oct 201914 Aug 2026
290wafbwheels.comGoDaddy.com, LLC11 Apr 200522 Mar 202511 Apr 2026
291wafasultan.comGoDaddy.com, LLC10 Aug 200521 Jul 202510 Aug 2026
292wafarly.comGoDaddy.com, LLC13 Jul 20112 Jul 202513 Jul 2026
293waffclub.comGoDaddy.com, LLC3 Feb 201330 Apr 20153 Feb 2016
294wafang.comeName Technology Co., Ltd.15 Aug 20076 Sep 202515 Aug 2026
295wafb.coChengdu West Dimension Digital Technology Co., Ltd…20 Jul 201720 Jul 201719 Jul 2018
296wafederal.comKey-Systems GmbH8 Apr 201330 Nov 20258 Apr 2026
297waffleprint.neteNom, Inc.26 Oct 20146 Nov 201626 Oct 2017
298wafapak.orgGoDaddy.com, LLC26 Oct 201426 Oct 201426 Oct 2015
299wafootball.comTurnCommerce, Inc. DBA NameBright.com28 Oct 201422 Oct 202028 Oct 2026
300waffle-iron.comBeijing Lanhai Jiye Technology Co., Ltd4 Jan 202312 Jan 20264 Jan 2027
301wafainternationalsdnbhd.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Oct 201428 Oct 201428 Oct 2015
302wafahourani7.comWild West Domains, LLC28 Oct 201428 Oct 201428 Oct 2015
303wafaacreations.com-29 Oct 201429 Oct 201429 Oct 2017
304waffenfabrik.comOne.com A/S25 Dec 201025 Nov 202525 Dec 2026
305wafflebarn.comeNom, Inc.20 Mar 201113 Mar 202520 Mar 2026
306wafia.comGoDaddy.com, LLC24 Dec 20212 Dec 202524 Dec 2026
307wafrican.comeNom, Inc.8 Apr 200911 Dec 20258 Apr 2026
308wafita.comeNom, Inc.18 Apr 201211 May 201718 Apr 2018
309wafercards.comGoDaddy.com, LLC7 Apr 202418 May 20257 Apr 2025
310wafermanufacturers.comeNom, Inc.12 Jun 201211 Dec 202512 Jun 2026
311wafae.comeNom, Inc.19 Sep 200516 Sep 202519 Sep 2026
312wafid.comGoDaddy.com, LLC5 Jul 20126 Jul 20255 Jul 2026
313waffe.infounited-domains AG13 Jan 20257 Feb 202613 Jan 2026
314wafered.comDropCatch.com 365 LLC16 May 202417 May 202416 May 2026
315wafflebrothers.usGoDaddy.com, LLC27 Oct 201427 Oct 201426 Oct 2015
316waffly.comGoDaddy.com, LLC24 Mar 200621 Aug 202324 Mar 2028
317wafiq.comGoDaddy.com, LLC25 Dec 200727 Dec 202525 Dec 2030
318wafer.ca----
319wafpanels.comTurnCommerce, Inc. DBA NameBright.com8 Mar 20199 Apr 20197 Mar 2020
320wafflesome.comGoDaddy.com, LLC29 Oct 201425 Oct 202429 Oct 2026
321wafflehouseexperience.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
322waffenlager.com-26 Feb 202626 Feb 202626 Feb 2027
323wafencemakers.comGoDaddy.com, LLC29 Oct 201430 Oct 201429 Oct 2016
324wafamvi.comTucows Domains Inc.26 Oct 201330 Oct 201426 Oct 2015
325waface.comHiChina Zhicheng Technology Limited25 Oct 20123 Sep 202525 Oct 2026
326wafaaherbs.comTucows Domains Inc.26 Oct 200930 Oct 201426 Oct 2015
327wafaaalhusaini.comNetwork Solutions, LLC30 Oct 201416 Oct 202530 Oct 2026
328waf1234.comGabia, Inc.24 Oct 201330 Oct 201424 Oct 2015
329wafflemakers.info1&1 Internet AG29 Sep 201529 Sep 201629 Sep 2017
330wafsecurity.orgPapaki Ltd.23 Nov 201423 Jan 201523 Nov 2015
331waffleconnection.comGoDaddy.com, LLC20 May 201313 Dec 202520 May 2026
332wafflesorpancakes.comGoDaddy.com, LLC31 May 20241 Jun 202531 May 2026
333wafon.comDynadot, LLC28 Nov 20085 Nov 202528 Nov 2026
334wafal.comDynadot, LLC13 Dec 20081 Dec 202513 Dec 2026
335wafis.comPSI-USA, Inc. dba Domain Robot27 May 200930 May 202527 May 2026
336wafie.comPSI-USA, Inc. dba Domain Robot4 Jun 200924 Jul 20254 Jun 2026
337waffleology.comGoDaddy.com, LLC19 Nov 201220 Nov 202519 Nov 2026
338waffizza.comWild West Domains, LLC18 Feb 201518 Feb 202518 Feb 2026
339wafah.comPSI-USA, Inc. dba Domain Robot18 Aug 20097 Oct 202518 Aug 2026
340wafts.comPSI-USA, Inc. dba Domain Robot17 Jun 20106 Aug 202517 Jun 2026
341wafee.comPSI-USA, Inc. dba Domain Robot10 May 201029 Jun 202510 May 2026
342wafiz.comPSI-USA, Inc. dba Domain Robot10 Apr 201030 May 202510 Apr 2026
343wafricarelief.comFastDomain Inc.30 Oct 201430 Oct 201430 Oct 2015
344wafitexbd.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Oct 201430 Oct 201430 Oct 2015
345wafidinstitute.comGoDaddy.com, LLC30 Oct 201431 Oct 202530 Oct 2027
346wafidcenter.comGoDaddy.com, LLC30 Oct 201431 Oct 202530 Oct 2027
347waffleswithlulu.comWild West Domains, LLC6 Feb 20166 Feb 20166 Feb 2017
348wafatour.comOnlineNIC, Inc.2 Mar 20172 Mar 20172 Mar 2018
349wafeze.infoGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2015
350waffles.coEdomains LLC26 Jun 202416 Aug 202526 Jun 2026
351wafermachine.comTurnCommerce, Inc. DBA NameBright.com16 Aug 202010 Aug 202116 Aug 2026
352wafflebarnonline.comGoDaddy.com, LLC9 Jun 200720 May 20259 Jun 2026
353wafsco.comTucows Domains Inc.31 Oct 20144 Nov 201531 Oct 2016
354waffleoflife.comDomain.com, LLC31 Oct 201431 Oct 201431 Oct 2015
355wafencemasters.comGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2016
356wafaaonline.comGoDaddy.com, LLC1 Nov 20141 Nov 20161 Nov 2017
357waffle-house.comGoDaddy.com, LLC14 May 201015 May 202514 May 2026
358wafflethins.comGoDaddy.com, LLC2 Jun 20153 Jun 20152 Jun 2016
359wafflebark.comGoDaddy.com, LLC3 Jun 20154 Jun 20153 Jun 2016
360waferpro.comTucows Domains Inc.17 Jun 201614 May 202517 Jun 2026
361wafiyat.comGoDaddy.com, LLC31 Dec 200512 Aug 202531 Dec 2026
362wafflerecipe.comGoDaddy.com, LLC24 Jan 200225 Jan 202624 Jan 2027
363wafersupply.comDynadot, LLC13 Dec 202511 Jan 202613 Dec 2026
364wafflestomp.comGoDaddy.com, LLC13 Apr 200814 Apr 202513 Apr 2026
365wafdam.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Dec 20102 Feb 202622 Dec 2025
366wafuvinumaq.comTLD Registrar Solutions Ltd.9 Nov 20149 Nov 20149 Nov 2015
367waftick.comDynadot6 LLC8 Sep 202218 Nov 20238 Sep 2023
368waftrix.comTucows Domains Inc.31 Jul 202031 Jul 202031 Jul 2021
369wafrick.comMedia Elite Holdings Limited1 Nov 20221 Nov 20221 Nov 2023
370waff48news.comGoDaddy.com, LLC4 Mar 200314 Apr 20244 Mar 2024
371wafking.comeNom659, Inc.21 May 201722 May 201721 May 2018
372waftik.comHangzhou Dianshang Internet Technology Co., Ltd25 Nov 202025 Nov 202025 Nov 2021
373waferscale.comNameCheap, Inc.8 Nov 20019 Oct 20258 Nov 2026
374wafflehousemenu.comHosting Concepts B.V. dba Openprovider18 Jul 202524 Jul 202518 Jul 2026
375wafc.netAnnulet LLC26 Jan 201511 Jan 202626 Jan 2027
376wafers.bizGoDaddy.com, LLC19 Jan 200427 Jun 201518 Jan 2016
377wafbmuseum.orgeNom, Inc.10 Jul 200811 May 202510 Jul 2026
378waffra.comDropCatch.com 1483 LLC15 Jan 201927 Mar 202415 Jan 2027
379wafflestheunicorgi.comGoDaddy.com, LLC2 Nov 20142 Nov 20142 Nov 2015
380waf007.comGoDaddy.com, LLC1 Nov 20141 Nov 20141 Nov 2015
