With support for 
Keyword: VALENTINES
Reverse Whois » KEYWORD [valentines ] { 5,582 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | valentines.boutique | 1&1 Internet AG | 2 Jan 2024 | 16 Feb 2025 | 2 Jan 2026 |
| 2 | valentines.xyz | Dynadot, LLC | 7 May 2020 | 20 Aug 2025 | 7 May 2027 |
| 3 | valentines.pictures | Go China Domains, LLC | 23 Jul 2014 | 14 Jun 2025 | 23 Jul 2026 |
| 4 | valentines.soy | Name.com, Inc. | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 5 | valentines.london | Minds + Machines Registrar Limited | 23 Oct 2014 | 5 Dec 2014 | 23 Oct 2015 |
| 6 | valentines.nyc | GoDaddy.com, LLC | 24 Jul 2024 | 20 Oct 2025 | 24 Jul 2026 |
| 7 | valentines.supply | eNom, Inc. | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 8 | valentines.property | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 9 | valentines.wtf | eNom, Inc. | 1 Apr 2015 | 22 Mar 2020 | 1 Apr 2021 |
| 10 | valentines.wales | Mesh Digital Limited | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 11 | valentines.flowers | CSC Corporate Domains, Inc. | 7 Apr 2015 | 24 Mar 2025 | 7 Apr 2026 |
| 12 | valentines.toys | NameCheap, Inc. | 2 Mar 2021 | 7 Mar 2021 | 2 Mar 2022 |
| 13 | valentines.pics | Dynadot, LLC | 11 Aug 2022 | 12 Aug 2024 | 11 Aug 2025 |
| 14 | valentines.click | eNom, Inc. | 27 Jan 2018 | 1 Feb 2018 | 27 Jan 2019 |
| 15 | valentines.run | NameCheap, Inc. | 29 Jul 2019 | 29 Jun 2025 | - |
| 16 | valentines.florist | CSC Corporate Domains, Inc. | 20 Aug 2015 | - | 20 Aug 2026 |
| 17 | valentines.us | - | 27 Feb 2023 | 30 Mar 2025 | 27 Feb 2026 |
| 18 | valentines.wedding | Uniregistrar Corp | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 19 | valentines.work | GoDaddy.com, LLC | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 20 | valentines.cards | Uniregistrar Corp | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2016 |
| 21 | valentines.direct | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Jan 2016 | 22 Feb 2017 | 8 Jan 2018 |
| 22 | valentines.jewelry | NameCheap, Inc. | 15 Aug 2021 | 16 Jul 2025 | - |
| 23 | valentines.win | Alpnames Limited | 10 Feb 2016 | - | 9 Feb 2017 |
| 24 | valentines.com | Domain.com, LLC | 10 Sep 1995 | 20 Aug 2025 | 9 Sep 2026 |
| 25 | valentines.vip | united-domains AG | 5 Apr 2019 | 30 Sep 2025 | 5 Apr 2026 |
| 26 | valentines.mom | CSC Corporate Domains, Inc. | 3 May 2016 | 27 Apr 2025 | 3 May 2026 |
| 27 | valentines.pink | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 28 | valentines.party | SafeNames Ltd. | 18 Feb 2015 | 14 Oct 2025 | 17 Feb 2026 |
| 29 | valentines.delivery | Uniregistrar Corp | 11 Feb 2016 | 8 Feb 2020 | 11 Feb 2021 |
| 30 | valentines.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 6 May 2021 | 4 Jun 2025 | 6 May 2026 |
| 31 | valentines.email | Porkbun, LLC | 18 Jul 2025 | 18 Jul 2025 | 18 Jul 2026 |
| 32 | valentines.tips | GoDaddy.com, LLC | 26 Feb 2014 | 12 Apr 2017 | 26 Feb 2018 |
| 33 | valentines.limo | GoDaddy.com, LLC | 14 Mar 2014 | 17 Mar 2017 | 14 Mar 2018 |
| 34 | valentines.ninja | GoDaddy.com, LLC | 11 Feb 2016 | 2 May 2016 | 11 Feb 2017 |
| 35 | valentines.codes | 101domain, Inc. | 16 Apr 2014 | 16 Apr 2024 | 16 Apr 2025 |
| 36 | valentines.lol | - | 13 Nov 2025 | 13 Nov 2025 | 13 Nov 2026 |
| 37 | valentines.gifts | CSC Corporate Domains, Inc. | 4 Nov 2014 | 5 Oct 2024 | 4 Nov 2025 |
| 38 | valentines.sexy | Uniregistrar Corp | 25 Feb 2014 | 2 Feb 2017 | 25 Feb 2018 |
| 39 | valentines.solutions | CSC Corporate Domains, Inc. | 28 Mar 2014 | - | 28 Mar 2026 |
| 40 | valentines.gift | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 41 | valentines.photo | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 42 | valentines.biz | GoDaddy.com, LLC | 27 Mar 2002 | 7 May 2025 | 26 Mar 2025 |
| 43 | valentines.space | Gandi SAS | 3 Aug 2016 | 11 Aug 2017 | 3 Aug 2018 |
| 44 | valentines.one | Google, Inc. | 30 Apr 2023 | 5 May 2023 | 30 Apr 2024 |
| 45 | valentines.date | Alpnames Limited | 22 Sep 2016 | 22 Sep 2017 | 21 Sep 2017 |
| 46 | valentines.co.nz | - | 14 Jan 1998 | 12 Mar 2023 | - |
| 47 | valentines.info | PSI-USA, Inc. dba Domain Robot | 10 Jul 2009 | 2 Sep 2025 | 13 Jul 2026 |
| 48 | valentines.mobi | Wild West Domains, LLC | 21 Dec 2011 | 4 Feb 2025 | 21 Dec 2025 |
| 49 | valentines.ltd | GoDaddy.com, LLC | 18 Jan 2024 | 1 Mar 2025 | 18 Jan 2025 |
| 50 | valentines.cat | SW Hosting & Communications Technologies SL dba Se… | 27 May 2020 | 2 Jul 2024 | 27 May 2024 |
| 51 | valentines.flights | eNom, Inc. | 14 Oct 2016 | 29 Sep 2017 | 14 Oct 2018 |
| 52 | valentines.deals | eNom, Inc. | 14 Oct 2016 | 18 Oct 2017 | 14 Oct 2018 |
| 53 | valentines.net | Network Solutions, LLC | 17 Jul 1997 | 17 May 2022 | 16 Jul 2027 |
| 54 | valentines.express | GoDaddy.com, LLC | 20 Oct 2016 | 1 Dec 2017 | 20 Oct 2017 |
| 55 | valentines.org | eNom, Inc. | 30 Sep 1997 | 28 May 2024 | 29 Sep 2026 |
| 56 | valentines.it | - | 5 Nov 2001 | 10 Dec 2025 | 9 Dec 2025 |
| 57 | valentines.org.uk | - | 31 Jan 2004 | 29 Jan 2024 | 31 Jan 2026 |
| 58 | valentines.guru | eNom, Inc. | 25 Nov 2016 | 6 Feb 2018 | 25 Nov 2017 |
| 59 | valentines.cloud | NameCheap, Inc. | 8 Mar 2024 | 23 Mar 2024 | 8 Mar 2026 |
| 60 | valentines.group | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Jul 2024 | 28 Jul 2025 | 28 Jul 2026 |
| 61 | valentines.pet | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Feb 2019 | 16 Mar 2019 | 28 Feb 2020 |
| 62 | valentines.agency | NameCheap, Inc. | 2 Oct 2025 | - | - |
| 63 | valentines.co.uk | - | 18 Sep 1996 | 19 Sep 2025 | 18 Sep 2026 |
| 64 | valentines.gold | Porkbun, LLC | 11 Nov 2019 | 16 Nov 2019 | 11 Nov 2020 |
| 65 | valentines.restaurant | GoDaddy.com, LLC | 12 Apr 2018 | 13 Apr 2020 | 12 Apr 2021 |
| 66 | valentines.coffee | GoDaddy.com, LLC | 18 Aug 2018 | 18 Aug 2018 | 18 Aug 2019 |
| 67 | valentines.recipes | NameCheap, Inc. | 20 Dec 2018 | 20 Dec 2018 | 20 Dec 2019 |
| 68 | valentines.services | Namesilo, LLC | 23 Jan 2019 | 23 Jan 2019 | 23 Jan 2020 |
| 69 | valentines.today | GoDaddy.com, LLC | 10 Jan 2024 | 21 Feb 2025 | 10 Jan 2025 |
| 70 | valentines.help | Network Solutions, LLC | 12 Mar 2019 | 12 Mar 2019 | 12 Mar 2020 |
| 71 | valentines.diamonds | Porkbun, LLC | 11 Nov 2019 | 16 Nov 2019 | 11 Nov 2020 |
| 72 | valentines.network | Uniregistrar Corp | 12 Feb 2020 | 17 Feb 2020 | 12 Feb 2021 |
| 73 | valentines.life | GoDaddy.com, LLC | 9 Mar 2020 | 20 May 2025 | 9 Mar 2025 |
| 74 | valentines.world | CommuniGal Communication Ltd. | 8 Mar 2025 | 13 Mar 2025 | 8 Mar 2026 |
| 75 | valentines.zone | GoDaddy.com, LLC | 1 Sep 2020 | 1 Sep 2020 | 1 Sep 2021 |
| 76 | valentines.blue | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 77 | valentines.bid | GoDaddy.com, LLC | 19 Aug 2023 | 20 Oct 2025 | 19 Aug 2026 |
| 78 | valentines.media | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 79 | valentines.photos | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 80 | valentines.house | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 81 | valentines.clothing | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 82 | valentines.green | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 83 | valentines.photography | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 84 | valentines.uk | - | 5 Jul 2019 | 19 Oct 2025 | 5 Jul 2026 |
| 85 | valentines.club | GoDaddy.com, LLC | 18 Jan 2021 | 18 Jan 2021 | 18 Jan 2022 |
| 86 | valentines.dog | NameCheap, Inc. | 20 Jan 2021 | 20 Jan 2021 | 20 Jan 2022 |
| 87 | valentines.pizza | NameCheap, Inc. | 17 Feb 2021 | 17 Feb 2021 | 17 Feb 2022 |
| 88 | valentines.men | NameCheap, Inc. | 24 Feb 2021 | 25 Feb 2021 | 24 Feb 2022 |
| 89 | valentines.beauty | NameCheap, Inc. | 26 May 2022 | 6 Aug 2023 | 26 May 2023 |
| 90 | valentines.makeup | NameCheap, Inc. | 6 Mar 2021 | 6 Mar 2021 | 6 Mar 2022 |
| 91 | valentines.school | NameCheap, Inc. | 31 Mar 2021 | 31 Mar 2021 | 31 Mar 2022 |
| 92 | valentines.pro | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Sep 2024 | 11 Oct 2024 | 27 Sep 2025 |
| 93 | valentines.day | CSC Corporate Domains, Inc. | 18 Jan 2022 | - | 18 Jan 2026 |
| 94 | valentines.asia | Key-Systems GmbH | 10 Jun 2008 | 20 Jul 2024 | 10 Jun 2024 |
| 95 | valentines.best | Tucows Domains Inc. | 19 Dec 2023 | 23 Dec 2024 | 19 Dec 2025 |
| 96 | valentines.buzz | Namesilo, LLC | 8 Feb 2022 | 13 Feb 2022 | 8 Feb 2023 |
| 97 | valentines.gay | NameCheap, Inc. | 28 Jul 2025 | 26 Sep 2025 | 28 Jul 2026 |
| 98 | valentines.dance | Porkbun, LLC | 20 Apr 2022 | 6 May 2025 | 20 Apr 2026 |
| 99 | valentines.earth | GoDaddy.com, LLC | 12 Jan 2020 | 14 Oct 2025 | 12 Jan 2026 |
| 100 | valentines.games | GoDaddy.com, LLC | 21 Sep 2016 | 2 Nov 2025 | 21 Sep 2025 |
| 101 | valentines.how | Automattic Inc. | 8 Jul 2022 | 13 Jul 2025 | 8 Jul 2026 |
| 102 | valentines.ie | - | 22 Feb 2010 | 8 Apr 2025 | 22 Feb 2026 |
| 103 | valentines.monster | NameCheap, Inc. | 7 Nov 2022 | 1 Nov 2025 | 7 Nov 2026 |
| 104 | valentines.nl | - | 5 Dec 2004 | 8 Dec 2024 | - |
| 105 | valentines.pl | - | 21 Aug 2025 | 21 Aug 2025 | 21 Aug 2026 |
| 106 | valentines.chat | Dynadot, LLC | 21 Dec 2023 | 21 Dec 2025 | 21 Dec 2026 |
| 107 | valentines.lat | Namesilo, LLC | 27 Mar 2024 | 30 Apr 2025 | 27 Mar 2025 |
| 108 | valentines.pt | - | - | - | - |
| 109 | valentines.co | GoDaddy.com, LLC | 21 Jul 2010 | 16 Jul 2025 | 20 Jul 2026 |
| 110 | valentines.io | NameKing.com Inc. | 9 Apr 2022 | 24 May 2025 | 9 Apr 2026 |
| 111 | valentines.au | - | - | 25 Sep 2025 | - |
| 112 | valentines.swatch | CSC Corporate Domains, Inc. | 24 Jan 2018 | 20 Jan 2025 | 24 Jan 2026 |
| 113 | valentines.ru | - | 20 Sep 2022 | - | 20 Sep 2026 |
| 114 | valentines.de | - | - | 19 Sep 2023 | - |
| 115 | valentines.dk | - | 7 Dec 2021 | - | 6 Dec 2026 |
| 116 | valentines.fr | EuroDNS S.A. | 12 Jun 2020 | 10 Jun 2025 | 12 Jun 2026 |
| 117 | valentines.in | Epik Inc. | 16 Feb 2005 | 15 Apr 2021 | 16 Feb 2026 |
| 118 | valentines.me | - | 18 Jul 2008 | 15 Oct 2025 | 18 Jul 2026 |
