Our database now contains whois records of 642 Million (642,077,338) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [642 Million Domains] $10,000 Details

Keyword: VINTEK

Reverse Whois » KEYWORD [vintek ]  { 142 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1vintek.techNameCheap, Inc.15 Sep 201621 Oct 201715 Sep 2017
2vintek.inGoDaddy.com, LLC26 Dec 20233 Jun 202526 Dec 2025
3vintek.comCSC Corporate Domains, Inc.10 Dec 19965 Dec 20249 Dec 2025
4vintek.netGoDaddy.com, LLC2 Apr 199828 Oct 20241 Apr 2026
5vintek.it-7 Oct 201623 Oct 20247 Oct 2025
6vintek.siteNameCheap, Inc.16 Sep 201716 Sep 201716 Sep 2018
7vintek.infoThe Registrar Company B.V.28 Nov 2017-28 Nov 2018
8vintek.storeGoDaddy.com, LLC2 Sep 2025-2 Sep 2026
9vintek.spaceBeget LLC16 Apr 202021 Apr 202016 Apr 2021
10vintek.coNameKing.com Inc.23 Jul 202428 Jul 202523 Jul 2025
11vintek.usALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED10 Feb 20254 Jun 202510 Feb 2026
12vintek.xyzChengdu West Dimension Digital Technology Co., Ltd…7 Dec 202416 Dec 20247 Dec 2025
13vintek.com.au--4 Aug 2025-
14vintek.my.id-9 Jan 20239 Jan 20239 Jan 2024
15vintek.cl-24 Mar 2011-19 Apr 2026
16vintek.com.br-8 Apr 201727 Feb 20258 Apr 2026
17vintek.co.in-21 Dec 201030 Dec 202421 Dec 2026
18vintek.nl-5 Jan 20131 Jul 2025-
19vintek.orgWild West Domains, LLC26 Nov 201710 Jan 202526 Nov 2027
20vintek.co.uk-22 Sep 202022 Sep 202522 Sep 2026
21vintek.uk-17 Jul 202017 Jul 202517 Jul 2026
22vintek.ru-2 Sep 2010-2 Sep 2026
23vintek.funOVH sas5 Jul 20251 Aug 20255 Jul 2027
24vintek.su-7 Nov 2024-7 Nov 2025
25vintek.fr-8 Mar 20247 Mar 20258 Mar 2025
26vintek.plNamware.com, Inc.2 Jul 20248 Jul 20252 Jul 2026
27vintek.se-11 Aug 20241 Jun 202511 Aug 2026
28vintek.id-8 May 2023-8 May 2025
29vintek.eu----
30vintek.de--12 May 2025-
31vintek.proLimited Liability Company "Registrar of domain nam…25 Sep 2025-25 Sep 2026
32vintekinc.comGoDaddy.com, LLC19 May 202030 Jun 202419 May 2024
33vinteko-china.com-27 Oct 202430 Oct 202427 Oct 2025
34vinteko.comAscio Technologies, Inc. Danmark - Filial af Ascio…5 Mar 200624 Jul 20255 Mar 2026
35vintekit.comGoDaddy.com, LLC22 Dec 201423 Dec 202422 Dec 2026
36vinteko.xyzXin Net Technology Corporation26 Dec 202213 Sep 202326 Dec 2027
37vintekno.comNameCheap, Inc.23 Sep 201730 Sep 202423 Sep 2025
38vinteksystem.comGMO Internet Inc.4 Sep 20245 Sep 20254 Sep 2025
39vintekcellars.comGoDaddy.com, LLC17 Mar 202128 Apr 202517 Mar 2025
40vintekan.net----
41vintekss.comLaunchpad, Inc.7 May 201518 Jun 20177 May 2017
42vintekchemicalsproducts.comInfocom Network Ltd.15 May 201515 May 201515 May 2016
43vintekasinc.comTucows Domains Inc.18 May 201422 May 201518 May 2016
44vintek-innovation.comFastDomain Inc.15 Sep 201515 Sep 201615 Sep 2017
45vintekshop.comAtak Domain Hosting Internet d/b/a Atak Teknoloji19 Nov 201524 Nov 202419 Nov 2025
46vintekproducts.comGoDaddy.com, LLC3 Dec 20153 Dec 20153 Dec 2017
47vinteknutrition.biz1&1 Internet AG12 Sep 201127 Oct 202411 Sep 2025
48vinteka.com-12 Oct 202423 Jul 202512 Oct 2025
49vinteknutrition.com1&1 Internet AG9 Apr 201010 Apr 20179 Apr 2026
50vintektime.comCSC Corporate Domains, Inc.24 Mar 200514 Feb 202324 Mar 2031
51vintekled.comWebfusion Ltd.6 Aug 202219 Sep 20236 Aug 2023