381wafkid.comTucows Domains Inc.31 Oct 201931 Oct 201931 Oct 2020
382wafever.comeNom1010, Inc.13 Nov 201614 Nov 201613 Nov 2017
383wafu-living.comMvpdomainnames.com LLC29 Sep 20191 Oct 201929 Sep 2020
384waflehouse.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Feb 200526 Feb 202527 Feb 2026
385wafj.orgPDR Ltd. d/b/a PublicDomainRegistry.com10 Jan 200023 Mar 202510 Jan 2025
386waffle.tvDynadot, LLC5 May 20072 Jun 20175 May 2018
387wafrost.comGoDaddy.com, LLC22 Jun 199830 Oct 202221 Jun 2026
388wafflekitchen.comGoDaddy.com, LLC26 Apr 20146 Apr 202526 Apr 2026
389wafflems.netTucows Domains Inc.18 Aug 201929 Oct 202218 Aug 2022
390waferking.comDiaMatrix C.C.11 Apr 20193 Jun 202511 Apr 2029
391waffletruck.comGoDaddy.com, LLC28 Jun 201827 Aug 202428 Jun 2026
392waffleplace.comGoDaddy.com, LLC29 Jan 200730 Jan 202629 Jan 2027
393wafergard.comGoDaddy.com, LLC10 May 201710 May 201710 May 2018
394waffra.netTucows Domains Inc.29 Oct 20102 Nov 201829 Oct 2018
395wafiqa.com-22 Jun 20236 Jun 202522 Jun 2026
396wafaahmad.comeNom, Inc.2 Nov 20142 Nov 20142 Nov 2015
397wafusa.orgGoDaddy.com, LLC18 Aug 20052 Oct 202518 Aug 2026
398wafarmersmarkets.comFastDomain Inc.9 Mar 199922 Feb 20259 Mar 2026
399wafercookies.comDynadot, LLC14 Sep 20055 Sep 202514 Sep 2026
400wafuqi.comGoDaddy.com, LLC8 Jun 20129 Jun 20158 Jun 2016
401wafbhomes.comGoDaddy.com, LLC19 Jun 200720 Jun 202519 Jun 2026
402wafflechicks.comGoDaddy.com, LLC15 Feb 202515 Feb 202515 Feb 2026
403wafflehouserewards.comGoDaddy.com, LLC27 May 201428 May 202527 May 2026
404wafricarelief.orgFastDomain Inc.1 Nov 201414 Jan 20161 Nov 2017
405wafop18.comBrandon Gray Internet Services, Inc. (dba NameJuic…21 Nov 20037 Dec 202121 Nov 2026
406waffleandchicken.comGoDaddy.com, LLC8 Jun 20199 Jun 20258 Jun 2026
407wafflehaus.meGoDaddy.com, LLC10 Jun 201410 Jun 201510 Jun 2016
408wafflee.comTurnCommerce, Inc. DBA NameBright.com19 Jun 201711 Nov 202519 Jun 2026
409waffentechnik-solingen.de--14 Dec 2016-
410wafsbo.comGoogle, Inc.26 Feb 202228 Apr 202326 Feb 2023
411waffletea.comNameCheap, Inc.23 May 20224 Jul 202523 May 2025
412wafflesyrup.comFabulous.com Pty Ltd.2 Nov 20154 Aug 20252 Nov 2026
413wafflesapparel.comName.com, Inc.4 Nov 20144 Nov 20144 Nov 2015
414wafflerin.comTucows Domains Inc.3 Nov 20143 Nov 20143 Nov 2015
415waffenobermeier.comMesh Digital Limited30 Jul 200717 Jan 202630 Jul 2026
416wafabar.comBigRock Solutions Ltd.3 Nov 20143 Nov 20143 Nov 2015
417wafelha.usGoDaddy.com, LLC12 Jun 201412 Jun 201411 Jun 2015
418wafflepatterns.comGoDaddy.com, LLC4 Jan 20153 Jan 20254 Jan 2030
419wafamilydentistry.comCloudFlare, Inc.26 Jul 200313 Mar 202526 Jul 2026
420wafedbank.comGoDaddy.com, LLC15 Jan 200921 Jan 202520 Jan 2027
421wafish.comGoDaddy.com, LLC25 Nov 20088 Jan 202625 Nov 2026
422waffra.orgTucows Domains Inc.29 Oct 201031 Oct 201729 Oct 2018
423wafflesandcream.usGoDaddy.com, LLC2 Nov 20147 Nov 20171 Nov 2018
424wafflemaker-deal.comeNom, Inc.13 Sep 201413 Sep 201413 Sep 2015
425wafnjlaw.comFastDomain Inc.28 Apr 202429 Apr 202528 Apr 2026
426wafugee-realty.comMarcaria.com International, Inc.4 Nov 20144 Nov 20144 Nov 2015
427wafengyu.comBeijing Lanhai Jiye Technology Co., Ltd21 Aug 201922 Aug 202421 Aug 2025
428wafemaleveterans.comregister.com, Inc.4 Nov 20144 Nov 20144 Nov 2015
429wafmca.comFastDomain Inc.5 Dec 200220 Nov 20255 Dec 2026
430wafair.comHangzhou AiMing Network Co., LTD27 Oct 20101 Sep 202527 Oct 2026
431wafow.eueNom, Inc.---
432wafband.orgGoDaddy.com, LLC3 Dec 199816 Jan 20262 Dec 2026
433waffen-ss.no-1 Oct 20101 Oct 2010-
434wafflescafechicago.comDropCatch.com 1088 LLC13 Jun 202216 Dec 202413 Jun 2026
435wafflichworld.comeNom, Inc.10 Dec 20189 Dec 201810 Dec 2019
436wafwd.com-22 Oct 202522 Oct 202522 Oct 2026
437wafflezen.comGoDaddy.com, LLC5 Nov 201417 Jan 20255 Nov 2024
438wafers-sh.comXin Net Technology Corporation6 Nov 201424 May 20226 Nov 2026
439waffelicious.comTurnCommerce, Inc. DBA NameBright.com2 Feb 202011 Nov 20252 Feb 2026
440waffledesign.comAnnulet LLC17 Aug 201418 Aug 202517 Aug 2026
441wafa127.comGoDaddy.com, LLC13 Jun 201414 Jun 201513 Jun 2016
442wafm-spoknae.comGoDaddy.com, LLC14 Jun 201415 Jun 201514 Jun 2016
443wafy.orgGoDaddy.com, LLC29 Sep 202213 Nov 202529 Sep 2026
444wafasbrowart.netGoDaddy.com, LLC17 Jun 201418 Jun 201517 Jun 2016
445wafflesandwifi.comGoogle, Inc.31 Aug 202331 Oct 202431 Aug 2024
446wafa-blog.comGoDaddy.com, LLC17 Jun 201118 Jun 201517 Jun 2016
447wafastpitch.comGoDaddy.com, LLC29 Jul 202010 Oct 202329 Jul 2023
448waffles4u.comregister.com, Inc.10 Nov 202311 Oct 202510 Nov 2026
449wafikmoustafa.com1&1 Internet AG14 Mar 202314 Mar 202314 Mar 2026
450wafok.comPSI-USA, Inc. dba Domain Robot24 Jul 200212 Sep 202524 Jul 2026
451waftu.comNameCheap, Inc.3 Oct 202518 Oct 20253 Oct 2026
452wafpakistan.orgWild West Domains, LLC19 Jun 20141 Jul 201519 Jun 2016
453wafitm.mobiGMO Internet Inc.5 Nov 20145 Nov 20145 Nov 2015
454wafa-int.netPDR Ltd. d/b/a PublicDomainRegistry.com19 Aug 201419 Aug 201419 Aug 2015
455wafacultysenate.orgNetwork Solutions, LLC31 Jul 202312 Sep 202431 Jul 2024
456wafer-tech.comAmazon Registrar, Inc.10 Oct 202510 Oct 202510 Oct 2026
457waffen-haus.comTucows Domains Inc.16 Aug 201220 Aug 201416 Aug 2015
458waffenhouse.comGoDaddy.com, LLC12 Dec 202412 Dec 202512 Dec 2026
459waffenlaw.comGoDaddy.com, LLC19 Aug 201412 Aug 202419 Aug 2028
460wafajet-casablanca.comeNom, Inc.24 Jun 201526 May 201724 Jun 2018
461wafangwang.comHiChina Zhicheng Technology Limited24 Jun 201524 Jun 201524 Jun 2016
462wafaoil.comDynadot, LLC24 Jun 201524 Jun 201524 Jun 2017
463wafflepussy.comGoDaddy.com, LLC14 Feb 202228 Apr 202314 Feb 2023
464wafflingjack.comHosting Concepts B.V. dba Openprovider24 Jun 20152 Aug 201524 Jun 2016
465wafu-photo.comGMO Internet Inc.7 Nov 201427 Nov 20176 Nov 2018
466waftura.comCSC Corporate Domains, Inc.6 Nov 20144 Dec 20166 Nov 2018
467wafterik.comDynadot, LLC24 Jul 201924 Jul 201924 Jul 2020
468waffle-mix.comGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2017
469wafausa.comGoDaddy.com, LLC16 Nov 202516 Nov 202516 Nov 2027
470wafarha.comNameCheap, Inc.30 Dec 202530 Dec 202530 Dec 2026
471waffen-house.comTucows Domains Inc.16 Aug 201220 Aug 201416 Aug 2015
472wafflensandwich.comGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