| 119 | valentines.ng | - | 23 Nov 2021 | 20 Feb 2025 | 23 Nov 2024 |
| 120 | valentines.coupons | 101domain, Inc. | 27 Aug 2015 | 7 Oct 2024 | 27 Aug 2025 |
| 121 | valentines.se | - | 28 Feb 2011 | 5 Feb 2025 | 28 Feb 2026 |
| 122 | valentines.shopping | NameKing.com Inc. | 7 Jan 2025 | 16 May 2025 | 7 Jan 2026 |
| 123 | valentines.vision | NameCheap, Inc. | 6 Jan 2025 | - | - |
| 124 | valentines.bar | GoDaddy.com, LLC | 12 Jan 2025 | 25 Aug 2025 | 12 Jan 2026 |
| 125 | valentines.com.im | - | - | - | - |
| 126 | valentines.social | GoDaddy.com, LLC | 25 Jan 2025 | 30 Jan 2025 | 25 Jan 2026 |
| 127 | valentines.bot | GoDaddy.com, LLC | 25 Jan 2025 | 25 Jan 2025 | 25 Jan 2026 |
| 128 | valentines.graphics | Porkbun, LLC | 30 Jan 2025 | 30 Jan 2025 | 30 Jan 2026 |
| 129 | valentines.icu | Hostinger, UAB | 2 Feb 2025 | 7 Feb 2025 | 2 Feb 2026 |
| 130 | valentines.cz | - | 6 Feb 2025 | 10 Feb 2025 | 6 Feb 2026 |
| 131 | valentines.quest | GoDaddy.com, LLC | 12 Feb 2025 | 19 Mar 2025 | 12 Feb 2026 |
| 132 | valentines.christmas | NameCheap, Inc. | 13 Feb 2025 | 3 Mar 2025 | 13 Feb 2026 |
| 133 | valentines.nz | - | 30 Mar 2015 | 13 Mar 2025 | - |
| 134 | valentines.uk.com | GoDaddy.com, LLC | 27 Apr 2025 | 24 Jun 2025 | 27 Apr 2026 |
| 135 | valentines.salon | Automattic Inc. | 12 Aug 2025 | 17 Aug 2025 | 12 Aug 2026 |
| 136 | valentines.id | Reserved | 24 Apr 2025 | 24 Apr 2025 | 24 Apr 2026 |
| 137 | valentines.diy | GoDaddy.com, LLC | 30 Sep 2025 | 5 Oct 2025 | 30 Sep 2026 |
| 138 | valentines.com.br | - | 21 Aug 2019 | 11 Nov 2025 | 21 Aug 2026 |
| 139 | valentinesfiesta.com | Tucows Domains Inc. | 6 Apr 2007 | 10 Dec 2017 | 6 Apr 2018 |
| 140 | valentineswine.com | GoDaddy.com, LLC | 13 Nov 2020 | 5 Sep 2025 | 13 Nov 2026 |
| 141 | valentinestreet.com | TurnCommerce, Inc. DBA NameBright.com | 22 Oct 2014 | 2 Dec 2025 | 22 Oct 2025 |
| 142 | valentines-2015.com | GMO Internet Inc. | 2 Jul 2018 | 2 Jul 2018 | 2 Jul 2019 |
| 143 | valentines2015images.com | GoDaddy.com, LLC | 19 Aug 2019 | 19 Aug 2019 | 19 Aug 2020 |
| 144 | valentinesday14feb.com | HiChina Zhicheng Technology Limited | 23 Jul 2018 | 23 Jul 2018 | 23 Jul 2019 |
| 145 | valentinesday2015.gift | GoDaddy.com, LLC | 26 Dec 2014 | 31 Dec 2014 | 26 Dec 2015 |
| 146 | valentinesday2015card.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 147 | valentinesday2015greetingcards.com | Xin Net Technology Corporation | 9 Jul 2018 | 9 Jul 2018 | 9 Jul 2019 |
| 148 | valentinesday2015k.net | GMO Internet Inc. | 8 Apr 2016 | 8 Apr 2016 | 8 Apr 2017 |
| 149 | valentinesday2015pictures.com | GoDaddy.com, LLC | 10 Jan 2015 | 24 Feb 2015 | 10 Jan 2016 |
| 150 | valentinesday2015v.com | GoDaddy.com, LLC | 9 Jan 2015 | 23 Feb 2015 | 9 Jan 2016 |
| 151 | valentinesday2015wishes.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 152 | valentinesday2015z.com | BigRock Solutions Ltd. | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 153 | valentinesdaycardsprintables.com | Dynadot, LLC | 9 Oct 2022 | 19 Dec 2023 | 9 Oct 2023 |
| 154 | valentinesdaymahjong.com | GoDaddy.com, LLC | 10 Jan 2012 | 10 Jan 2025 | 10 Jan 2026 |
| 155 | valentinesdaymessagespoems.com | BigRock Solutions Ltd. | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 156 | valentinesdayquotespoems.com | 35 Technology Co., Ltd. | 26 Mar 2018 | - | 26 Mar 2019 |
| 157 | valentinesdaysms.in | - | 3 Jan 2015 | 20 Jan 2017 | 3 Jan 2018 |
| 158 | valentinesdaywallpaperimages.com | Dynadot, LLC | 19 Dec 2022 | 28 Feb 2024 | 19 Dec 2023 |
| 159 | valentinescards.org | Domainhysteria.com LLC | 3 Mar 2016 | 3 Mar 2017 | 3 Mar 2018 |
| 160 | valentinesdelightfarms.com | GoDaddy.com, LLC | 23 Oct 2014 | 24 Oct 2024 | 23 Oct 2029 |
| 161 | valentinesdayquotes2015.net | Tucows Domains Inc. | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2016 |
| 162 | valentinesdayquotescards2015.com | Mfro Inc. | 6 Jun 2019 | 6 Jun 2019 | 6 Jun 2020 |
| 163 | valentinesdayquotes2015.com | GMO Internet Inc. | 25 Dec 2015 | 18 Nov 2016 | 25 Dec 2017 |
| 164 | valentinesdaydoneforyou.com | GoDaddy.com, LLC | 4 May 2009 | 29 May 2015 | 28 May 2016 |
| 165 | valentinestationary.com | GoDaddy.com, LLC | 29 May 2010 | 30 May 2015 | 29 May 2016 |
| 166 | valentinesplace.com | TurnCommerce, Inc. DBA NameBright.com | 13 Jan 2018 | 22 Feb 2025 | 13 Jan 2025 |
| 167 | valentinesbaltimoreescortservice.com | GoDaddy.com, LLC | 4 Jun 2012 | 5 Jun 2015 | 4 Jun 2016 |
| 168 | valentinesgiftbaskets.com | Network Solutions, LLC | 12 Mar 2003 | 11 Jan 2025 | 12 Mar 2027 |
| 169 | valentinesurfacing.com | Network Solutions, LLC | 22 Mar 2024 | 4 Jun 2025 | 22 Mar 2025 |
| 170 | valentinesdayflowergift.us | Wild West Domains, LLC | 29 Mar 2015 | 8 Mar 2017 | 28 Mar 2018 |
| 171 | valentinesdaycardsideas.com | eNom, Inc. | 28 Nov 2016 | 1 Dec 2017 | 28 Nov 2017 |
| 172 | valentinesdaycoupon.com | DropCatch.com 970 LLC | 6 Jan 2020 | 6 Jan 2020 | 6 Jan 2021 |
| 173 | valentinesday2015quotes.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 174 | valentinescoupon.com | Domain.com, LLC | 18 Oct 2006 | 10 Apr 2017 | 18 Oct 2017 |
| 175 | valentinestopsites.com | GoDaddy.com, LLC | 18 Oct 2003 | 18 Apr 2015 | 18 Oct 2015 |
| 176 | valentinesdaytraditions.com | eNom, Inc. | 19 Apr 2009 | 11 May 2017 | 19 Apr 2018 |
| 177 | valentineschools.com | GoDaddy.com, LLC | 17 Mar 2021 | 17 Mar 2021 | 17 Mar 2022 |
| 178 | valentinesdaygiftstore.com | eNom, Inc. | 27 Jan 2011 | 23 Jan 2017 | 27 Jan 2018 |
| 179 | valentinesday411.com | GoDaddy.com, LLC | 15 Feb 2010 | 16 Jun 2015 | 15 Feb 2016 |
| 180 | valentinesday2016.com | GoDaddy.com, LLC | 1 Mar 2015 | 15 Apr 2015 | 1 Mar 2016 |
| 181 | valentinesupplements.com | GoDaddy.com, LLC | 30 Oct 2014 | 12 Dec 2016 | 15 Jan 2018 |
| 182 | valentinesnacks.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 183 | valentinesite.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 184 | valentinesauces.com | GoDaddy.com, LLC | 30 Oct 2014 | 12 Dec 2016 | 15 Jan 2018 |
| 185 | valentinesauce.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 186 | valentines-day-gifts-4u.com | GoDaddy.com, LLC | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 187 | valentinesdaymassacre.com | GoDaddy.com, LLC | 24 Jun 2017 | 25 Jun 2025 | 24 Jun 2026 |
| 188 | valentinesecard.com | GoDaddy.com, LLC | 2 Dec 2010 | 6 May 2015 | 2 Dec 2015 |
| 189 | valentinesdayplanner.com | 1&1 Internet AG | 22 May 2007 | 26 Mar 2015 | 22 May 2016 |
| 190 | valentinesdaypartyguide.com | 1&1 Internet AG | 3 Oct 2007 | 4 Oct 2014 | 3 Oct 2015 |
| 191 | valentinesdaycoupon.net | Domain.com, LLC | 18 Oct 2006 | 28 Sep 2017 | 18 Oct 2018 |
| 192 | valentinescoupon.net | Anessia Inc. | 7 Jan 2020 | 9 Jan 2020 | 7 Jan 2021 |
| 193 | valentinesdaycards2014.com | GoDaddy.com, LLC | 5 Jan 2014 | 18 Feb 2015 | 5 Jan 2016 |
| 194 | valentinesdaygiftforher.com | GoDaddy.com, LLC | 11 Sep 2023 | 12 Sep 2025 | 11 Sep 2026 |
| 195 | valentinesdaysexygifts.com | GoDaddy.com, LLC | 28 Dec 2009 | 25 Apr 2015 | 28 Dec 2015 |
| 196 | valentinesdaygift.net | - | 26 Jan 2023 | 10 Sep 2024 | 26 Jan 2026 |
| 197 | valentinesushko.com | FastDomain Inc. | 15 Oct 2012 | 30 Oct 2016 | 15 Oct 2017 |
| 198 | valentinesdaystore.com | GoDaddy.com, LLC | 28 Jun 2006 | 28 Jul 2025 | 28 Jun 2026 |
| 199 | valentinesdaycards.org | GoDaddy.com, LLC | 6 Jan 2017 | 7 Jan 2018 | 6 Jan 2019 |
| 200 | valentines-day-2015.com | Treasure Trove Domains LLC | 29 Feb 2016 | 29 Feb 2016 | 28 Feb 2017 |
| 201 | valentinesdaybuzz.com | GoDaddy.com, LLC | 31 Jan 2017 | 31 Jan 2017 | 31 Jan 2018 |
| 202 | valentinesvideomessage.com | GoDaddy.com, LLC | 2 Feb 2011 | 20 Mar 2015 | 2 Feb 2016 |
| 203 | valentinesgiftsselections.com | - | - | - | - |
| 204 | valentineshugs.com | GoDaddy.com, LLC | 6 Apr 2011 | 6 Apr 2025 | 6 Apr 2026 |
| 205 | valentinesearcher4u.ru | - | - | - | - |
| 206 | valentinesdayjewelry.info | GoDaddy.com, LLC | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 207 | valentinesmorning.com | GoDaddy.com, LLC | 4 Feb 2014 | 1 Mar 2017 | 4 Feb 2018 |
| 208 | valentinesdance.com | TurnCommerce, Inc. DBA NameBright.com | 7 Jul 2015 | 6 Aug 2024 | 7 Jul 2024 |
| 209 | valentinesdaysales.com | GoDaddy.com, LLC | 4 Jan 2021 | 19 Jan 2025 | 4 Jan 2026 |
| 210 | valentinesflowerswinnipeg.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2017 |
| 211 | valentinestreats.com | - | 1 May 2021 | 7 May 2025 | 1 May 2026 |
| 212 | valentinesday24365.com | GoDaddy.com, LLC | 8 Jun 2013 | 9 Jun 2015 | 8 Jun 2016 |
| 213 | valentinesweddinginparis.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 214 | valentinesearchersite.ru | - | - | - | - |
| 215 | valentinesdayimagesquotes.com | GoDaddy.com, LLC | 7 Nov 2018 | 7 Nov 2018 | 7 Nov 2019 |
| 216 | valentinesdaycardss.com | GoDaddy.com, LLC | 1 Feb 2017 | 1 Feb 2017 | 1 Feb 2018 |
| 217 | valentinesearcher.ru | - | - | - | - |
| 218 | valentinesnails.com | NameKing.com Inc. | 26 Aug 2023 | 27 Aug 2025 | 26 Aug 2026 |
| 219 | valentinesdayidea-s.com | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 220 | valentineschooltypingclub.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 221 | valentinesday.ninja | eNom, Inc. | 6 Dec 2014 | 15 Dec 2014 | 6 Dec 2015 |
| 222 | valentinescupcakes.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 223 | valentinesluckycoinshop.com | Tucows Domains Inc. | 16 Aug 2013 | 19 Aug 2014 | 16 Aug 2015 |
| 224 | valentinesyear.com | Wix.com Ltd. | 13 Feb 2021 | 25 Apr 2023 | 13 Feb 2023 |
| 225 | valentines-day-images.com | Key-Systems GmbH | 4 Mar 2024 | 2 Apr 2025 | 4 Mar 2026 |
| 226 | valentinesdatesheet.com | GMO Internet Inc. | 26 Aug 2022 | 6 Nov 2023 | 26 Aug 2023 |
| 227 | valentinesday2015images.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 13 Jan 2015 | 8 Jan 2016 |
| 228 | valentinesdayweek.com | Hostinger, UAB | 10 Dec 2022 | 19 Feb 2024 | 10 Dec 2023 |
| 229 | valentinesforsequoia.com | Tucows Domains Inc. | 12 Jan 2015 | 16 Jan 2016 | 12 Jan 2017 |
| 230 | valentinesinnewbraunfels.com | NameCheap, Inc. | 12 Jan 2015 | 23 Feb 2024 | 12 Jan 2024 |