52vintekfinancial.comGoDaddy.com, LLC21 Feb 202022 Feb 202521 Feb 2027
53vintekhotrodparts.comGoDaddy.com, LLC24 Nov 20094 Sep 201224 Nov 2021
54vintekltd.comTucows Domains Inc.1 Apr 201313 May 20241 Apr 2027
55vinteks.comregister.com, Inc.24 Apr 200125 Mar 202324 Apr 2026
56vintekcellar.comGoDaddy.com, LLC16 Feb 201217 Feb 201416 Feb 2018
57vintekgroup.comNetwork Solutions, LLC22 Nov 200510 Nov 202422 Nov 2025
58vintekcontrols.comNetwork Solutions, LLC14 Sep 200711 Sep 202314 Sep 2026
59vintekportal.comNetwork Solutions, LLC4 Feb 201430 Aug 20174 Feb 2020
60vintekcommunications.comGoDaddy.com, LLC3 May 20054 May 20163 May 2017
61vintekcontrolsystems.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Mar 201417 Mar 202518 Mar 2026
62vintek-nutrition.com1&1 Internet AG28 Mar 201113 Apr 201828 Mar 2026
63vintekmedical.comTucows Domains Inc.30 Mar 20101 Mar 202530 Mar 2026
64vinteknutrition.info1&1 Internet AG12 Sep 201112 Sep 202512 Sep 2026
65vinteknutrition.mobi1&1 Internet AG12 Sep 201112 Sep 202512 Sep 2026
66vinteknutrition.net1&1 Internet AG12 Sep 201115 Dec 201712 Sep 2026
67vinteknutrition.org1&1 Internet AG12 Sep 201112 Sep 202512 Sep 2026
68vintekoor.be-29 Jun 2025--
69vintekin.comInternet Domain Services BS Corp3 Jan 20173 Jan 20173 Jan 2018
70vinteky.comRegister.it SPA5 Jun 20228 Jul 20235 Jun 2023
71vintek-cn.comDomain.com, LLC3 Feb 20171 Apr 20173 Feb 2018
72vinteksol.comGoDaddy.com, LLC20 Feb 201720 Feb 201720 Feb 2022
73vintekcn.comWix.com Ltd.21 Nov 202322 Jun 202421 Nov 2025
74vintekpharma.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Mar 20178 Mar 202523 Mar 2026
75vinteksolutions.comGoDaddy.com, LLC9 Apr 202110 Apr 20259 Apr 2026
76vintekpharmaceuticals.comGoDaddy.com, LLC27 Apr 201727 Apr 201727 Apr 2018
77vinteknature.comPDR Ltd. d/b/a PublicDomainRegistry.com16 May 201716 Jul 201716 May 2018
78vintekelektronik.comFBS Inc.17 Jul 201717 Jul 201717 Jul 2018
79vintekllc.comNameCheap, Inc.26 Jul 201726 Jun 202526 Jul 2026
80vintektime.netNetwork Solutions, LLC5 Sep 20175 Sep 20175 Sep 2018
81vintektest.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Sep 201715 Sep 201715 Sep 2018
82vintekco.comMat Bao Trading & Service Company Limited d/b/a Ma…18 Dec 201720 May 202318 Dec 2025
83vintekgadgets.comTucows Domains Inc.4 Apr 20188 Apr 20204 Apr 2020
84vinteknoloji.comDNC Holdings, Inc.9 Jul 20189 Jul 20189 Jul 2019
85vinteka.infoGoDaddy.com, LLC16 Sep 201815 Nov 201816 Sep 2019
86vinteko.infoLimited Liability Company "Registrar of domain nam…18 Sep 201818 Sep 201818 Sep 2019
87vintekland.comFastDomain Inc.2 Jan 20233 Jan 20242 Jan 2025
88vintekindia.comGoDaddy.com, LLC23 Jan 202523 Jan 202523 Jan 2030
89vinteko.siteHosting Ukraine LLC13 Nov 2018-13 Nov 2019
90vintekglobal.comMasterofmydomains.net LLC10 May 202323 Jun 202410 May 2024
91vintekchemicalproducts.comTucows Domains Inc.26 Feb 20199 May 202326 Feb 2023
92vintekvn.comTucows Domains Inc.25 Oct 202425 Oct 202425 Oct 2025
93vinteknatureresource.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Aug 201922 Aug 201922 Aug 2020
94vinteksmarthomes.comGoDaddy.com, LLC28 Sep 201928 Sep 201928 Sep 2020
95vinteksmarthomesolutions.comGoogle, Inc.19 Oct 20194 Nov 201919 Oct 2020
96vinteksolution.comHostinger, UAB7 Nov 201912 Oct 20247 Nov 2025