473wafflesmiles.comHosting Concepts B.V. dba Openprovider8 Nov 20219 Nov 20218 Nov 2022
474wafflesmiles.infoGoDaddy.com, LLC12 Apr 201825 Apr 202312 Apr 2024
475wafflesmiles.netGandi SAS17 Apr 201817 Apr 201817 Apr 2019
476wafflesmiles.orgGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
477wafrika.comPorkbun, LLC14 Jan 202415 Jan 202614 Jan 2027
478waferjel.comTucows Domains Inc.12 Jan 201516 Jan 201612 Jan 2017
479waffenwerke.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
480wafsra.orgGoDaddy.com, LLC9 Mar 201613 Mar 20179 Mar 2018
481waf-ajk.orgNamesilo, LLC5 Nov 20148 Dec 20175 Nov 2018
482wafbunkers.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2017
483wafflesandsyrup.comMetaregistrar BV Applications2 Oct 20241 Nov 20252 Oct 2025
484wafiadditives.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2016
485wafoindustry.comeNom, Inc.6 Feb 201514 Mar 20176 Feb 2018
486wafflelending.comeNom, Inc.21 Aug 201421 Jul 201521 Aug 2017
487waffleloans.comeNom, Inc.21 Aug 201421 Jul 201521 Aug 2017
488wafuasianbistro.neteNom, Inc.21 Aug 20147 Aug 201621 Aug 2017
489wafvbx.comNetwork Solutions, LLC21 Aug 201421 Aug 201421 Aug 2015
490wafausa.netTucows Domains Inc.3 Nov 20087 Nov 20143 Nov 2015
491wafgroup.comeNom, Inc.9 Apr 201711 Mar 20259 Apr 2026
492wafflesonwaffles.comWild West Domains, LLC25 Sep 202325 Sep 202325 Sep 2026
493waffleras.comDattatec.com SRL8 Nov 201411 Nov 20258 Nov 2026
494wafflecraftlp.comeNom, Inc.7 Nov 20147 Nov 20147 Nov 2015
495wafflecorporation.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2015
496wafflebrown.comDreamHost, LLC7 Nov 201411 Nov 20197 Nov 2020
497waffen-naegele.comCronon AG7 Nov 201427 Dec 20257 Nov 2026
498wafaico.comregister.com, Inc.7 Nov 20147 Nov 20147 Nov 2015
499wafangdianzx.comChengdu West Dimension Digital Technology Co., Ltd…1 Mar 20151 Mar 20151 Mar 2026
500waffleshot.comGoDaddy.com, LLC17 May 20161 Nov 202217 May 2027
501waffletoddler.comTucows Domains Inc.25 Feb 20141 Mar 201525 Feb 2016
502wafor.netBeijing Lanhai Jiye Technology Co., Ltd6 Aug 20254 Feb 20266 Aug 2026
503wafflehouseegypt.comTucows Domains Inc.19 Aug 200922 Aug 201419 Aug 2015
504waffleport.comGoDaddy.com, LLC22 Feb 201722 Feb 201722 Feb 2022
505wafflero.comGoDaddy.com, LLC23 Nov 201619 Nov 202523 Nov 2026
506waffleshirts.comGoDaddy.com, LLC23 Aug 201423 Aug 201623 Aug 2018
507waffletshirt.comGoDaddy.com, LLC23 Aug 201423 Aug 201623 Aug 2018
508waffletshirts.comGoDaddy.com, LLC23 Aug 201423 Aug 201623 Aug 2018
509wafsolution.comOpen System Ltda - Me22 Aug 201422 Aug 201422 Aug 2015
510wafashop.comNameCheap, Inc.26 Dec 202426 Nov 202526 Dec 2026
511wafflechoco.comIHS Telekom, Inc.14 Apr 20152 May 201714 Apr 2018
512wafflechocosos.comIHS Telekom, Inc.14 Apr 201514 Apr 201514 Apr 2016
513wafflecrepe.comOVH sas3 Oct 202326 Aug 20253 Oct 2026
514wafwip.comAscio Technologies, Inc. Danmark - Filial af Ascio…14 Apr 201514 Apr 201514 Apr 2016
515wafaoil.netDynadot, LLC24 Jun 201524 Jun 201524 Jun 2017
516wafahost.comNameCheap, Inc.6 Jul 20242 Jul 20256 Jul 2026
517wafflesup.comGoDaddy.com, LLC8 Nov 20149 Nov 20248 Nov 2026
518waffleqwest.comGoDaddy.com, LLC8 Nov 20149 Nov 20258 Nov 2026
519waffle-qwest.comGoDaddy.com, LLC8 Nov 20149 Nov 20258 Nov 2026
520wafay.comDropCatch.com 1481 LLC2 May 202513 Sep 20252 May 2026
521wafchesjp.comGMO Internet Inc.20 Jan 201820 Jan 201820 Jan 2019
522wafflesdesign.comHostinger, UAB26 Nov 20238 Jan 202626 Nov 2025
523wafasblog.netGoDaddy.com, LLC12 Aug 201412 Aug 201412 Aug 2015
524wafdier.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Aug 201413 Aug 201412 Aug 2015
525wafifurniture.comHetzner Online AG15 Nov 202225 Nov 202515 Nov 2026
526wafzz.comXin Net Technology Corporation12 Aug 201412 Aug 201412 Aug 2015
527waflag.comGoDaddy.com, LLC20 May 202025 Dec 202520 May 2026
528waffleweiner.comGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
529waffle-weiner.comGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
530waffenschule.com1&1 Internet AG9 Nov 201410 Nov 20219 Nov 2026
531waffenschule-mv.com1&1 Internet AG9 Nov 201410 Nov 20169 Nov 2018
532waffenschule-berlin.com1&1 Internet AG9 Nov 201410 Nov 20259 Nov 2026
533waffle-engine.comFastDomain Inc.2 Jul 202016 Jun 20252 Jul 2026
534wafflesandwhiskey.comSquarespace Domains LLC22 May 20243 Jul 202522 May 2025
535wafflesncream.netNobel Networks13 Aug 201413 Aug 201413 Aug 2015
536wafrc8787.comGoDaddy.com, LLC14 Aug 201414 Aug 201414 Aug 2015
537waf2014.comWeb Commerce Communications Limited dba WebNic.cc22 Apr 20231 Jun 202422 Apr 2024
538wafamilymedicinejobs.comGoDaddy.com, LLC26 Aug 20147 Oct 202426 Aug 2024
539wafchesjp.bizGMO Internet Inc.30 Mar 202524 Oct 202530 Mar 2026
540waffelinolawrence.comBrandsight, Inc.25 Aug 201426 Jul 202525 Aug 2026
541waffledeli.comDomain.com, LLC26 Aug 201426 Aug 201426 Aug 2015
542waffledelicious.comDomain.com, LLC26 Aug 201426 Aug 201426 Aug 2015
543wafflehouselex.comNetwork Solutions, LLC26 Aug 201425 Mar 201526 Aug 2017
544waffleyachtproductions.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2016
545wafraid.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
546wafrico.comBeijing Lanhai Jiye Technology Co., Ltd3 Feb 20237 Apr 20253 Feb 2025
547wafsta.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
548wafuchuanmei.comGuangDong NaiSiNiKe Information Technology Co Ltd.25 Aug 201425 Aug 201425 Aug 2015
549wafufu.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 Jul 202519 Jul 202517 Jul 2026
550wafukuoteire.comGMO Internet Inc.26 Aug 201411 Aug 202326 Aug 2026
551wafulaadvocates.comOnlineNIC, Inc.27 Aug 201427 Aug 201427 Aug 2015
552waffleqwest.orgregister.com, Inc.8 Nov 20148 Nov 20148 Nov 2015
553waffleqwest.netregister.com, Inc.8 Nov 20148 Nov 20148 Nov 2015
554waf2014.orgNetowl, Inc.8 Nov 20149 Nov 20148 Nov 2015
555waffenschule.net1&1 Internet AG9 Nov 201410 Nov 20219 Nov 2026
556waffenschule.info1&1 Internet AG9 Nov 201424 Dec 20259 Nov 2026
557waffenschule-mv.net1&1 Internet AG9 Nov 201415 Dec 20179 Nov 2018
558waffenschule-mv.info1&1 Internet AG9 Nov 20149 Nov 20179 Nov 2018
559waffenschule-berlin.net1&1 Internet AG9 Nov 201410 Nov 20219 Nov 2026
560waffenschule-berlin.info1&1 Internet AG9 Nov 201424 Dec 20259 Nov 2026
561wafa-creation.com1&1 Internet AG5 Nov 201618 Dec 20245 Nov 2024