| 231 | valentinesdaygiftidea.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jan 2016 | 6 Mar 2025 | 25 Jan 2025 |
| 232 | valentinesgiftsforboyfriend.com | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 233 | valentinesdayquotescards.com | Uniregistrar Corp | - | - | - |
| 234 | valentinesdayquotes.org | GoDaddy.com, LLC | 25 Jan 2017 | 27 Mar 2017 | 25 Jan 2018 |
| 235 | valentinesinjamaica.com | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2016 |
| 236 | valentinesday2015ideasforhim.com | BigRock Solutions Ltd. | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 237 | valentines-present.com | Tucows Domains Inc. | 6 Nov 2009 | 10 Nov 2014 | 6 Nov 2015 |
| 238 | valentineslowcostbridal2013.com | Tucows Domains Inc. | 22 Aug 2013 | 27 Aug 2014 | 22 Aug 2015 |
| 239 | valentinesdaypage.com | Fabulous.com Pty Ltd. | 8 Oct 2010 | 10 Nov 2015 | 8 Oct 2016 |
| 240 | valentinesjewelry.biz | GoDaddy.com, LLC | 15 Aug 2014 | 23 Oct 2025 | 14 Aug 2026 |
| 241 | valentinesjewelry.net | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2025 | 15 Aug 2026 |
| 242 | valentinesmusic.com | GoDaddy.com, LLC | 23 May 2019 | 23 May 2019 | 23 May 2020 |
| 243 | valentineswebsitedesign.com | Tucows Domains Inc. | 8 Nov 2013 | 12 Nov 2014 | 8 Nov 2015 |
| 244 | valentineshomeimprovements.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 245 | valentinesday2014.org | GoDaddy.com, LLC | 6 Feb 2017 | 3 Sep 2017 | 6 Feb 2018 |
| 246 | valentineslots.com | GoDaddy.com, LLC | 11 Sep 2014 | 12 Sep 2025 | 11 Sep 2026 |
| 247 | valentinesfavorites.com | Annulet LLC | 20 Jan 2016 | 25 Aug 2016 | 20 Jan 2018 |
| 248 | valentines2048.com | GoDaddy.com, LLC | 14 Sep 2014 | 15 Sep 2025 | 14 Sep 2026 |
| 249 | valentinesells.com | GoDaddy.com, LLC | 2 Sep 2014 | 3 Sep 2016 | 2 Sep 2018 |
| 250 | valentinestephanie.com | Network Solutions, LLC | 3 Sep 2014 | 4 Aug 2024 | 3 Sep 2026 |
| 251 | valentinesday2015.com | DropCatch.com 639 LLC | 2 Feb 2016 | 3 Feb 2017 | 2 Feb 2018 |
| 252 | valentines-catering.com | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 253 | valentinesfamily.com | Wild West Domains, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 254 | valentinesdayshop.com | - | 13 Jan 2024 | 8 Feb 2025 | 13 Jan 2026 |
| 255 | valentinesshow.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Sep 2014 | 4 Sep 2014 | 3 Sep 2015 |
| 256 | valentinesdaygiftshub.com | eNom, Inc. | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 257 | valentinesdaydecorations.com | Hostinger, UAB | 11 Oct 2023 | 14 Sep 2025 | 11 Oct 2026 |
| 258 | valentinestreeservice.com | - | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2017 |
| 259 | valentinesday-2015.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 260 | valentinestees.us | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 14 Nov 2015 |
| 261 | valentinesdayusa.com | Tucows Domains Inc. | 12 Jan 2024 | 22 Feb 2025 | 12 Jan 2025 |
| 262 | valentinesdaygiftsales.com | GoDaddy.com, LLC | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2016 |
| 263 | valentinesfarms.com | GoDaddy.com, LLC | 11 Aug 2022 | 12 Aug 2025 | 11 Aug 2026 |
| 264 | valentinesarrow.com | Tucows Domains Inc. | 1 Jan 2020 | 5 Jan 2021 | 1 Jan 2021 |
| 265 | valentinesafternoon.com | eNom, Inc. | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 266 | valentinesday-2015.net | BigRock Solutions Ltd. | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 267 | valentinesblues.com | Tucows Domains Inc. | 7 Dec 2018 | 11 Dec 2019 | 7 Dec 2019 |
| 268 | valentinesdayblues.com | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 269 | valentinesdaybluesdance.com | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 270 | valentinesfoods.com | Name.com, Inc. | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 271 | valentinesdancect.com | Tucows Domains Inc. | 19 Nov 2014 | 5 Nov 2025 | 19 Nov 2026 |
| 272 | valentines-day-quotes.com | DropCatch.com 901 LLC | 28 Dec 2019 | 28 Dec 2019 | 28 Dec 2020 |
| 273 | valentinesresortreservations.com | Tucows Domains Inc. | 3 Oct 2014 | 7 Oct 2015 | 3 Oct 2016 |
| 274 | valentinesbridal-formals.com | Tucows Domains Inc. | 22 Sep 2014 | 26 Sep 2019 | 22 Sep 2019 |
| 275 | valentinestreetproductions.com | - | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2017 |
| 276 | valentinesdaywedding.com | - | 8 Sep 2016 | 8 Sep 2016 | 8 Sep 2017 |
| 277 | valentinesdayideas.us | NameCheap, Inc. | 11 Jul 2017 | 13 Jul 2017 | 10 Jul 2018 |
| 278 | valentinesdaylove2015.com | BigRock Solutions Ltd. | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 279 | valentinesdaywishesz.com | BigRock Solutions Ltd. | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 280 | valentinesmodels.com | Dynadot, LLC | 26 Feb 2021 | 11 Feb 2025 | 26 Feb 2026 |
| 281 | valentinesring.com | GoDaddy.com, LLC | 19 Mar 2023 | 29 Apr 2024 | 19 Mar 2024 |
| 282 | valentinesday2015.net | GoDaddy.com, LLC | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 283 | valentinescards.net | Mesh Digital Limited | 21 Nov 2014 | 4 Dec 2016 | 21 Nov 2017 |
| 284 | valentinesjewel.com | Tucows Domains Inc. | 16 Jan 2019 | 20 Jan 2020 | 16 Jan 2020 |
| 285 | valentinest.com | Gabia, Inc. | 25 Nov 2023 | 3 Feb 2025 | 25 Nov 2024 |
| 286 | valentinesdaymessages2015.com | GMO Internet Inc. | 4 May 2017 | 9 Jun 2017 | 4 May 2018 |
| 287 | valentines-day-fun.com | Dynadot, LLC | 22 Oct 2023 | 1 Jan 2025 | 22 Oct 2024 |
| 288 | valentinesways.com | Wild West Domains, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 289 | valentineservicesgroup.com | eNom, Inc. | 28 Jun 2016 | 28 Jun 2016 | 28 Jun 2017 |
| 290 | valentines-uncovered.com | GMO Internet Inc. | 26 Sep 2014 | 14 Jun 2016 | 26 Sep 2017 |
| 291 | valentineskydive.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 292 | valentinesdayflowerdelivery.com | GoDaddy.com, LLC | 22 May 2023 | 3 Jun 2025 | 22 May 2026 |
| 293 | valentinesmagazine.com | Network Solutions, LLC | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 294 | valentinesdaywishesquotes.com | GMO Internet Inc. | 15 Feb 2017 | 7 Mar 2017 | 14 Feb 2018 |
| 295 | valentineswallpapers.com | GoDaddy.com, LLC | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2016 |
| 296 | valentinesspecial.com | Tucows Domains Inc. | 3 Dec 2022 | 13 Jan 2024 | 3 Dec 2023 |
| 297 | valentinesmassacre.com | GoDaddy.com, LLC | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 298 | valentinesday1.com | BigRock Solutions Ltd. | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 299 | valentinesdaysms2015.net | BigRock Solutions Ltd. | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 300 | valentinesdays.org | GoDaddy.com, LLC | 28 Nov 2014 | 8 Nov 2017 | 28 Nov 2018 |
| 301 | valentinesday2015x.net | GMO Internet Inc. | 8 Apr 2016 | 8 Apr 2016 | 8 Apr 2017 |
| 302 | valentinesvip.com | - | 7 Mar 2022 | 7 Apr 2023 | 7 Mar 2023 |
| 303 | valentinesmvp.com | GoDaddy.com, LLC | 10 Oct 2019 | 11 Oct 2025 | 10 Oct 2026 |
| 304 | valentinesmiami.com | FastDomain Inc. | 1 Dec 2014 | 1 Dec 2017 | 1 Dec 2018 |
| 305 | valentinesdayideas2015.com | eNom, Inc. | 16 Apr 2016 | 2 Apr 2017 | 16 Apr 2018 |
| 306 | valentinesday2015.us | GoDaddy.com, LLC | 30 Nov 2014 | 30 Nov 2014 | 29 Nov 2015 |
| 307 | valentineswalkrun.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2016 |
| 308 | valentineshairsalon.com | NameCheap, Inc. | 20 Sep 2018 | 21 Aug 2025 | 20 Sep 2026 |
| 309 | valentinesway.com | Webfusion Ltd. | 10 Apr 2021 | 3 Aug 2025 | 10 Apr 2026 |
| 310 | valentinesdayoutlet.com | GMO Internet Inc. | 18 Feb 2022 | 31 Mar 2023 | 18 Feb 2023 |
| 311 | valentinesday10k.com | GoDaddy.com, LLC | 5 Dec 2014 | 6 Dec 2025 | 5 Dec 2026 |
| 312 | valentinesdayoutlet.net | 1&1 Internet AG | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 313 | valentinesdayfab.com | NameCheap, Inc. | 24 Feb 2020 | 3 Apr 2024 | 24 Feb 2026 |
| 314 | valentinesday2015.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Dec 2014 | 6 Dec 2014 | 5 Dec 2015 |
| 315 | valentinesdaygiftsformen.net | GoDaddy.com, LLC | 5 Dec 2014 | 16 Feb 2025 | 5 Dec 2024 |
| 316 | valentinesdaysms2015.com | Chengdu West Dimension Digital Technology Co., Ltd… | 3 May 2018 | 3 May 2018 | 3 May 2019 |
| 317 | valentinesfightnight.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2016 |
| 318 | valentinesdaypark.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 319 | valentinesday2015wallpapers.com | DropCatch.com 407 LLC | 26 Feb 2016 | 27 Feb 2017 | 26 Feb 2018 |
| 320 | valentinesday2015sms.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 321 | valentinesday2015shayari.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 322 | valentinesday2015quoteslove.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 323 | valentinesday2015messages.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 324 | valentinesday2015images.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 325 | valentinesday2015greetings.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 326 | valentinesmusicschool.com | Tucows Domains Inc. | 11 Dec 2014 | 15 Dec 2022 | 11 Dec 2022 |
| 327 | valentinesdayweb.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 328 | valentinesdayqoutes.com | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 329 | valentinesdaydeas.com | eNom, Inc. | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 330 | valentines2016.com | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 331 | valentinesinjan.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 332 | valentinesday-2015ideas.com | Uniregistrar Corp | - | - | - |
| 333 | valentinesbanner.com | Tucows Domains Inc. | 11 Dec 2009 | 15 Dec 2014 | 11 Dec 2015 |
| 334 | valentineshop.net | Tucows Domains Inc. | 21 Jan 2025 | 19 Jun 2025 | 21 Jan 2026 |