97vintekvitrifiedprivitedlimited.comGoogle, Inc.1 Dec 20191 Dec 20191 Dec 2020
98vintekvitrified.comGoDaddy.com, LLC11 Dec 201911 Dec 201911 Dec 2020
99vintekvietnam.comGoogle, Inc.17 Mar 20202 Apr 202017 Mar 2021
100vintekplywood.comP.A. Viet Nam Company Limited31 Mar 202031 Mar 202031 Mar 2021
101vintekaquatics.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Oct 202028 Oct 202028 Oct 2021
102vintekcastings.comGoogle, Inc.9 Dec 202024 Nov 20249 Dec 2025
103vintekbiotech.comNameCheap, Inc.19 Aug 202120 Aug 202519 Aug 2026
104vintekltd.infoNamesilo, LLC28 Apr 202228 Apr 202328 Apr 2024
105vintekk.ma-3 Feb 20194 Jan 20253 Feb 2026
106vinteknik.comCV. Rumahweb Indonesia19 Sep 202231 Oct 202319 Sep 2023
107vinteks.onlineLimited Liability Company "Registrar of domain nam…4 Oct 20224 Oct 20224 Oct 2023
108vinteks.xyzReg2C.com Inc.4 Nov 20225 Nov 20244 Nov 2025
109vinteko.techXin Net Technology Corporation26 Dec 202231 Aug 202326 Dec 2027
110vinteko.pressXin Net Technology Corporation26 Dec 202231 Aug 202326 Dec 2027
111vinteko.netXin Net Technology Corporation26 Dec 202226 Dec 202226 Dec 2027
112vinteko.com.cn-16 Jul 2025-16 Jul 2026
113vintekbank.comLigne Web Services SARL8 Jun 20248 Jun 20248 Jun 2026
114vintekonto.comInternet Domain Services BS Corp26 Feb 20237 May 202426 Feb 2024
115vintekk.comGoDaddy.com, LLC9 Mar 202310 Mar 20259 Mar 2027
116vintekdrillbitsharpener.storeCrazy Domains FZ-LLC13 Mar 20234 Nov 202413 Mar 2025
117vintekdrillbitsharpener.comCrazy Domains FZ-LLC13 Mar 202326 Apr 202513 Mar 2025
118vintekyapi.comİsimtescil Bilişim A.Ş.21 Jan 20202 Dec 202421 Jan 2026
119vintekpharma.inNamesilo, LLC30 Nov 20222 Jan 202430 Nov 2023
120vintekbd.comNameCheap, Inc.18 Apr 202330 Jun 202418 Apr 2024
121vintekprofessionaldrillbitsharpener.comCrazy Domains FZ-LLC26 Apr 202326 Apr 202326 Apr 2025
122vintekprofessionaldrillbitsharpener.onlineCrazy Domains FZ-LLC26 Apr 202323 Apr 202426 Apr 2025
123vintek-group.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Oct 202315 Apr 20255 Oct 2027
124vintekpro.comHosting Concepts B.V. dba Openprovider29 Feb 202410 May 202528 Feb 2025
125vinteks.coNamesilo, LLC16 Nov 20167 Nov 202415 Nov 2025
126vinteka.ru-23 Jun 2021-23 Jun 2026
127vintekh.ru-10 Sep 2024-10 Sep 2025
128vintek-2001.ru-14 May 2015-14 May 2025
129vinteko.ru-27 Nov 2017-27 Nov 2025
130vinteks.ru-4 Oct 2022-4 Oct 2025
131vinteks.eu----
132vintektimes.comWild West Domains, LLC23 Aug 202429 Aug 202423 Aug 2025
133vintekh.comGoDaddy.com, LLC21 Dec 202421 Dec 202421 Dec 2027
134vintekstand.comHostinger, UAB6 Feb 20256 Feb 20256 Feb 2026
135vintekfun.netOVH sas14 Feb 202514 Feb 202514 Feb 2026
136vintek7.comGoDaddy.com, LLC17 Feb 202517 Feb 202517 Feb 2028
137vintekrealtors.comGoDaddy.com, LLC29 Apr 202529 Apr 202529 Apr 2026
138vinteknologi.comWeb Commerce Communications Limited dba WebNic.cc9 May 20253 Oct 20249 May 2026
139vintekopro.ru-16 May 2025-16 May 2026
140vinteksystem.siteGMO Internet Inc.27 Jun 20252 Jul 202527 Jun 2026
141vintekco.netCosmotown, Inc.9 Jul 20259 Jul 20259 Jul 2026
142vinteksms.comNameCheap, Inc.25 Sep 202525 Sep 202525 Sep 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=vintek

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now