562wafaesindh.comGransy s.r.o. d/b/a subreg.cz5 Jun 20255 Jun 20255 Jun 2027
563waferprocessing.neteNom, Inc.14 Aug 201414 Aug 201414 Aug 2015
564waffaa.comNordreg AB21 Nov 202521 Nov 202521 Nov 2026
565waffleseverything.comGoDaddy.com, LLC14 Aug 201415 Aug 201614 Aug 2018
566waffletina.comPorkbun, LLC11 Jun 202011 Jun 202011 Jun 2021
567wafflezfactory.com1&1 Internet AG10 Nov 201410 Nov 201410 Nov 2015
568wafflezfactory.biz1&1 Internet AG10 Nov 2014-9 Nov 2015
569wafflez.biz1&1 Internet AG10 Nov 2014-9 Nov 2015
570wafaefennich.comNetwork Solutions, LLC10 Nov 201410 Nov 201410 Nov 2015
571wafamag.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
572wafeqz.comNetwork Solutions, LLC27 Aug 201427 Aug 201427 Aug 2015
573wafflesdeluxe.comGoDaddy.com, LLC27 Aug 201411 Jun 202427 Aug 2027
574wafamag.netGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
575waf-asbl.netTucows Domains Inc.12 Aug 201015 Aug 201412 Aug 2015
576wafang0411.comDropCatch.com 898 LLC8 May 202218 Jun 20238 May 2023
577wafasaudi.comGoDaddy.com, LLC15 Aug 201427 Oct 202315 Aug 2023
578wafasaudi.infoGoDaddy.com, LLC15 Aug 201415 Aug 201415 Aug 2015
579wafasaudi.mobiGoDaddy.com, LLC15 Aug 201415 Aug 201415 Aug 2015
580wafasaudi.netGoDaddy.com, LLC15 Aug 201415 Aug 201415 Aug 2015
581wafdceo.comGoDaddy.com, LLC15 Aug 201416 Aug 202415 Aug 2029
582wafdceoforum.comGoDaddy.com, LLC15 Aug 201416 Aug 202415 Aug 2029
583wafflellama.comGoogle, Inc.15 Aug 201415 Aug 201415 Aug 2015
584wafflepanda.comCloudFlare, Inc.15 Aug 201416 Jul 202515 Aug 2026
585wafowa.orgKey-Systems GmbH9 Aug 201225 Nov 20259 Aug 2026
586wafree.comTurnCommerce, Inc. DBA NameBright.com20 Oct 201511 Nov 202520 Oct 2026
587waftio.comWild West Domains, LLC15 Aug 20144 Aug 202515 Aug 2026
588wafaire.comGransy s.r.o. d/b/a subreg.cz1 Nov 201524 Oct 20251 Nov 2026
589wafcdn.comGoDaddy.com, LLC17 Aug 201431 Dec 202517 Aug 2026
590wafdr.comChengdu West Dimension Digital Technology Co., Ltd…2 May 20182 May 20182 May 2019
591waffries.comNetwork Solutions, LLC16 Aug 201417 Jul 202516 Aug 2026
592waffries.netName.com, Inc.16 Aug 201416 Aug 201416 Aug 2015
593waffries.orgName.com, Inc.16 Aug 201416 Aug 201416 Aug 2015
594waffry.comGoDaddy.com, LLC12 Apr 202012 Apr 202012 Apr 2021
595waffry.netName.com, Inc.16 Aug 201416 Aug 201416 Aug 2015
596waffry.orgName.com, Inc.16 Aug 201416 Aug 201416 Aug 2015
597waflag.orgeNom, Inc.9 Nov 20149 Nov 20149 Nov 2015
598wafistonebridge.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Jan 20173 Jan 201819 Jan 2018
599wafflesandwine.comTucows Domains Inc.30 Apr 201815 Apr 202530 Apr 2026
600wafernutscom.com----
601wafernuts.comGoDaddy.com, LLC12 Nov 201412 Nov 201412 Nov 2015
602wafjipjncuud.bizGMO Internet Inc.13 Nov 201413 Nov 201412 Nov 2015
603wafflecrisps.comGoDaddy.com, LLC7 Jun 20228 Jun 20257 Jun 2026
604wafamag.infoGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
605wafamag.mobiGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
606wafflebottom.comGoDaddy.com, LLC23 Nov 201721 Nov 202523 Nov 2026
607wafflekhan.netKoreacenter.com co., Ltd.28 Aug 201428 Aug 201428 Aug 2015
608wafflesandwings.comGoDaddy.com, LLC6 Feb 202111 Feb 20266 Feb 2027
609wafflesnwings.comGoDaddy.com, LLC6 Feb 202111 Feb 20266 Feb 2027
610waferoptik.comGMO Internet Inc.26 Nov 201526 Nov 201526 Nov 2016
611waffenschrank-a.comPSI-USA, Inc. dba Domain Robot15 Apr 201011 Sep 201415 Apr 2015
612waffenschrank-b.comPSI-USA, Inc. dba Domain Robot15 Apr 201011 Sep 201415 Apr 2015
613waffledrop.comGoDaddy.com, LLC12 Feb 201713 Feb 202512 Feb 2027
614waferlabs.comGoDaddy.com, LLC29 Aug 201411 Sep 202529 Aug 2026
615waffenbesitzer.netDropCatch.com 593 LLC6 Jan 20212 Mar 20216 Jan 2028
616wafflemedia.netCloudFlare, Inc.29 Dec 202220 Jan 202629 Dec 2026
617wafflewebdir.infoGMO Internet Inc.3 Mar 20202 May 20203 Mar 2021
618wafitech.comTurnCommerce, Inc. DBA NameBright.com29 Aug 201411 Nov 202529 Aug 2026
619waffletherapy.comDomainAdministration.com, LLC30 Nov 201715 Nov 202530 Nov 2026
620wafairchancecoalition.orgGoDaddy.com, LLC12 Sep 20148 Oct 201712 Sep 2018
621wafideal.comNameCheap, Inc.7 May 20257 May 20257 May 2026
622waffleclass.comDomainLocal LLC14 Nov 201415 Nov 201614 Nov 2017
623waffenschmiede.comNamesilo, LLC18 Apr 20209 Apr 202518 Apr 2026
624wafak.comTurnCommerce, Inc. DBA NameBright.com14 Nov 201413 Feb 202514 Nov 2026
625waf-u.comGMO Internet Inc.30 Aug 201430 Aug 201430 Aug 2015
626waferpriceindex.comTucows Domains Inc.27 Aug 200830 Aug 201427 Aug 2015
627waferpriceindex.netTucows Domains Inc.27 Aug 200830 Aug 201427 Aug 2015
628wafflblr.comNamesilo, LLC29 Jan 201930 Jan 201929 Jan 2020
629wafakm.comeNom, Inc.13 Sep 20146 Sep 202513 Sep 2026
630waferdigital.com-15 Mar 202418 Dec 202415 Mar 2026
631waffle-licious.comNameCheap, Inc.11 Apr 202423 May 202511 Apr 2025
632wafaz.netMarcaria.com International, Inc.13 Sep 201413 Sep 201413 Sep 2015
633wafchildrenscentre.orgeNom, Inc.31 Aug 201431 Aug 201431 Aug 2015
634wafcld.comNetwork Solutions, LLC31 Aug 20141 Sep 201431 Aug 2015
635waffandme.comWild West Domains, LLC31 Aug 201429 Aug 201631 Aug 2017
636waffleandsteak-kw.comNameCheap, Inc.18 May 202330 Jul 202418 May 2024
637wafflecoffee.comGoDaddy.com, LLC31 Aug 20141 Sep 202431 Aug 2026
638wafflescoops.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
639waffoooseverything.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
640waffoooseverything.netGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
641waffoooseverything.orgGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
642wafooos.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2016
643wafymot.comGoDaddy.com, LLC16 Sep 201417 Sep 201416 Sep 2015
644waferlife.comHiChina Zhicheng Technology Limited1 Sep 201412 Jul 20251 Sep 2026
645waftblade.bizGMO Internet Inc.1 Sep 2014-31 Aug 2015
646waftsynod.infoGMO Internet Inc.2 Sep 2014-2 Sep 2015
647wafeng.comeName Technology Co., Ltd.11 Sep 201431 Dec 202511 Sep 2026
648wafflecafe.comTurnCommerce, Inc. DBA NameBright.com16 Sep 201413 Nov 202416 Sep 2026
649wafipd.comNetwork Solutions, LLC16 Sep 201416 Sep 201416 Sep 2015
650wafondation.comTucows Domains Inc.16 Sep 201420 Sep 201516 Sep 2016
651wafunny.comHiChina Zhicheng Technology Limited17 Sep 201713 Aug 202417 Sep 2026