| 335 | valentinesday2019.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 336 | valentinesday2018.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 337 | valentinesday2017.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 338 | valentines2019.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 339 | valentines2018.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 340 | valentines2017.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 341 | valentinesday-quotes.org | eNom, Inc. | 30 Dec 2016 | 31 Dec 2017 | 30 Dec 2018 |
| 342 | valentinesnews.com | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 343 | valentinesday2014images.com | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 344 | valentinescards.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Dec 2014 | 16 Dec 2014 | 15 Dec 2015 |
| 345 | valentinesdayswag.com | Network Solutions, LLC | 10 Aug 2018 | 25 Jun 2025 | 10 Aug 2026 |
| 346 | valentinesdaysupersite.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 347 | valentinesattheplaza.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 348 | valentinesunderthestars.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2016 |
| 349 | valentinesdaywallpapershd.com | Key-Systems GmbH | 6 Mar 2016 | 9 Mar 2016 | 6 Mar 2017 |
| 350 | valentinesday2015ideas.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 351 | valentinesgiftsforhim.info | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 352 | valentinesday2015cards.com | GMO Internet Inc. | 25 May 2017 | 13 Jun 2017 | 25 May 2018 |
| 353 | valentines360.com | GoDaddy.com, LLC | 19 Dec 2014 | 20 Dec 2024 | 19 Dec 2025 |
| 354 | valentinesdaywallpaper2015.net | BigRock Solutions Ltd. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 355 | valentinesdaysms.net | BigRock Solutions Ltd. | 19 Nov 2016 | 19 Nov 2017 | 19 Nov 2017 |
| 356 | valentinesdayquotes-2015.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 357 | valentinesdaypictures.net | BigRock Solutions Ltd. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 358 | valentinesdaymessagesquotes.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 359 | valentinesdaymessages2015.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 360 | valentinesdaylove2015.net | BigRock Solutions Ltd. | 6 Sep 2016 | 18 Oct 2017 | 6 Sep 2017 |
| 361 | valentinesdayjokes2015.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 362 | valentinesdayimages2015.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 363 | valentinesday2015wishes.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 364 | valentinesday2015wallpapers.net | BigRock Solutions Ltd. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 365 | valentinesday2015sms.net | BigRock Solutions Ltd. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 366 | valentinesday2015quotes.net | BigRock Solutions Ltd. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 367 | valentinesday2015messages.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 368 | valentinesbook.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 369 | valentinesdayquote.com | Moniker Online Services LLC | 9 Jun 2019 | 9 Jun 2019 | 9 Jun 2020 |
| 370 | valentinesdayideass.com | Xin Net Technology Corporation | 1 Mar 2021 | 3 Mar 2021 | 1 Mar 2022 |
| 371 | valentinesday-special.com | Domaininthehole.com LLC | 8 Mar 2016 | 28 Feb 2017 | 8 Mar 2019 |
| 372 | valentinesdayz.net | FastDomain Inc. | 16 Oct 2023 | 29 Dec 2024 | 16 Oct 2024 |
| 373 | valentinesday2k15.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 374 | valentinesday2014.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 375 | valentinesdayweddingspackagesspecials.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 376 | valentines2015.net | Tucows Domains Inc. | 31 Mar 2016 | 31 Mar 2016 | 31 Mar 2017 |
| 377 | valentinesforlife.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 378 | valentinesdaywishes2015.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 379 | valentinesdayguide.com | Automattic Inc. | 9 Jan 2024 | 21 Feb 2025 | 9 Jan 2025 |
| 380 | valentinessongs.com | GoDaddy.com, LLC | 23 Dec 2014 | 27 Jan 2024 | 15 Jan 2025 |
| 381 | valentinesnewjerseyescorts.com | GoDaddy.com, LLC | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 382 | valentinesgirls.com | GoDaddy.com, LLC | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 383 | valentinesdayhelp.com | Xin Net Technology Corporation | 17 Mar 2018 | 17 Mar 2018 | 17 Mar 2019 |
| 384 | valentinesday2015qutoes.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 385 | valentinesday-2015.org | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 386 | valentinesdaylovequotes.com | Namesilo, LLC | 14 Mar 2019 | 15 Mar 2019 | 14 Mar 2020 |
| 387 | valentines-day-gifts-for-her.com | Namesilo, LLC | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 388 | valentinesdaydesigns.com | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 389 | valentinesdayquotesforhim.com | GoDaddy.com, LLC | 26 Dec 2014 | 27 Dec 2014 | 26 Dec 2015 |
| 390 | valentinesday2015blog.com | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 391 | valentinesrosesdelivery.com | GoDaddy.com, LLC | 27 Dec 2014 | 24 Dec 2024 | 27 Dec 2025 |
| 392 | valentinesdayresolutions.com | GoDaddy.com, LLC | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 393 | valentinesdaylight2015.com | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 394 | valentinesdaycouplesmassagedavenport.com | GoDaddy.com, LLC | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2016 |
| 395 | valentinesdaycards2015.com | GoDaddy.com, LLC | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 396 | valentinesday2015wallpaper.com | BigRock Solutions Ltd. | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 397 | valentinesamor.com | GoDaddy.com, LLC | 27 Dec 2014 | 28 Dec 2024 | 27 Dec 2025 |
| 398 | valentinesdaywallpaper.com | DropCatch.com 518 LLC | 17 Mar 2017 | 18 Mar 2017 | 17 Mar 2018 |
| 399 | valentinesgreeting.org | AtlanticFriendNames.com LLC | 15 Mar 2016 | 20 Mar 2017 | 15 Mar 2018 |
| 400 | valentinesjewellery.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 29 Dec 2014 | 19 Jan 2018 | 29 Dec 2018 |
| 401 | valentinesignature.com | eNom, Inc. | 10 Apr 2017 | 10 Apr 2017 | 10 Apr 2018 |
| 402 | valentinesenchantedearth.com | Network Solutions, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2016 |
| 403 | valentinesdaymovies.com | NameCheap, Inc. | 8 Oct 2023 | 20 Dec 2024 | 8 Oct 2024 |
| 404 | valentinesdaycashcow.com | Launchpad, Inc. | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 405 | valentinesama.com | OVH sas | 30 Dec 2014 | 28 May 2025 | 30 Dec 2025 |
| 406 | valentines-day-pictures.com | BigRock Solutions Ltd. | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 407 | valentinesdayresolutions.org | GoDaddy.com, LLC | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 408 | valentinesrugs.com | register.com, Inc. | 30 Dec 2014 | 22 Mar 2017 | 30 Dec 2017 |
| 409 | valentinesinprague.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 30 Dec 2014 | 3 Aug 2025 | 30 Dec 2025 |
| 410 | valentinesday-pictures.com | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Mar 2021 | 25 Mar 2021 | 25 Mar 2022 |
| 411 | valentinesday-images.com | 1&1 Internet AG | 30 Dec 2014 | 31 May 2017 | 30 Dec 2017 |
| 412 | valentinesdaysmscards.com | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 413 | valentinesdaycardsgifts.com | eNom, Inc. | 3 Apr 2016 | 3 Apr 2016 | 3 Apr 2017 |
| 414 | valentinesday2015pic.com | GMO Internet Inc. | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2017 |
| 415 | valentinesweeklist.com | DropCatch.com 1460 LLC | 8 Jun 2019 | 8 Jun 2019 | 8 Jun 2020 |
| 416 | valentinesdaysmsmessages2015.com | SliceofHeaven Domains, LLC | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 417 | valentinesdayimages2015.com | Dynadot, LLC | 22 Jun 2022 | 31 Aug 2023 | 22 Jun 2023 |
| 418 | valentinesdaygiftideas2015.com | GoDaddy.com, LLC | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 419 | valentinesday2015i.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 420 | valentines-day2015.com | eName Technology Co., Ltd. | 24 Apr 2019 | 24 Apr 2019 | 24 Apr 2020 |
| 421 | valentinesgreetings.net | eNom, Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 422 | valentinesdayy.org | GoDaddy.com, LLC | 1 Jan 2015 | 6 Jan 2017 | 1 Jan 2018 |
| 423 | valentinesinternational.com | DropCatch.com 1352 LLC | 24 Mar 2018 | 24 Mar 2018 | 24 Mar 2019 |
| 424 | valentinesdayquotesideas.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 425 | valentinesdayideasforhim2015.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 426 | valentinesdayideas0.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 427 | valentinesday2015x.com | GoDaddy.com, LLC | 23 Jan 2017 | 23 Jan 2017 | 23 Jan 2018 |
| 428 | valentinesday2015quote.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 429 | valentines-heart.com | Tucows Domains Inc. | 2 Jan 2015 | 6 Jan 2018 | 2 Jan 2018 |
| 430 | valentinesdayzz.com | Sterling Domains LLC | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 431 | valentinesdaywish.com | TurnCommerce, Inc. DBA NameBright.com | 7 May 2020 | 8 Jun 2024 | 7 May 2024 |
| 432 | valentinesdaypoemsfor.com | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 433 | valentinesdaymessage2015.com | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 434 | valentinesdaycelebration.com | Exclusive Domain Find LLC | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 435 | valentinescrushes.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 436 | valentinesbae.com | GoDaddy.com, LLC | 10 Jan 2025 | 10 Jan 2025 | 10 Jan 2026 |
| 437 | valentinesgiftsforher.org | eNom, Inc. | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 438 | valentinesdaywishes.org | Allworldnames.com LLC | 22 Mar 2023 | 26 Jan 2025 | 22 Mar 2026 |
| 439 | valentinesday2015wallpapers.org | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 440 | valentineswishespics.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 441 | valentinesmsg.com | Hosting Concepts B.V. dba Openprovider | 6 Feb 2021 | 6 Feb 2021 | 6 Feb 2022 |
| 442 | valentineslandscaping.com | DropCatch.com 1308 LLC | 24 Mar 2017 | 27 Mar 2017 | 24 Mar 2018 |