652waffelrezept.netHiChina Zhicheng Technology Limited18 May 201918 May 201918 May 2020
653wafer-ic.comXin Net Technology Corporation2 Sep 20144 Sep 20252 Sep 2026
654waffenkammer.com-18 Dec 20232 Dec 202518 Dec 2026
655waffledots.comWild West Domains, LLC2 Sep 20142 Aug 20252 Sep 2026
656wafflesmx.comNetwork Information Center Mexico, S.C.1 Jul 20143 Jul 20151 Jul 2016
657wafky.comGoDaddy.com, LLC1 Dec 20151 Dec 20151 Dec 2016
658waferia.comGransy s.r.o. d/b/a subreg.cz15 Nov 201418 Nov 202515 Nov 2026
659wafamilyhistory.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Mar 202011 Mar 202011 Mar 2021
660wafaa-ksa.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Sep 201415 Sep 201415 Sep 2015
661waffledelivery.comNameCheap, Inc.3 Aug 2020-3 Aug 2021
662wafuutei.comGoDaddy.com, LLC16 Sep 20143 Nov 202516 Sep 2026
663wafdylow.us-16 Sep 2014-15 Sep 2015
664wafangdianxing.comeName Technology Co., Ltd.17 Sep 201415 Sep 201717 Sep 2018
665wafantian.comBeijing Lanhai Jiye Technology Co., Ltd23 Apr 202010 Feb 202623 Apr 2027
666wafirsttimehomebuyer.comGoDaddy.com, LLC17 Sep 201429 Oct 202417 Sep 2024
667waffen-ssjp.comGMO Internet Inc.3 Sep 201419 Aug 20173 Sep 2018
668waffle-magic.comGoDaddy.com, LLC4 Jul 20204 Jul 20204 Jul 2021
669wafflemakers.orgHostinger, UAB24 Jan 202224 Jan 202624 Jan 2027
670wafi-services.comeNom, Inc.3 Sep 20143 Sep 20143 Sep 2015
671wafsitting.comHiChina Zhicheng Technology Limited28 Nov 201828 Nov 201828 Nov 2019
672wafu-snack.comGMO Internet Inc.3 Sep 20143 Sep 20143 Sep 2015
673wafangdianshuo.comeName Technology Co., Ltd.17 Sep 201415 Sep 201717 Sep 2018
674wafangdianyou.comeName Technology Co., Ltd.17 Sep 201415 Sep 201717 Sep 2018
675waffaz.comeNom, Inc.17 Sep 201417 Sep 201417 Sep 2015
676wafflepress.netGoogle, Inc.17 Sep 201417 Sep 201917 Sep 2020
677waff.info1&1 Internet AG6 Sep 202419 Oct 20256 Sep 2025
678wafea.com-14 Nov 202515 Nov 202514 Nov 2026
679wafea.orgNamesilo, LLC5 Sep 20148 Oct 20255 Sep 2025
680wafflenight.comNameCheap, Inc.24 Jun 202524 Jun 202524 Jun 2026
681wafts-dev.comGoDaddy.com, LLC4 Sep 20144 Sep 20144 Sep 2015
682waffaz.neteNom, Inc.18 Sep 201418 Sep 201418 Sep 2015
683waffensachkundepruefung-bundesweit.com1&1 Internet AG18 Sep 201413 Apr 201818 Sep 2026
684waffii.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Sep 201418 Sep 201418 Sep 2015
685waffers.comDynadot, LLC17 Sep 20149 Sep 202517 Sep 2026
686waffensachkundepruefung-bundesweit.info1&1 Internet AG18 Sep 20142 Nov 202518 Sep 2026
687waffensachkundepruefung-bundesweit.net1&1 Internet AG18 Sep 201419 Sep 202518 Sep 2026
688waffleskingdom.comOne.com A/S18 Sep 201419 Aug 202518 Sep 2026
689wafiqhachemical.comNetwork Solutions, LLC18 Sep 201418 Sep 201418 Sep 2015
690wafidacademy.comGoDaddy.com, LLC17 Nov 201418 Nov 202517 Nov 2027
691wafflewiener.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2015
692waffle3pie.comKey-Systems GmbH17 Nov 201417 Nov 201417 Nov 2015
693waffle-wiener.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2015
694waffgrenandsonspatiocovers.comGoDaddy.com, LLC17 Nov 201417 Nov 201417 Nov 2015
695wafdugfgfsd.bizGMO Internet Inc.17 Nov 201419 Nov 201416 Nov 2015
696wafastprofits.netPDR Ltd. d/b/a PublicDomainRegistry.com5 Sep 20145 Sep 20145 Sep 2015
697wafiapp.comAutomattic Inc.4 Apr 202524 Nov 20254 Apr 2026
698wafmzc.comNetwork Solutions, LLC5 Sep 20145 Sep 20145 Sep 2015
699wafutech.comXin Net Technology Corporation18 Aug 20188 Aug 202518 Aug 2026
700wafe-women.orgGMO Internet Inc.22 Nov 201523 Nov 201622 Nov 2017
701wafflechoice.comDomain.com, LLC6 Sep 20146 Sep 20146 Sep 2015
702wafflemania.netNetwork Solutions, LLC5 Jan 20173 Jan 20185 Jan 2019
703wafnews.comNamesilo, LLC9 Jul 202219 Jun 20259 Jul 2026
704wafund.orgGoDaddy.com, LLC1 Dec 202410 Dec 20251 Dec 2027
705wafu.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…23 Nov 202330 Jan 202523 Nov 2024
706wafzwc.mobiGMO Internet Inc.16 Nov 201416 Nov 201416 Nov 2015
707wafainc.comTurnCommerce, Inc. DBA NameBright.com21 Jun 201415 Jun 202021 Jun 2026
708wafelshop.comTucows Domains Inc.4 Sep 20138 Sep 20144 Sep 2015
709waferfabsolutions.comGoDaddy.com, LLC7 Sep 201431 Aug 20257 Sep 2026
710waferfabsupport.comeNom, Inc.7 Sep 20147 Sep 20147 Sep 2015
711wafflebuzz.comGoDaddy.com, LLC8 Jan 201913 Jan 20258 Jan 2025
712wafra-eg.comNameCheap, Inc.7 Sep 20149 Sep 20257 Sep 2026
713wafed-nepal.orgGMO Internet Inc.17 Nov 201428 Dec 201717 Nov 2018
714waftishow.comMetaregistrar BV Applications9 Feb 202510 Feb 20269 Feb 2027
715wafflewaffles.comGoDaddy.com, LLC18 Nov 201419 Nov 202418 Nov 2026
716wafflearabasi.comFBS Inc.16 Feb 201616 Feb 201616 Feb 2017
717waffelatti.comAscio Technologies, Inc. Danmark - Filial af Ascio…18 Nov 201418 Nov 201418 Nov 2015
718wafevents.comAnnulet LLC9 Oct 20139 Oct 20259 Oct 2026
719waferstepper.comHosting Concepts B.V. dba Openprovider18 Nov 201410 Feb 201718 Nov 2017
720wafamekail.comGoDaddy.com, LLC1 Feb 20191 Feb 20191 Feb 2020
721waf8uq.comTucows Domains Inc.15 Nov 201319 Nov 201415 Nov 2015
722waffledreams.comNamesilo, LLC10 Jul 20256 Aug 202510 Jul 2026
723waffletrees.comNameCheap, Inc.29 Sep 201411 Jan 201829 Sep 2018
724wafiqmusallam.comTucows Domains Inc.30 Sep 20144 Oct 201530 Sep 2016
725wafersiltron.comGabia, Inc.26 Sep 200519 Sep 201726 Sep 2018
726wafersmonteverde.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Sep 201426 Sep 201729 Sep 2018
727wafflesonsticks.comGoDaddy.com, LLC11 Apr 202112 Apr 202511 Apr 2026
728wafaigroup.comregister.com, Inc.8 Sep 20148 Sep 20148 Sep 2015
729wafanyakazi.comLaunchpad, Inc.22 Aug 20234 Oct 202422 Aug 2024
730wafelek.comKey-Systems GmbH10 Mar 202530 Nov 202510 Mar 2026
731waffling.comFabulous.com Pty Ltd.25 Aug 200024 Dec 202525 Aug 2027
732wafaawakf.comGoDaddy.com, LLC10 Sep 201411 Sep 201610 Sep 2017
733wafersale.bizMesh Digital Limited9 Sep 201412 Sep 20198 Sep 2020
734waffrha.comGoDaddy.com, LLC23 Apr 20213 Apr 202523 Apr 2026
735wafindia.comGoDaddy.com, LLC29 Nov 201830 Sep 202529 Nov 2027
736wafnjt.comNetwork Solutions, LLC19 Jul 20149 Sep 201419 Jul 2015
737wafuz.comGoDaddy.com, LLC28 Apr 202229 Apr 202428 Apr 2026
738wafilmcaucus.orgLaunchpad, Inc.2 Oct 20143 Oct 20142 Oct 2015
739wafaawakf.infoGoDaddy.com, LLC10 Sep 201422 Sep 202510 Sep 2026
740waffleroga.comArsys Internet, S.L. dba NICLINE.COM24 Apr 202524 Apr 202524 Apr 2026