| 443 | valentinesdaywishescards.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 444 | valentinesdayquotes-2015.com | Gozerdomains.com LLC | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 445 | valentinesday2014celebration.com | BigRock Solutions Ltd. | 4 Jan 2014 | 5 Jan 2015 | 4 Jan 2016 |
| 446 | valentinesdesigns.xyz | Network Solutions, LLC | 11 Jul 2014 | 11 Jul 2014 | 11 Jul 2015 |
| 447 | valentinesday.xyz | West263 International Limited | 28 Jun 2021 | 26 Aug 2025 | 28 Jun 2027 |
| 448 | valentinesday.discount | united-domains AG | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 449 | valentinesday.nyc | GoDaddy.com, LLC | 10 Oct 2014 | 20 Oct 2025 | 9 Oct 2026 |
| 450 | valentinesday.soy | Name.com, Inc. | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 451 | valentinescard.email | Crazy Domains FZ-LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 452 | valentinesday.pictures | NameCheap, Inc. | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 453 | valentinesdayflowers.club | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2016 | 14 Nov 2017 |
| 454 | valentinesday.click | Porkbun, LLC | 17 Feb 2023 | 21 Feb 2025 | 17 Feb 2026 |
| 455 | valentinesday.rocks | NameCheap, Inc. | 9 Jan 2017 | 13 Jan 2018 | 9 Jan 2019 |
| 456 | valentinesday.deals | Porkbun, LLC | 7 Feb 2023 | 20 Mar 2024 | 7 Feb 2024 |
| 457 | valentinesday.red | GMO Internet Inc. | 17 Dec 2014 | 19 Nov 2015 | 17 Dec 2015 |
| 458 | valentinespresents.club | eNom, Inc. | 29 Dec 2014 | 29 Dec 2014 | 28 Dec 2015 |
| 459 | valentinesgifts.club | NameCheap, Inc. | 21 Apr 2021 | - | 21 Apr 2022 |
| 460 | valentinesdayexpress.nyc | eNom, Inc. | 29 Dec 2014 | 28 Apr 2016 | 28 Dec 2016 |
| 461 | valentinesday.vegas | eNom, Inc. | 2 Jun 2014 | 6 Jan 2015 | 2 Jun 2015 |
| 462 | valentinesday.expert | OVH sas | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 463 | valentines-day.expert | OVH sas | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 464 | valentinesgift.top | 101domain, Inc. | 6 Feb 2015 | - | 6 Feb 2016 |
| 465 | valentinesdayideas.website | NameCheap, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 466 | valentinesgifts.top | 101domain, Inc. | 11 Feb 2015 | - | 11 Feb 2016 |
| 467 | valentinesday.guide | - | 8 Mar 2025 | - | 8 Mar 2026 |
| 468 | valentinesday.work | 1&1 Internet AG | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 469 | valentinesday.onl | Crazy Domains FZ-LLC | 14 Feb 2015 | - | 14 Feb 2016 |
| 470 | valentinesignature.photography | GoDaddy.com, LLC | 8 Mar 2015 | 8 Mar 2015 | 8 Mar 2016 |
| 471 | valentinesday.wales | Mesh Digital Limited | 5 Apr 2015 | 5 Apr 2015 | 5 Apr 2016 |
| 472 | valentinesday.flowers | CSC Corporate Domains, Inc. | 7 Apr 2015 | 24 Mar 2025 | 7 Apr 2026 |
| 473 | valentinesday.sydney | Crazy Domains FZ-LLC | 10 Apr 2015 | - | 10 Apr 2016 |
| 474 | valentinesday.melbourne | Crazy Domains FZ-LLC | 10 Apr 2015 | - | 10 Apr 2016 |
| 475 | valentinesday.coach | SafeNames Ltd. | 7 Apr 2015 | 8 Apr 2025 | 7 Apr 2026 |
| 476 | valentinesdayideasher.com | - | 14 Aug 2016 | 14 Aug 2016 | 14 Aug 2017 |
| 477 | valentinesday2015pics.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 478 | valentines-heart-beats.com | Dynadot, LLC | 23 Mar 2021 | 23 Mar 2021 | 23 Mar 2022 |
| 479 | valentinesdayquotes2015.org | Domaincapitan.com LLC | 22 Mar 2016 | 5 May 2017 | 22 Mar 2018 |
| 480 | valentinesdayimages2015.org | GMO Internet Inc. | 20 Apr 2016 | 29 Mar 2017 | 20 Apr 2018 |
| 481 | valentinesrings.com | GoDaddy.com, LLC | 1 Jun 2023 | 1 Jun 2023 | 1 Jun 2024 |
| 482 | valentinesresidencesresortmarina.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2017 |
| 483 | valentinesloveday.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 484 | valentinesdayquotewishes.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 485 | valentinesdayquotesx.com | Netowl, Inc. | 9 Sep 2019 | 9 Sep 2019 | 9 Sep 2020 |
| 486 | valentinesdayimages-pictures.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 487 | valentinesdayheadquarters.com | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2017 |
| 488 | valentinesdaygiftsideass.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 489 | valentinesday2015smss.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 490 | valentinesday2015-wallpapers.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 491 | valentines-day2015ideas.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 492 | valentinesgiftsforhim.org | UdomainName.com LLC | 23 Mar 2016 | 6 Oct 2016 | 23 Mar 2017 |
| 493 | valentinesdaymeme.com | eNom, Inc. | 25 Nov 2016 | 28 Nov 2017 | 25 Nov 2017 |
| 494 | valentinesdayideas2015.net | GMO Internet Inc. | 28 Mar 2016 | 28 Mar 2016 | 28 Mar 2017 |
| 495 | valentinesdayideas15.com | GoDaddy.com, LLC | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 496 | valentinesdaycards2015.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 497 | valentinesday-poems.com | Jiangsu Bangning Science and technology Co. Ltd. | 3 Jul 2020 | 3 Jul 2020 | 3 Jul 2021 |
| 498 | valentinesdaysmswish.com | BigRock Solutions Ltd. | 8 Jan 2015 | 19 May 2016 | 8 Jan 2017 |
| 499 | valentinesdayideasx.com | GoDaddy.com, LLC | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 500 | valentinesclothiersfairlawnohio.com | eNom, Inc. | 14 Aug 2015 | 7 Dec 2016 | 14 Aug 2020 |
| 501 | valentinesday2015gifts.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 502 | valentinesweetdeals.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 503 | valentinesvouchers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 May 2020 | 25 Apr 2025 | 10 May 2026 |
| 504 | valentinesdayfunny.com | 1&1 Internet AG | 9 Jan 2015 | 19 Feb 2017 | 9 Jan 2018 |
| 505 | valentinesday2015images.org | GMO Internet Inc. | 8 Apr 2016 | 1 Mar 2017 | 8 Apr 2018 |
| 506 | valentinesday-cards.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 507 | valentineshirt.com | GoDaddy.com, LLC | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 508 | valentinesforveterans.org | GoDaddy.com, LLC | 6 Jan 2023 | 20 Feb 2025 | 6 Jan 2026 |
| 509 | valentinesdayjazz.com | GoDaddy.com, LLC | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2017 |
| 510 | valentinesday-wishes.com | GoDaddy.com, LLC | 28 Dec 2016 | 28 Dec 2016 | 28 Dec 2017 |
| 511 | valentinesday-cards.net | BigRock Solutions Ltd. | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 512 | valentines-quotes.com | GoDaddy.com, LLC | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 513 | valentinesdaywhatsappmessages.com | GMO Internet Inc. | 28 Oct 2017 | 29 Oct 2017 | 28 Oct 2018 |
| 514 | valentinesdaymessage.com | Dynadot, LLC | 30 Nov 2018 | 30 Nov 2018 | 30 Nov 2019 |
| 515 | valentinesdaymemes.com | NameCheap, Inc. | 11 Jan 2015 | 12 Dec 2024 | 11 Jan 2026 |
| 516 | valentinesdayideas4u.com | GoDaddy.com, LLC | 11 Jan 2015 | 11 Jan 2015 | 11 Jan 2016 |
| 517 | valentinesbluesdance.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 518 | valentines-gifts-for-him.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 519 | valentinesquotes.net | 1&1 Internet AG | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 520 | valentinesday-images.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 521 | valentines-day.info | CommuniGal Communication Ltd. | 18 Sep 2022 | 17 Oct 2023 | 18 Sep 2023 |
| 522 | valentinesdaypoemsquotes.com | BigRock Solutions Ltd. | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 523 | valentinescreenplays.com | Dynadot, LLC | 13 Jan 2015 | 5 Jan 2025 | 15 Jan 2027 |
| 524 | valentinesiboni.info | OVH sas | 6 Jan 2013 | 20 Feb 2024 | 6 Jan 2026 |
| 525 | valentinesdays.net | Namesilo, LLC | 29 Mar 2019 | 29 Mar 2019 | 29 Mar 2020 |
| 526 | valentinespixel.com | Dinahosting s.l. | 2 Jan 2020 | 26 Dec 2024 | 2 Jan 2026 |
| 527 | valentinesdaynews.com | NameCheap, Inc. | 14 Jan 2015 | 10 Jan 2025 | 14 Jan 2026 |
| 528 | valentinesdayimages.us | BigRock Solutions Ltd. | 13 Jan 2015 | 13 Jan 2015 | 12 Jan 2016 |
| 529 | valentinesdayla.com | Gandi SAS | 15 Jan 2015 | 17 Oct 2025 | 15 Jan 2026 |
| 530 | valentinesday2015y.com | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 531 | valentinesrescue.com | Google, Inc. | 3 Jan 2020 | 3 Jan 2020 | 3 Jan 2021 |
| 532 | valentinesllc.com | 1&1 Internet AG | 17 Dec 2007 | 18 Dec 2021 | 17 Dec 2025 |
| 533 | valentinesgifti.com | BigRock Solutions Ltd. | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 534 | valentinesdaysideas.com | The Domains LLC | 4 Apr 2016 | 5 Apr 2017 | 4 Apr 2018 |
| 535 | valentinesdaypoemss.com | GoDaddy.com, LLC | 16 Jan 2015 | 17 Jan 2015 | 16 Jan 2016 |
| 536 | valentinesdaypartyatl.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2017 |
| 537 | valentinesdaymasqueradeball.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2017 |
| 538 | valentinesdayideasforhimher.com | BigRock Solutions Ltd. | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 539 | valentinesdaygreetings2015.com | GoDaddy.com, LLC | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 540 | valentinesdayflower.com | GoDaddy.com, LLC | 29 Oct 2019 | 18 Oct 2025 | 29 Oct 2026 |
| 541 | valentinesdayatl.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2017 |
| 542 | valentinesdaymessages2016.party | Alpnames Limited | 10 Jun 2015 | - | 9 Jun 2016 |
| 543 | valentinesongs.xyz | Alpnames Limited | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 544 | valentinesdaysongs.xyz | Alpnames Limited | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 545 | valentinesdayimagesgreetings.com | GoDaddy.com, LLC | 16 Aug 2015 | 16 Aug 2015 | 16 Aug 2016 |
| 546 | valentinesday.site | GoDaddy.com, LLC | 21 Dec 2023 | 19 Mar 2025 | 21 Dec 2025 |
| 547 | valentinesday.jewelry | GoDaddy.com, LLC | 30 Jul 2015 | 6 Jan 2017 | 30 Jul 2017 |
| 548 | valentinesdayidea.info | GoDaddy.com, LLC | 16 Jan 2015 | 17 Jan 2017 | 16 Jan 2018 |
| 549 | valentinesdaysalecoupons.com | GoDaddy.com, LLC | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 550 | valentinesdayquoteslove.com | GoDaddy.com, LLC | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 551 | valentinesday2015giftideas.com | BigRock Solutions Ltd. | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 552 | valentinestea.com | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 553 | valentinesim.com | Crazy Domains FZ-LLC | 16 Jan 2010 | 20 Jan 2015 | 16 Jan 2016 |
| 554 | valentinesdigital.com | GoDaddy.com, LLC | 14 Feb 2024 | 27 Mar 2025 | 14 Feb 2025 |
| 555 | valentinesdayrush.com | Snapsource LLC | 28 Mar 2018 | 29 Mar 2018 | 28 Mar 2019 |
| 556 | valentinescardonline.com | Crazy Domains FZ-LLC | 16 Jan 2010 | 20 Jan 2015 | 16 Jan 2016 |
| 557 | valentinesweek2015.com | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 558 | valentineshunt.com | Realtime Register B.V. | 10 Apr 2024 | 20 Jun 2025 | 10 Apr 2026 |
| 559 | valentinesdayimage.com | TurnCommerce, Inc. DBA NameBright.com | 17 Oct 2022 | 27 Nov 2025 | 17 Oct 2025 |
| 560 | valentinesflowers.info | eNom, Inc. | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 561 | valentinesdayprizedraw.info | TierraNet Inc. d/b/a DomainDiscover | 19 Jan 2015 | 6 Dec 2016 | 19 Jan 2018 |
| 562 | valentinesshoes.com | Xin Net Technology Corporation | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2016 |
| 563 | valentinesdays2015.com | Namesilo, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 564 | valentinesdaynow.com | - | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 565 | valentinesideas.org | Namesilo, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 566 | valentines2015.org | GoDaddy.com, LLC | 7 Aug 2017 | 7 Aug 2017 | 7 Aug 2018 |
| 567 | valentinesoapcompany.com | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 568 | valentinesdinnerideas.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 569 | valentinesdaysquotes.com | GoDaddy.com, LLC | 2 Nov 2019 | 2 Nov 2019 | 2 Nov 2020 |
| 570 | valentinesdayfebruary14.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 571 | valentinesdaydealsandsales.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Aug 2017 | 5 Aug 2017 | 5 Aug 2018 |
| 572 | valentinesday2015-cards.com | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 573 | valentines15.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 574 | valentinesdrop.com | Google, Inc. | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 575 | valentinesdayworld.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 576 | valentinestaxandbookkeepingservices.com | Tucows Domains Inc. | 24 Jan 2015 | 28 Jan 2018 | 24 Jan 2018 |
| 577 | valentinesdriving.com | NoticedDomains LLC | 24 Jan 2015 | 25 Jan 2017 | 24 Jan 2018 |
| 578 | valentines-day-messages.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Jan 2015 | 28 Jan 2015 | 27 Jan 2016 |
| 579 | valentinesingles.com | Key-Systems GmbH | 17 Jan 2004 | 17 Jan 2025 | 17 Jan 2026 |
| 580 | valentinesdayideaz.com | BigRock Solutions Ltd. | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 581 | valentinesday2015hq.com | BigRock Solutions Ltd. | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 582 | valentinesproject.org | eNom, Inc. | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2017 |
| 583 | valentinesquotes2015.com | GoDaddy.com, LLC | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 584 | valentinesdayjewellery.com | GoDaddy.com, LLC | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 585 | valentinesday-jewelry.com | Tucows Domains Inc. | 15 Jan 2021 | 19 Jan 2022 | 15 Jan 2022 |
| 586 | valentinesdaylovequotes.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 587 | valentinesday2015ideas.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 588 | valentinesmovies.com | Dynadot, LLC | 15 Feb 2023 | 26 Apr 2024 | 15 Feb 2024 |
| 589 | valentinesmassagegiveaway.com | GoDaddy.com, LLC | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 590 | valentinesflorist.com | Squarespace Domains LLC | 13 Dec 2024 | 13 Dec 2024 | 13 Dec 2025 |
| 591 | valentinesdaystuff.com | ZNet Technologies Pvt Ltd. | 29 Jan 2015 | 12 Dec 2016 | 29 Jan 2018 |
| 592 | valentinesdayimagesi.com | GoDaddy.com, LLC | 14 Sep 2021 | 14 Sep 2021 | 14 Sep 2022 |
| 593 | valentinesdaygame.com | GoDaddy.com, LLC | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 594 | valentinescart.com | GoDaddy.com, LLC | 25 Jan 2017 | 25 Jan 2017 | 25 Jan 2018 |
| 595 | valentinesbreaks.com | Go Australia Domains, LLC | 19 Apr 2019 | 19 Apr 2019 | 19 Apr 2020 |
| 596 | valentinesayings.net | Namesilo, LLC | 29 Jan 2013 | 29 Jan 2024 | 29 Jan 2025 |
| 597 | valentinesdaywises.party | Alpnames Limited | 7 May 2015 | - | 6 May 2016 |
| 598 | valentinesdaycruises.com | GoDaddy.com, LLC | 31 Jan 2015 | 4 Jul 2025 | 31 Jan 2027 |
| 599 | valentinescurbsideservice.com | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 600 | valentines-to-vandy.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 601 | valentinesday.run | GoDaddy.com, LLC | 19 Aug 2015 | 3 Oct 2025 | 19 Aug 2026 |
| 602 | valentinesocola.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 603 | valentinesdaygiftzone.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 604 | valentinesdayae.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 605 | valentinesprom.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 606 | valentinesdayshirts.com | GoDaddy.com, LLC | 2 Jan 2020 | 3 Jan 2025 | 2 Jan 2026 |
| 607 | valentinesdayquotes2u.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 608 | valentinesdaypicturesimages.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 609 | valentinesdaycansuckit.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 610 | valentinesdatequotes.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 611 | valentinespresentcompany.com | easyDNS Technologies, Inc. | 1 Feb 2014 | 5 Feb 2015 | 1 Feb 2016 |
| 612 | valentinesgiftcompany.com | easyDNS Technologies, Inc. | 1 Feb 2014 | 5 Feb 2015 | 1 Feb 2016 |
| 613 | valentinesdayideasforboyfriend.com | FastDomain Inc. | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 614 | valentinesdaysmswish.net | 1&1 Internet AG | 3 Feb 2015 | 4 Feb 2015 | 3 Feb 2016 |
| 615 | valentines-love.com | 1&1 Internet AG | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 616 | valentinesdaysmsquotes.net | BigRock Solutions Ltd. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 617 | valentinesearch.com | DropCatch.com 1211 LLC | 28 Apr 2025 | 29 Apr 2025 | 28 Apr 2026 |
| 618 | valentinesday360.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 14 Oct 2022 | 24 Dec 2023 | 14 Oct 2023 |
| 619 | valentinesday2015wish.com | BigRock Solutions Ltd. | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 620 | valentinesfacebook.com | GoDaddy.com, LLC | 8 Feb 2015 | 8 Feb 2015 | 8 Feb 2016 |
| 621 | valentinesdesign.com | GoDaddy.com, LLC | 9 Feb 2017 | 10 Feb 2025 | 9 Feb 2026 |
| 622 | valentinestattoo.com | - | 6 Oct 2025 | 6 Oct 2025 | 6 Oct 2026 |
| 623 | valentines-day.org | GoDaddy.com, LLC | 7 Nov 2023 | 7 Nov 2025 | 7 Nov 2026 |
| 624 | valentinesday2014quotes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 625 | valentines-365.com | GoDaddy.com, LLC | 5 Mar 2021 | 17 May 2024 | 5 Mar 2024 |
| 626 | valentinesexshop.com | PT Ardh Global Indonesia | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 627 | valentinesday0214.com | Network Solutions, LLC | 10 Apr 2019 | 10 Apr 2019 | 10 Apr 2020 |
| 628 | valentinesdream.com | DropCatch.com 1393 LLC | 18 Mar 2024 | 19 Mar 2024 | 18 Mar 2026 |
| 629 | valentines-day-clipart.com | - | 20 Dec 2024 | 21 Dec 2024 | 20 Dec 2025 |
| 630 | valentinescu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2016 |
| 631 | valentinesinvalentine.com | GoDaddy.com, LLC | 16 Feb 2015 | 29 Mar 2025 | 16 Feb 2025 |
| 632 | valentinesdayquotesforfriends.com | GoDaddy.com, LLC | 16 Feb 2015 | 16 Feb 2015 | 16 Feb 2016 |
| 633 | valentineslinks.com | Tucows Domains Inc. | 13 Feb 2008 | 17 Feb 2015 | 13 Feb 2016 |
| 634 | valentinesro.com | IHS Telekom, Inc. | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 635 | valentinesofmanchester.com | NamePal.com #8024 | 27 Jul 2019 | 28 Jul 2019 | 27 Jul 2020 |
| 636 | valentinesdecorations.com | NameKing.com Inc. | 14 Jan 2005 | 14 Jan 2025 | 14 Jan 2026 |
| 637 | valentinesdayquotes2016.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 638 | valentines-hearts-beats.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 639 | valentines-heart-beat.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 640 | valentinesgirl.com | Wild West Domains, LLC | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2017 |
| 641 | valentines-day-2014.com | - | - | - | - |
| 642 | valentinesdaypoem.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Feb 2015 | 10 Jan 2017 | 19 Feb 2018 |
| 643 | valentinesdaymenu.com | GoDaddy.com, LLC | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2017 |
| 644 | valentinescollection.com | Name.com, Inc. | 15 Feb 2021 | 15 Feb 2021 | 15 Feb 2022 |
| 645 | valentines-for-him.com | - | - | - | - |
| 646 | valentineswim.com | Tucows Domains Inc. | 17 Aug 2020 | 27 Sep 2024 | 17 Aug 2024 |
| 647 | valentinesweb.org | Namesilo, LLC | 18 Nov 2016 | 18 Nov 2024 | 18 Nov 2025 |
| 648 | valentinesday.news | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 649 | valentinesdayweek.org | GoDaddy.com, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 650 | valentinesdayrose.com | GoDaddy.com, LLC | 1 Jan 2023 | 13 Mar 2024 | 1 Jan 2024 |
| 651 | valentinesreservations.com | eNom, Inc. | 3 Mar 2015 | 3 Feb 2016 | 3 Mar 2018 |
| 652 | valentines911.com | eNom, Inc. | 3 Mar 2015 | 20 Sep 2016 | 3 Mar 2019 |
| 653 | valentinesdayquotes.net | Namesilo, LLC | 11 Nov 2018 | 14 May 2020 | 11 Nov 2020 |
| 654 | valentines911.net | eNom, Inc. | 3 Mar 2015 | 3 Feb 2016 | 3 Mar 2018 |
| 655 | valentinesdaybears.com | Tucows Domains Inc. | 4 Feb 2020 | 4 Feb 2020 | 4 Feb 2021 |
| 656 | valentinescoloringpage.com | - | - | - | - |