741wafaawakf.netGoDaddy.com, LLC10 Sep 201411 Sep 201610 Sep 2017
742waf888.comNamesilo, LLC25 May 20252 Jan 202625 May 2027
743wafflemilly.com1API GmbH4 Oct 201417 Nov 20244 Oct 2024
744wafinvestments.comSquarespace Domains LLC6 Jul 202521 Jul 20256 Jul 2027
745wafseattle.orgNetwork Solutions, LLC3 Oct 20143 Oct 20143 Oct 2015
746wafyfair.comGransy s.r.o. d/b/a subreg.cz3 Oct 201425 Sep 20253 Oct 2026
747wafona-online.comGMO Internet Inc.3 Oct 20144 Sep 20173 Oct 2018
748wafens.com-11 Jul 201611 Jul 201611 Jul 2017
749waffle-bar.comGoDaddy.com, LLC21 May 202421 May 202521 May 2026
750wafso.comGoDaddy.com, LLC16 Jun 202529 Nov 202516 Jun 2026
751wafaawakf.orgGoDaddy.com, LLC10 Sep 201411 Sep 201710 Sep 2018
752wafalliance.orgDomain.com, LLC10 Sep 2014-10 Sep 2015
753waferoptic.orgPDR Ltd. d/b/a PublicDomainRegistry.com10 Sep 201410 Sep 201410 Sep 2015
754waftweb.com-14 Jul 201614 Jul 201614 Jul 2017
755waffles4dinner.comGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2015
756wafaasemaan.comGoDaddy.com, LLC21 Sep 201421 Sep 201421 Sep 2015
757wafflemakerstore.comBeijing Lanhai Jiye Technology Co., Ltd9 May 20235 Jan 20269 May 2026
758wafflesmania.comGoDaddy.com, LLC10 Apr 202322 Apr 202410 Apr 2025
759wafuasp.orgeNom, Inc.19 Nov 201419 Nov 201419 Nov 2015
760wafture.netregister.com, Inc.19 Nov 201421 Nov 201419 Nov 2015
761waft-armpit.netGMO Internet Inc.20 Nov 201420 Nov 201420 Nov 2015
762wafra-me.comChengdu West Dimension Digital Technology Co., Ltd…8 Feb 20198 Feb 20198 Feb 2020
763wafoof.net1&1 Internet AG20 Nov 201420 Nov 201420 Nov 2015
764wafasgh.comregister.com, Inc.21 Nov 201421 Nov 201421 Nov 2015
765waffledog.netAmazon Registrar, Inc.14 Mar 20248 Mar 202514 Mar 2026
766wafet.comPSI-USA, Inc. dba Domain Robot3 Sep 200923 Oct 20253 Sep 2026
767wafffar.comGoDaddy.com, LLC4 Oct 20145 Oct 20154 Oct 2016
768waffleolicious.comGoDaddy.com, LLC19 Jun 20182 Oct 202519 Jun 2026
769wafemyanmarengineeringservices.comOnlineNIC, Inc.23 Sep 201415 Sep 201723 Sep 2018
770waf3bsgs.comGMO Internet Inc.22 Sep 201423 Sep 201422 Sep 2015
771waffenkammer.netKey-Systems GmbH22 Sep 201422 Sep 201722 Sep 2018
772wafelsenzo.comKey-Systems GmbH22 Sep 201427 Oct 201722 Sep 2018
773wafarmersfirst.comSynergy Wholesale Pty Ltd6 Oct 201421 Sep 20256 Oct 2026
774wafelen.comTucows Domains Inc.5 Oct 20149 Oct 20155 Oct 2016
775wafflebuswifi.infoNETIM SARL5 Oct 20145 Oct 20145 Oct 2015
776waffledogg.comGoDaddy.com, LLC7 Dec 20207 Dec 20207 Dec 2021
777waffledoggie.comGoDaddy.com, LLC5 Oct 20145 Oct 20145 Oct 2015
778waffrnalk.comNameCheap, Inc.13 Mar 202324 Apr 202413 Mar 2024
779wafuk.comTurnCommerce, Inc. DBA NameBright.com23 Sep 201417 Sep 202023 Sep 2026
780waf21.comTop Pick Names LLC9 Feb 202225 Apr 20239 Feb 2023
781wafai.bizChengdu West Dimension Digital Technology Co., Ltd…15 Sep 200523 Oct 202514 Sep 2026
782wafawcett.comTucows Domains Inc.6 Oct 201417 Dec 20246 Oct 2024
783wafg.orgNameKing.com Inc.26 Jan 202226 Jan 202626 Jan 2027
784wafricanhairbraiding.comTucows Domains Inc.3 Oct 20047 Oct 20143 Oct 2015
785wafuyi.comShanghai Meicheng Technology Information Co., Ltd21 Nov 20146 Dec 202521 Nov 2026
786wafiyhz.comGoDaddy.com, LLC21 Nov 201421 Nov 201421 Nov 2015
787waf-transport.comBeijing Innovative Linkage Technology Ltd. dba dns…18 Nov 201021 Nov 201418 Nov 2015
788wafa-cliorscup.comNETIM SARL7 Oct 20146 Oct 20217 Oct 2026
789wafa-cliorscup.netNETIM SARL7 Oct 20146 Oct 20217 Oct 2026
790wafflingon.comWebfusion Ltd.7 Oct 20148 Oct 20257 Oct 2026
791wafflingon.orgNetwork Solutions, LLC8 Oct 201420 Dec 20248 Oct 2024
792wafi.infoWild West Domains, LLC15 Apr 202030 May 202515 Apr 2026
793waffenss.orgGoDaddy.com, LLC14 Jun 202029 Jul 202514 Jun 2027
794wafflefryclothing.comGoDaddy.com, LLC24 Sep 201424 Sep 201424 Sep 2017
795wafcclinics.infoGoDaddy.com, LLC25 Sep 20149 Nov 202525 Sep 2030
796wafcclinics.netGoDaddy.com, LLC25 Sep 201426 Sep 202525 Sep 2030
797wafflemakermart.comGoDaddy.com, LLC25 Sep 201425 Sep 201625 Sep 2017
798wafzdi.orgGMO Internet Inc.20 Nov 201420 Nov 201420 Nov 2015
799wafoof.org1&1 Internet AG20 Nov 2014-20 Nov 2015
800wafajamil.net-3 Feb 20263 Feb 20263 Feb 2027
801wafcclinics.orgGoDaddy.com, LLC25 Sep 20149 Nov 202525 Sep 2030
802waflightplan.orgFastDomain Inc.25 Sep 201425 Sep 201425 Sep 2015
803waffiler.comGoDaddy.com, LLC8 Oct 20148 Oct 20148 Oct 2015
804wafflelust.comNameCheap, Inc.25 Nov 202326 Oct 202525 Nov 2026
805wafiler.comGoDaddy.com, LLC8 Oct 20148 Oct 20148 Oct 2015
806wafsy.orgPDR Ltd. d/b/a PublicDomainRegistry.com8 Oct 20148 Oct 20148 Oct 2015
807waffookies.bizGoDaddy.com, LLC9 Oct 20149 Oct 20148 Oct 2015
808waferstrategiesllc.comDropCatch.com 1252 LLC9 Feb 201711 Feb 20179 Feb 2018
809wafgzic.comNetwork Solutions, LLC28 Sep 201429 Sep 201428 Sep 2015
810wafbjl.comNetwork Solutions, LLC28 Sep 201428 Sep 201428 Sep 2015
811waffor.comGoDaddy.com, LLC28 Sep 201411 Sep 202528 Sep 2026
812waferstrategiesllc.infoGoDaddy.com, LLC23 Nov 201423 Nov 201423 Nov 2016
813wafetmow.comOVH sas15 Oct 201415 Oct 201415 Oct 2015
814waftsguild.comeNom, Inc.15 Oct 201415 Oct 201415 Oct 2015
815wafizie.comGoDaddy.com, LLC24 Nov 201424 Nov 201424 Nov 2015
816wafiqhachemicals.comNetwork Solutions, LLC23 Nov 201423 Nov 201423 Nov 2015
817wafflledesign.comTucows Domains Inc.23 Nov 201422 Nov 202523 Nov 2026
818waffleos.comTurnCommerce, Inc. DBA NameBright.com10 Feb 20174 Feb 202110 Feb 2026
819wafflemenu.comName.com, Inc.24 Mar 20242 Jun 202524 Mar 2026
820wafer-li.comeNom, Inc.23 Nov 201423 Nov 201423 Nov 2015
821wafdxw.comHangzhou AiMing Network Co., LTD24 Nov 201424 Nov 201424 Nov 2015
822wafflessmp.netGoDaddy.com, LLC22 Nov 201422 Nov 201422 Nov 2015
823waferstrategiesllc.netGoDaddy.com, LLC23 Nov 201423 Nov 201423 Nov 2016
824wafus.comPSI-USA, Inc. dba Domain Robot18 Sep 20087 Nov 202518 Sep 2026
825wafflecim.comBeijing Lanhai Jiye Technology Co., Ltd3 Nov 20224 Jan 20253 Nov 2024
826wafflebuano.comTurnCommerce, Inc. DBA NameBright.com6 Feb 20196 Feb 20196 Feb 2020
827waferss.com-20 Jul 201620 Jul 201620 Jul 2017
828wafangzi.comBeijing Innovative Linkage Technology Ltd. dba dns…10 Oct 20147 Aug 201710 Oct 2017
829wafatours.comGoDaddy.com, LLC19 Aug 201919 Aug 201919 Aug 2020
830wafeldag.comTucows Domains Inc.10 Oct 201414 Oct 201510 Oct 2016