| 657 | valentinestudiosdsm.com | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 658 | valentinesrentals.com | GoDaddy.com, LLC | 24 Mar 2025 | 24 Mar 2025 | 24 Mar 2026 |
| 659 | valentinesday2016quotesimages.com | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 660 | valentinesjokes.com | 1API GmbH | 26 May 2016 | 1 Jul 2025 | 26 May 2026 |
| 661 | valentinesday-info.com | DropCatch.com 609 LLC | 5 Apr 2017 | 5 Apr 2017 | 5 Apr 2018 |
| 662 | valentinesfilms.com | GoDaddy.com, LLC | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 663 | valentinesdaycraftideas.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Oct 2023 | 7 Dec 2024 | 30 Oct 2024 |
| 664 | valentinesdaydownloads.com | - | - | - | - |
| 665 | valentinesday.online | GoDaddy.com, LLC | 4 Nov 2025 | 4 Nov 2025 | 4 Nov 2026 |
| 666 | valentineshoponline.com | Key-Systems GmbH | 9 Jun 2021 | 10 Jun 2021 | 9 Jun 2022 |
| 667 | valentinesday2016wallpapers.com | GMO Internet Inc. | 8 Jun 2016 | 9 May 2017 | 8 Jun 2018 |
| 668 | valentinesolar.net | eNom, Inc. | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2017 |
| 669 | valentinesocial.com | Automattic Inc. | 15 Aug 2021 | 15 Aug 2021 | 15 Aug 2022 |
| 670 | valentinesdaygiftshop.com | Tucows Domains Inc. | 17 Dec 2023 | 27 Jan 2025 | 17 Dec 2024 |
| 671 | valentinesnap.com | GoDaddy.com, LLC | 29 Jul 2025 | 29 Jul 2025 | 29 Jul 2026 |
| 672 | valentinesdayideasquotes2014.com | - | 16 Jun 2016 | 16 Jun 2016 | 16 Jun 2017 |
| 673 | valentinesday-sms.com | - | - | - | - |
| 674 | valentinesdayjokes2014.com | NamePal.com #8009 | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 675 | valentinesday2016.org | LiquidNet Ltd. | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 676 | valentinesdaywallpapers.com | DropCatch.com 625 LLC | 29 Mar 2015 | 30 Mar 2017 | 29 Mar 2018 |
| 677 | valentinestores.com | TurnCommerce, Inc. DBA NameBright.com | 30 Mar 2015 | 24 Mar 2021 | 30 Mar 2026 |
| 678 | valentinesday123.com | - | - | - | - |
| 679 | valentinesgift.org | Tucows Domains Inc. | 5 Feb 2024 | 18 Mar 2025 | 5 Feb 2025 |
| 680 | valentinesdaysms.com | TurnCommerce, Inc. DBA NameBright.com | 31 Mar 2015 | 11 Jun 2025 | 31 Mar 2025 |
| 681 | valentineshopping.com | NameKing.com Inc. | 31 Oct 2024 | 17 Oct 2025 | 31 Oct 2026 |
| 682 | valentinesdaywallpapers.org | World Biz Domains, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 683 | valentinesdayx.com | GoDaddy.com, LLC | 10 Apr 2023 | 22 Apr 2024 | 10 Apr 2025 |
| 684 | valentines-day-poems.com | NamePal.com #8026 | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 685 | valentineseo.com | Network Solutions, LLC | 7 Apr 2015 | 13 May 2017 | 7 Apr 2018 |
| 686 | valentinesandmore.com | Interweb Advertising D.B.A. Profile Builder | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 687 | valentinesoflondon.com | Namesilo, LLC | 1 Sep 2015 | 20 May 2018 | 1 Sep 2018 |
| 688 | valentinesjournal.com | Wild West Domains, LLC | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 689 | valentinesday.london | Minds + Machines Registrar Limited | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 690 | valentinesgiftbox.com | GoDaddy.com, LLC | 31 Aug 2015 | 12 Oct 2025 | 31 Aug 2026 |
| 691 | valentinesastrology.com | Domain.com, LLC | 29 Aug 2015 | 14 Aug 2016 | 29 Aug 2017 |
| 692 | valentinesinapril.com | Wild West Domains, LLC | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 693 | valentinesdayjokes.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Feb 2022 | 29 Oct 2025 | 12 Feb 2026 |
| 694 | valentinesalao.com | GoDaddy.com, LLC | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2017 |
| 695 | valentines-direct.com | FastDomain Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 696 | valentines-day-specials.com | - | - | - | - |
| 697 | valentinesshine.com | GoDaddy.com, LLC | 19 Apr 2015 | 20 Apr 2025 | 19 Apr 2026 |
| 698 | valentinesecrets.com | - | 11 Jul 2022 | 11 Jul 2023 | 11 Jul 2024 |
| 699 | valentinesday2016cards.com | BigRock Solutions Ltd. | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 700 | valentinesuperlovejam.com | Tucows Domains Inc. | 20 Apr 2015 | 21 Mar 2017 | 20 Apr 2018 |
| 701 | valentinessuperlovejam.com | Tucows Domains Inc. | 20 Apr 2015 | 21 Mar 2017 | 20 Apr 2018 |
| 702 | valentinesrock.com | Namesilo, LLC | 8 Jan 2018 | 9 Jan 2018 | 8 Jan 2019 |
| 703 | valentinesfear.com | GoDaddy.com, LLC | 22 Apr 2015 | 22 Apr 2015 | 22 Apr 2016 |
| 704 | valentinescountrymeats.com | GoDaddy.com, LLC | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 705 | valentinesdaypoems.org | Wild West Domains, LLC | 22 Apr 2015 | 22 Apr 2015 | 22 Apr 2016 |
| 706 | valentinesdayportal.com | eNom661, Inc. | 5 Apr 2019 | 6 Apr 2019 | 5 Apr 2020 |
| 707 | valentinesdaydates.com | Adomainofyourown.com LLC | 24 Apr 2015 | 6 Jun 2017 | 24 Apr 2018 |
| 708 | valentinesdaylingerie.com | - | 5 May 2021 | 7 May 2025 | 5 May 2026 |
| 709 | valentineskitchen.com | GoDaddy.com, LLC | 12 Aug 2019 | 12 Aug 2019 | 12 Aug 2020 |
| 710 | valentineslovestory.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 May 2015 | 24 May 2017 | 1 May 2018 |
| 711 | valentinesupholstery.com | Domain.com, LLC | 3 May 2015 | 18 Apr 2017 | 3 May 2018 |
| 712 | valentineslawns.com | GoDaddy.com, LLC | 5 May 2015 | 5 May 2015 | 5 May 2016 |
| 713 | valentinesdaygames.com | DropCatch.com 1295 LLC | 28 Apr 2017 | 13 Jul 2017 | 28 Apr 2018 |
| 714 | valentinesdayquotes2014.com | Namesilo, LLC | 24 Oct 2016 | 26 Nov 2017 | 24 Oct 2017 |
| 715 | valentineslovequotes.com | GoDaddy.com, LLC | 16 Jul 2022 | 27 Sep 2025 | 16 Jul 2025 |
| 716 | valentinesdaycheckers.com | GoDaddy.com, LLC | 5 May 2015 | 6 May 2025 | 5 May 2026 |
| 717 | valentinesdirect.net | - | - | - | - |
| 718 | valentineseroticart.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 May 2015 | 10 May 2015 | 10 May 2016 |
| 719 | valentinesarais.com | Wix.com Ltd. | 11 Nov 2021 | 22 Dec 2023 | 11 Nov 2023 |
| 720 | valentinesdaycruise2016.com | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 721 | valentinesdoves.com | GoDaddy.com, LLC | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 722 | valentinesdayimages.com | TurnCommerce, Inc. DBA NameBright.com | 5 Aug 2018 | 16 Sep 2024 | 5 Aug 2024 |
| 723 | valentineslandscape.com | GoDaddy.com, LLC | 18 May 2015 | 18 May 2015 | 18 May 2016 |
| 724 | valentinesilvio.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 May 2015 | 18 May 2015 | 18 May 2016 |
| 725 | valentinesdaygift.us | Uniregistrar Corp | 7 Oct 2016 | 7 Oct 2016 | 6 Oct 2017 |
| 726 | valentinesails.com | DNC Holdings, Inc. | 20 May 2015 | 1 Jul 2025 | 20 May 2025 |
| 727 | valentinesandvendettas.com | Domain.com, LLC | 14 Sep 2015 | 14 Sep 2015 | 14 Sep 2016 |
| 728 | valentinesday2016quotes.com | eName Technology Co., Ltd. | 22 May 2019 | 22 May 2019 | 22 May 2020 |
| 729 | valentinesliquorice.com | Tucows Domains Inc. | 22 May 2009 | 26 May 2015 | 22 May 2016 |
| 730 | valentinesday2016wishes.com | - | 15 Sep 2016 | 15 Sep 2016 | 15 Sep 2017 |
| 731 | valentinesday2016images.com | GoDaddy.com, LLC | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 732 | valentinestearoom.com | OVH sas | 31 May 2015 | 31 May 2015 | 31 May 2016 |
| 733 | valentinesdayjokes2014.org | Net 4 India Limited | 31 May 2015 | 1 Jun 2015 | 31 May 2016 |
| 734 | valentinesday2016.info | GoDaddy.com, LLC | 1 Jun 2015 | 2 Jun 2015 | 1 Jun 2016 |
| 735 | valentinesearcher4u.info | Gransy s.r.o. d/b/a subreg.cz | 4 Jun 2015 | - | 4 Jun 2016 |
| 736 | valentinesminions.com | eNom, Inc. | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2016 |
| 737 | valentinesdaystalker.com | Domain.com, LLC | 10 Jun 2015 | 13 Jun 2017 | 10 Jun 2017 |
| 738 | valentinesdaysgift.com | Tucows Domains Inc. | 8 Jan 2024 | 19 Feb 2025 | 8 Jan 2025 |
| 739 | valentinesdayspades.com | GoDaddy.com, LLC | 15 Jun 2015 | 16 Jun 2025 | 15 Jun 2026 |
| 740 | valentinesday-hearts.com | GoDaddy.com, LLC | 15 Jun 2015 | 16 Jun 2025 | 15 Jun 2026 |
| 741 | valentines-day-ideas.org | Crazy Domains FZ-LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2017 |
| 742 | valentinesellshomes.com | Squarespace Domains LLC | 2 Apr 2024 | 19 Mar 2025 | 2 Apr 2026 |
| 743 | valentinesdayimages.org | Namesilo, LLC | 29 Nov 2018 | 29 Nov 2025 | 29 Nov 2026 |
| 744 | valentinesilvo.com | Network Solutions, LLC | 28 Jun 2015 | 30 Jun 2017 | 28 Jun 2018 |
| 745 | valentineslowcostbridal.com | 1&1 Internet AG | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 746 | valentines-low-cost-bridal.com | 1&1 Internet AG | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 747 | valentinesday-2014.com | DropHub.com, Inc. | 23 Jun 2014 | 3 Jul 2015 | 23 Jun 2016 |
| 748 | valentinesauto.com | NameCheap, Inc. | 8 Jul 2019 | 7 Jul 2024 | 8 Jul 2026 |
| 749 | valentinespizzabox.com | GoDaddy.com, LLC | 5 Jul 2015 | 5 Jul 2015 | 5 Jul 2016 |
| 750 | valentinesideasforher.com | NameCheap, Inc. | 9 Jul 2015 | 20 Jul 2025 | 9 Jul 2026 |
| 751 | valentinesgiftforher.com | Namesilo, LLC | 9 Jul 2015 | 20 Nov 2025 | 9 Jul 2026 |
| 752 | valentinesnightclub.com | MidWestDomains, LLC | 19 Dec 2019 | 20 Dec 2019 | 19 Dec 2020 |
| 753 | valentinesgiftideas.org | Namesilo, LLC | 9 Jul 2015 | 20 Nov 2025 | 9 Jul 2026 |
| 754 | valentineslodgeswithhottub.com | Register.it SPA | 12 Jul 2015 | 12 Jul 2015 | 12 Jul 2016 |
| 755 | valentinesgiftsforher.com | GoDaddy.com, LLC | 3 Dec 2019 | 7 Mar 2025 | 3 Dec 2026 |
| 756 | valentinespoolservice.com | register.com, Inc. | 15 Jul 2015 | 17 Jul 2017 | 15 Jul 2018 |
| 757 | valentinesdayideasherhim.com | GoDaddy.com, LLC | 15 Jul 2015 | 16 Jul 2015 | 15 Jul 2016 |
| 758 | valentines-day-flower-delivery.com | Tucows Domains Inc. | 14 Jul 2004 | 18 Jul 2018 | 14 Jul 2018 |
| 759 | valentinesdeli.com | GoDaddy.com, LLC | 28 Sep 2015 | 29 Sep 2025 | 28 Sep 2026 |
| 760 | valentinesqualitypainting.com | DreamHost, LLC | 28 Jul 2015 | 24 Sep 2017 | 28 Jul 2018 |
| 761 | valentinesday-quotes.net | GoDaddy.com, LLC | 26 Jul 2015 | 26 Jul 2015 | 26 Jul 2016 |