831waffen.proPorkbun, LLC1 Dec 20241 Dec 20241 Dec 2029
832waffiller.comGoDaddy.com, LLC11 Oct 201411 Oct 201411 Oct 2015
833wafforum.netKey-Systems GmbH10 Oct 201410 Oct 201410 Oct 2015
834wafforum.orgKey-Systems GmbH10 Oct 201410 Oct 201410 Oct 2015
835wafiller.comGoDaddy.com, LLC11 Oct 201411 Oct 201411 Oct 2015
836wafoot.netXin Net Technology Corporation12 May 201712 May 201712 May 2018
837waforum.netHostinger, UAB26 Jan 202230 Dec 202526 Jan 2027
838wafsfzpa.orgGMO Internet Inc.10 Oct 2014-10 Oct 2015
839wafubing.comNamesilo, LLC23 Jul 201924 Jul 201923 Jul 2020
840wafricalogistics.comGoDaddy.com, LLC17 Oct 201417 Oct 202517 Oct 2028
841wafflewasted.comregister.com, Inc.16 Oct 201416 Oct 201416 Oct 2015
842wafaindonesia.comHostinger, UAB16 Oct 201416 Oct 201416 Oct 2015
843wafablush.comGoDaddy.com, LLC16 Oct 201417 Oct 201416 Oct 2015
844waflightplan.comGoDaddy.com, LLC19 Dec 201619 Dec 201619 Dec 2017
845wafflecraft.comTurnCommerce, Inc. DBA NameBright.com25 Sep 201413 Nov 202425 Sep 2026
846waffle-innovators.comChengdu West Dimension Digital Technology Co., Ltd…14 Dec 201914 Dec 201914 Dec 2020
847wafcclinics.comGoDaddy.com, LLC25 Sep 201426 Sep 202525 Sep 2030
848waf3.comGoDaddy.com, LLC25 Sep 201426 Sep 202525 Sep 2026
849waftbox.comeNom, Inc.27 Sep 201427 Sep 201427 Sep 2015
850waffen-forum.neteNom, Inc.11 Oct 201412 Oct 201411 Oct 2015
851wafflesandvodka.comGoDaddy.com, LLC12 Oct 20141 Mar 202514 Jun 2027
852waffleos.netPDR Ltd. d/b/a PublicDomainRegistry.com23 Nov 201423 Nov 201423 Nov 2015
853wafirtravel.comHostinger, UAB3 Nov 202213 Dec 20233 Nov 2023
854wafiftytwoeighty.comGoDaddy.com, LLC25 Nov 201425 Nov 202525 Nov 2026
855waferspring.comNetraCorp LLC dba Global Internet24 Sep 200514 Oct 201524 Sep 2016
856waferinspectors.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
857waferinspector.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
858waferinspectiontools.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
859waferinspectiontool.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
860waferdefectdetection.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
861wafabeauty.comGoDaddy.com, LLC23 Jul 20232 Sep 202423 Jul 2024
862waffle-studio-designs.comGoDaddy.com, LLC12 Oct 201413 Oct 201612 Oct 2018
863wafflesepeti.comGoDaddy.com, LLC20 Mar 201720 Mar 201720 Mar 2018
864waffleorawful.comGoDaddy.com, LLC17 Oct 201429 Oct 201617 Oct 2017
865wafflebreakfast.comFastDomain Inc.18 Oct 20141 Dec 202418 Oct 2024
866waferstrategiesllc.orgGoDaddy.com, LLC23 Nov 201423 Nov 201423 Nov 2016
867wafpsm.comWild West Domains, LLC25 Nov 201426 Nov 202525 Nov 2026
868waffivibes.comTucows Domains Inc.17 Mar 202318 Mar 202517 Mar 2027
869wafacars.comOVH sas25 Nov 201425 Nov 201425 Nov 2015
870waffleorawffle.comGoDaddy.com, LLC18 Oct 201418 Oct 201418 Oct 2015
871waffalafel.comGoDaddy.com, LLC8 Jan 20268 Jan 20268 Jan 2027
872wafeeqa-realestate.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Oct 20148 Sep 202515 Oct 2026
873waffableweed.comGoDaddy.com, LLC15 Oct 201415 Oct 201415 Oct 2016
874wafflenut.comregister.com, Inc.2 Jun 20162 Jun 20162 Jun 2017
875wafflesbar.comGoDaddy.com, LLC14 Oct 201415 Oct 202514 Oct 2026
876wafiqmitrateknik.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…26 Oct 202226 Oct 202226 Oct 2023
877wafujian.orgCrazy Domains FZ-LLC14 Oct 20147 May 202514 Oct 2026
878waffenfuerrojava.orgGMO Internet Inc.3 Jan 20174 Jan 20183 Jan 2019
879wafoministries.netOVH sas24 Nov 201419 May 202524 Nov 2026
880wafiftytwoeighty.netGoDaddy.com, LLC25 Nov 201425 Nov 202525 Nov 2026
881wafgin.comGoDaddy.com, LLC20 Oct 201420 Oct 201420 Oct 2015
882wafersliver.comGoDaddy.com, LLC19 Oct 201419 Oct 201419 Oct 2015
883wafacosmetica.comeNom, Inc.19 Oct 201425 Jan 201719 Oct 2019
884wafflems.orgName.com, Inc.25 Nov 201425 Nov 201425 Nov 2015
885wafoundation.comTurnCommerce, Inc. DBA NameBright.com25 Nov 201419 Nov 202025 Nov 2026
886waforcerealty.com1&1 Internet AG3 May 20173 May 20173 May 2018
887waffleworkscatering.comNetwork Solutions, LLC26 Nov 201424 Nov 201626 Nov 2017
888wafflelolly.comAmazon Registrar, Inc.11 Jan 202012 Jan 202611 Jan 2026
889wafflecomic.comNetpia.com, Inc.26 Nov 201427 Dec 201526 Nov 2015
890waffleandpancakehouse.comGoDaddy.com, LLC28 Apr 20213 Aug 202328 Apr 2026
891waferhandlingsupplier.comThe Registrar Company B.V.26 Nov 201421 Mar 201726 Nov 2017
892waftular.infoCrazy Domains FZ-LLC19 Oct 201420 Oct 201419 Oct 2015
893wafml.comDropCatch.com 1279 LLC7 Jun 20207 Jun 20207 Jun 2021
894waffleheater.comHosting Concepts B.V. dba Openprovider27 Nov 201411 Dec 202527 Nov 2026
895wafflaki.com1&1 Internet AG16 Sep 202317 Sep 202516 Sep 2026
896waftinginternational.comGoDaddy.com, LLC28 Nov 201420 Oct 202528 Nov 2026
897wafstudy.comHiChina Zhicheng Technology Limited28 Nov 201428 Nov 201428 Nov 2015
898wafiya.comGoDaddy.com, LLC10 Jul 201611 Jul 202510 Jul 2026
899wafflecloud.comMegazone Corp., dba HOSTING.KR29 Nov 201421 Nov 202529 Nov 2026
900wafermessenger.comNetwork Solutions, LLC28 Nov 201429 Oct 202528 Nov 2026
901wafobel.comBeijing Lanhai Jiye Technology Co., Ltd17 Aug 202218 Aug 202417 Aug 2025
902wafflemakercorner.comDOMAIN NAME NETWORK PTY LTD2 May 202413 Jun 20252 May 2025
903wafflehotdog.comGoDaddy.com, LLC1 May 202313 Jul 20251 May 2025
904wafflehigh.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2015
905wafflehi.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2015
906waffesforbreakfast.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2016
907waffercard.comeNom, Inc.29 Nov 201430 Nov 201429 Nov 2015
908waferlabuga.comregister.com, Inc.30 Nov 201430 Nov 201430 Nov 2016
909wafflecloud.netMegazone Corp., dba HOSTING.KR29 Nov 201421 Nov 202529 Nov 2026
910wafflenarlidere.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Nov 20141 Dec 201430 Nov 2015
911wafflecitynarlidere.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Nov 20141 Dec 201430 Nov 2015
912waffleanime.comGoDaddy.com, LLC1 Dec 20141 Dec 20141 Dec 2015
913wafar-dmo3k.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2015
914wafobel.orgAscio Technologies, Inc. Danmark - Filial af Ascio…29 Nov 2014-29 Nov 2015
915wafobel.netAscio Technologies, Inc. Danmark - Filial af Ascio…29 Nov 201429 Nov 201429 Nov 2015
916wafflesandwedges.com-22 Aug 201622 Aug 201622 Aug 2017
917wafhqxsylzq.bizPDR Ltd. d/b/a PublicDomainRegistry.com2 Dec 20142 Dec 20141 Dec 2015
918wafflesinterviewprep.comHebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.…2 Dec 20142 Dec 20142 Dec 2015
919wafflertruck.comGoDaddy.com, LLC3 Dec 20143 Dec 20163 Dec 2017
920waffleci.comTurnCommerce, Inc. DBA NameBright.com6 May 201711 Nov 20256 May 2026
921waferlab.orgCommuniGal Communication Ltd.7 Apr 202512 Apr 20257 Apr 2026
922waffleman.netGoDaddy.com, LLC27 Jun 20228 Sep 202427 Jun 2024
923wafling.comCrazy Domains FZ-LLC3 Dec 20143 Dec 20143 Dec 2015
924wafarmers.comGoDaddy.com, LLC9 Jan 202129 Dec 20259 Jan 2027
925wafajamil.comNameKing.com Inc.8 May 20208 May 20208 May 2021
926wafa-benromdan.comOVH sas3 Dec 20146 Dec 20153 Dec 2016
927waftersbenefitsnow.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Dec 20144 Dec 20144 Dec 2015
928wafflesincaffeinated.comWix.com Ltd.4 Dec 201410 Nov 20254 Dec 2026
929wafesoftware.comGandi SAS4 Dec 20144 Dec 20144 Dec 2015
930wafarmers.orgeNom, Inc.3 Dec 201420 Mar 20173 Dec 2017
931waffleshop.netGoDaddy.com, LLC31 Mar 202531 Mar 202531 Mar 2028
932waffengesetz.info1&1 Internet AG11 Jan 202311 Jan 202611 Jan 2027
933wafolicious.comWild West Domains, LLC5 Dec 20145 Dec 20145 Dec 2015
934wafflelafel.comGoDaddy.com, LLC5 Dec 20145 Dec 20145 Dec 2015
935waffenschmitz.com1&1 Internet AG5 Dec 20145 Dec 20145 Dec 2015
936wafdbmfu9ih.comGMO Internet Inc.5 Dec 20146 Dec 20145 Dec 2015
937wafd300.comGoDaddy.com, LLC5 Dec 20145 Dec 20145 Dec 2016
938wafalafel.com1&1 Internet AG27 Feb 201727 Feb 201727 Feb 2026
939waffle-crete.comDNC Holdings, Inc.28 Oct 199729 Oct 202527 Oct 2026
940waffleheart.orgTucows Domains Inc.1 Dec 20105 Dec 20141 Dec 2015
941wafmarketing.comNameCheap, Inc.10 Apr 202422 May 202510 Apr 2025
942wafholdings.comSquarespace Domains LLC6 Jul 202521 Jul 20256 Jul 2027
943wafgcwrouzlm.comGMO Internet Inc.8 Dec 20148 Dec 20148 Dec 2015
944waffle-kitchen.com1&1 Internet AG10 Jun 201710 Jun 201710 Jun 2026
945wafeekpor.comAscio Technologies, Inc. Danmark - Filial af Ascio…8 Dec 20148 Dec 20148 Dec 2015
946waffhbd.orgPDR Ltd. d/b/a PublicDomainRegistry.com7 Dec 20147 Dec 20147 Dec 2015
947wafmarketing.infoGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
948wafholdings.infoGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
949wafflehousediary.comGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2016
950wafw.netGoDaddy.com, LLC14 May 201714 May 201714 May 2018
951wafmarketing.netGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
952wafholdings.netGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
953wafflepress.orgGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
954wafycollege.comGoDaddy.com, LLC7 Feb 20177 Feb 20177 Feb 2019
955wafflelo.comGabia, Inc.5 Dec 200810 Dec 20145 Dec 2015
956wafangdianxw.comChengdu West Dimension Digital Technology Co., Ltd…29 May 201929 May 201929 May 2020
957wafmarketing.orgGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
958wafholdings.orgGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
959waffenschrank-heunert.infounited-domains AG11 Dec 201425 Jan 202611 Dec 2026
960waffar.infoNameCheap, Inc.28 May 2025--
961wafuelmandate.comGoDaddy.com, LLC11 Dec 201411 Dec 201411 Dec 2015
962waffletalks.comGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2016
963waffenschrank-heunert.comunited-domains AG11 Dec 201418 Jan 202611 Dec 2026
964waffenschrank-heunert.bizunited-domains AG11 Dec 201425 Jan 202610 Dec 2026
965wafer-it.comTucows Domains Inc.11 Dec 201415 Dec 201911 Dec 2019
966wafsh.com-24 Nov 201324 Nov 201325 Nov 2028
967waffleton.comGoDaddy.com, LLC12 Dec 201421 Nov 202412 Dec 2033
968wafflecraze.comTurnCommerce, Inc. DBA NameBright.com12 Dec 201413 Nov 202412 Dec 2026
969waffenschrank-heunert.netunited-domains AG11 Dec 20142 Feb 202611 Dec 2026
970wafupdates.comKey-Systems GmbH13 Dec 201414 Dec 201413 Dec 2015
971wafflejam.comSquarespace Domains LLC20 Nov 20235 Nov 202520 Nov 2026
972waffle123.comDOMAIN NAME NETWORK PTY LTD23 Oct 20245 Dec 202523 Oct 2025
973waffenfuzzi.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
974wafaflowers.comDropCatch.com 425 LLC14 Dec 201415 Dec 201614 Dec 2017
975wafaa.netGoDaddy.com, LLC14 Dec 201424 Nov 202514 Dec 2026
976wafukuaishan.comXin Net Technology Corporation15 Dec 201415 Dec 201415 Dec 2015
977waflcolts.comeNom, Inc.16 Dec 201416 Dec 201416 Dec 2015
978wafcw.comBeijing Lanhai Jiye Technology Co., Ltd15 Dec 201417 Feb 202615 Dec 2026
979wafrost.bizNetwork Solutions, LLC16 Dec 201422 Oct 201915 Dec 2020
980wafriconline.comGoogle, Inc.10 Dec 200711 Dec 201710 Dec 2018
981waffrewards.comLaunchpad, Inc.16 Dec 201416 Dec 201416 Dec 2015
982wafflesquadron.comTucows Domains Inc.13 Dec 200517 Dec 201413 Dec 2015
983wafflerestaurantchicago.comGoDaddy.com, LLC16 Dec 201416 Dec 201416 Dec 2015
984wafeel.comHiChina Zhicheng Technology Limited15 Jun 201816 Jun 202515 Jun 2026
985wafrost.infoNetwork Solutions, LLC16 Dec 201417 Oct 201916 Dec 2020
986wafrost.us-16 Dec 201417 Oct 201615 Dec 2017
987wafrost.orgNetwork Solutions, LLC16 Dec 201417 Oct 201616 Dec 2017
988wafrost.netNetwork Solutions, LLC16 Dec 20145 Mar 201716 Dec 2017
989wafeel.netHiChina Zhicheng Technology Limited16 Dec 201416 Dec 201416 Dec 2017
990wafflezandwings.comGoDaddy.com, LLC18 Dec 201418 Dec 201418 Dec 2015
991wafios-wpt.comDeutsche Telekom AG19 Dec 201427 Dec 201619 Dec 2017
992wafios-wpt.bizDeutsche Telekom AG19 Dec 20142 Feb 202018 Dec 2020
993wafexusa.comGoDaddy.com, LLC19 Dec 201421 Dec 202519 Dec 2026
994wafestivaloflaughs.comMarcaria.com International, Inc.19 Dec 201419 Dec 201419 Dec 2016
995wafricandevelopmentministries.orgregister.com, Inc.18 Dec 20143 Dec 201618 Dec 2018
996waflayer.com-11 Mar 202511 Mar 202511 Mar 2026
997wafiazizsattar.comGoDaddy.com, LLC20 Dec 201420 Dec 201420 Dec 2015
998wafflecouple.comHiChina Zhicheng Technology Limited20 Dec 201420 Dec 201420 Dec 2015
999wafiazizsattar.netGoDaddy.com, LLC20 Dec 201420 Dec 201420 Dec 2015
1000waffleandmore.comNameCheap, Inc.15 Feb 202116 Jan 202615 Feb 2027

Displaying 1,000 out of 30,656 domains starting with the keyword "WAF". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=waf

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now