| 762 | valentinessecrets.com | GoDaddy.com, LLC | 19 Jan 2020 | 31 Jan 2024 | 19 Jan 2025 |
| 763 | valentineslegends.com | Tucows Domains Inc. | 6 May 2017 | 31 Jul 2025 | 6 May 2026 |
| 764 | valentinesdayinthebahamas.com | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 765 | valentinesdayromantic.com | TLD Registrar Solutions Ltd. | 1 Oct 2015 | 29 Sep 2025 | 1 Oct 2026 |
| 766 | valentines-week.com | GoDaddy.com, LLC | 29 Nov 2020 | 29 Nov 2020 | 29 Nov 2021 |
| 767 | valentinesgayvideo.com | GoDaddy.com, LLC | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 768 | valentinesdrone.com | DROPCATCH.COM 822 LLC | 26 Mar 2018 | 26 Mar 2018 | 26 Mar 2019 |
| 769 | valentinesday2016.net | GoDaddy.com, LLC | 19 Oct 2017 | 20 Oct 2025 | 19 Oct 2026 |
| 770 | valentinesugar.com | Tucows Domains Inc. | 22 Jun 2020 | 26 Jun 2021 | 22 Jun 2021 |
| 771 | valentinesdaysoiree.com | GoDaddy.com, LLC | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2018 |
| 772 | valentinesdayimages2016.org | GoDaddy.com, LLC | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 773 | valentineservice.com | TurnCommerce, Inc. DBA NameBright.com | 7 Aug 2015 | 18 Sep 2024 | 7 Aug 2024 |
| 774 | valentinesdaysms.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Aug 2015 | 9 Aug 2016 | 8 Aug 2017 |
| 775 | valentinesvapes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 776 | valentinesdayvapes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 777 | valentinesday.wedding | Uniregistrar Corp | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 778 | valentinescarcare.net | Tucows Domains Inc. | 5 Oct 2015 | 6 Sep 2016 | 5 Oct 2017 |
| 779 | valentinespierre.com | register.com, Inc. | 17 May 2022 | 20 Jun 2025 | 17 May 2026 |
| 780 | valentinesjewlelry.com | GoDaddy.com, LLC | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 781 | valentinesdaymusic.com | GoDaddy.com, LLC | 11 Oct 2015 | 11 Oct 2025 | 11 Oct 2026 |
| 782 | valentinesgiftsforher.net | NameCheap, Inc. | 20 Apr 2023 | 21 Mar 2025 | 20 Apr 2026 |
| 783 | valentinesagency.com | GoDaddy.com, LLC | 16 Oct 2015 | 16 Oct 2015 | 16 Oct 2016 |
| 784 | valentines-day-flower.com | GMO Internet Inc. | 15 Oct 2015 | 16 Oct 2015 | 15 Oct 2016 |
| 785 | valentinesmood.com | Binero AB | - | - | - |
| 786 | valentinestraining.com | eNom, Inc. | 23 Oct 2015 | 23 Oct 2015 | 23 Oct 2016 |
| 787 | valentineshirts.com | Dynadot, LLC | 23 Oct 2015 | 5 Jan 2025 | 15 Jan 2027 |
| 788 | valentinesdaycandles.com | GoDaddy.com, LLC | 24 Oct 2015 | 24 Oct 2015 | 24 Oct 2017 |
| 789 | valentinesinmaine.com | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2017 |
| 790 | valentinesdayinmaine.com | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2017 |
| 791 | valentinesdayweeklist2016.net | Gransy s.r.o. d/b/a subreg.cz | 30 Nov 2023 | 1 Jan 2025 | 30 Nov 2024 |
| 792 | valentinesteulet.com | Wild West Domains, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2016 |
| 793 | valentinesdayimages2016.com | OnlineNIC, Inc. | 26 Feb 2021 | 26 Feb 2021 | 26 Feb 2022 |
| 794 | valentineservers.com | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 795 | valentinesdaysite.com | - | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2017 |
| 796 | valentineshairandbeauty.com | Tucows Domains Inc. | 26 Oct 2011 | 30 Oct 2015 | 26 Oct 2016 |
| 797 | valentines-guesthouse.com | eNom, Inc. | 30 Oct 2015 | 20 Apr 2017 | 30 Oct 2017 |
| 798 | valentinesstore.net | Tucows Domains Inc. | 29 Jan 2025 | 29 Jan 2025 | 29 Jan 2026 |
| 799 | valentinesgiftsforhim.xyz | NameCheap, Inc. | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 800 | valentinesgiftideas.xyz | NameCheap, Inc. | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 801 | valentinesuperhero.com | GoDaddy.com, LLC | 23 Mar 2020 | 23 Mar 2020 | 23 Mar 2021 |
| 802 | valentinesdayquotess.com | GoDaddy.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 803 | valentines4life.com | Network Solutions, LLC | 2 Nov 2015 | 3 Oct 2025 | 2 Nov 2026 |
| 804 | valentinesdayimageswishes.com | GoDaddy.com, LLC | 4 Nov 2021 | 5 Nov 2021 | 4 Nov 2022 |
| 805 | valentinesdayclock.us | GoDaddy.com, LLC | 8 Nov 2015 | 8 Nov 2016 | 7 Nov 2017 |
| 806 | valentinesdayclock.com | GoDaddy.com, LLC | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 807 | valentinesabode.com | - | - | - | - |
| 808 | valentinesdayz.com | GoDaddy.com, LLC | 12 Sep 2023 | 12 Sep 2023 | 12 Sep 2024 |
| 809 | valentinesdayquotesimages.com | NameCheap, Inc. | 27 Nov 2018 | 27 Nov 2018 | 27 Nov 2019 |
| 810 | valentinesdayquotes.us | NameCheap, Inc. | 27 Jan 2016 | 30 Jan 2017 | 26 Jan 2018 |
| 811 | valentinesinvegas2016.com | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 812 | valentinesdaygifts4u.com | GoDaddy.com, LLC | 23 Jan 2023 | 5 Apr 2024 | 23 Jan 2024 |
| 813 | valentinestraker.com | Wild West Domains, LLC | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 814 | valentinesdaydress.com | NameCheap, Inc. | 1 Dec 2021 | - | 1 Dec 2022 |
| 815 | valentinesdaywishes.net | BigRock Solutions Ltd. | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2016 |
| 816 | valentinesboutiquedressagency.com | Webfusion Ltd. | 13 Nov 2015 | 14 Dec 2015 | 13 Nov 2017 |
| 817 | valentinesboutiquedressagency.club | Mesh Digital Limited | 13 Nov 2015 | 13 Nov 2015 | 12 Nov 2016 |
| 818 | valentinesweeklists.com | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 819 | valentinesdaymessagess.com | Shining Star Domains, LLC | 26 Mar 2019 | 27 Mar 2019 | 26 Mar 2020 |
| 820 | valentinesdayquoteswishes.net | BigRock Solutions Ltd. | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 821 | valentinesweepstakesforthecure.com | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2017 |
| 822 | valentinesweepstakes.com | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2017 |
| 823 | valentineshop.xyz | GoDaddy.com, LLC | 6 Feb 2022 | 6 Feb 2022 | 6 Feb 2023 |
| 824 | valentinesdaypresentideas.com | GoDaddy.com, LLC | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2016 |
| 825 | valentinesdayquotesall.com | GMO Internet Inc. | 9 Feb 2017 | 1 Mar 2017 | 8 Feb 2018 |
| 826 | valentinesinthe.garden | GoDaddy.com, LLC | 26 Nov 2015 | 26 Nov 2015 | 26 Nov 2016 |
| 827 | valentinesweettree.com | GoDaddy.com, LLC | 27 Nov 2015 | 27 Nov 2015 | 27 Nov 2016 |
| 828 | valentinesdaywishes2016.net | BigRock Solutions Ltd. | 27 Nov 2015 | 27 Nov 2015 | 27 Nov 2016 |
| 829 | valentinesdayimagesms.net | BigRock Solutions Ltd. | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 830 | valentinesdaymessages2016.com | BigRock Solutions Ltd. | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 831 | valentinesday2016gifts.com | BigRock Solutions Ltd. | 26 Nov 2015 | 26 Nov 2015 | 26 Nov 2016 |
| 832 | valentinesdaypictures.org | GoDaddy.com, LLC | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 833 | valentinesfunrun.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 834 | valentinesflight.com | GoDaddy.com, LLC | 4 Dec 2015 | 5 Dec 2025 | 4 Dec 2027 |
| 835 | valentinesdaygiftsforhimher.com | GoDaddy.com, LLC | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2016 |
| 836 | valentinesdayfunrun.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 837 | valentinesmarine.net | register.com, Inc. | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 838 | valentinesdayideasz.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 839 | valentinesouthwest.com | Wild West Domains, LLC | 6 Dec 2015 | 17 Dec 2025 | 6 Dec 2026 |
| 840 | valentinesdayideas2016.com | GoDaddy.com, LLC | 7 Dec 2015 | 18 Jan 2017 | 7 Dec 2017 |
| 841 | valentinesday-2016.info | GoDaddy.com, LLC | 8 Dec 2015 | - | 8 Dec 2016 |
| 842 | valentineschmidt.info | Network Solutions, LLC | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 843 | valentinesings.com | GoDaddy.com, LLC | 10 Dec 2015 | 10 Dec 2015 | 10 Dec 2016 |
| 844 | valentinesday-2016.com | GoDaddy.com, LLC | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 845 | valentinesday-quotes.com | Above.com Pty Ltd. | 2 Jun 2022 | 14 Jul 2023 | 2 Jun 2023 |
| 846 | valentines-day2016.com | GoDaddy.com, LLC | 11 Dec 2015 | 11 Dec 2015 | 11 Dec 2016 |
| 847 | valentinesdayiideas.com | GoDaddy.com, LLC | 12 Dec 2015 | 12 Dec 2015 | 12 Dec 2016 |
| 848 | valentinesdayyideas.com | BigRock Solutions Ltd. | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 849 | valentinesday2016sms.com | GoDaddy.com, LLC | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 850 | valentinesdayshop.org | GoDaddy.com, LLC | 25 Apr 2023 | 6 Jun 2024 | 25 Apr 2024 |
| 851 | valentinessweeptakesforthecure.com | GoDaddy.com, LLC | 15 Dec 2015 | 15 Dec 2015 | 15 Dec 2017 |
| 852 | valentinesdayfacts.com | GoDaddy.com, LLC | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2016 |
| 853 | valentinesday2016-cards.com | BigRock Solutions Ltd. | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2016 |
| 854 | valentinesbarpattaya.com | GoDaddy.com, LLC | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2017 |
| 855 | valentinesfruitbaskets.com | GoDaddy.com, LLC | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2016 |
| 856 | valentinesediblefruitbouquets.com | GoDaddy.com, LLC | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2016 |
| 857 | valentinesediblebouquets.com | GoDaddy.com, LLC | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2016 |
| 858 | valentinesdaypoemsx.com | GMO Internet Inc. | 10 Mar 2017 | 10 Mar 2017 | 10 Mar 2018 |
| 859 | valentinesdaylove.com | Tucows Domains Inc. | 14 Jan 2023 | 26 Mar 2024 | 14 Jan 2024 |
| 860 | valentinesdaybeautybasket.com | GoDaddy.com, LLC | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2016 |
| 861 | valentinesbeautybasket.com | GoDaddy.com, LLC | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2016 |
| 862 | valentinesdaywishess.com | GoDaddy.com, LLC | 27 Mar 2017 | 27 Mar 2017 | 27 Mar 2018 |
| 863 | valentinesinc.com | GoDaddy.com, LLC | 9 Apr 2021 | 10 Apr 2025 | 9 Apr 2026 |
| 864 | valentinessweepstakesforthecure.com | GoDaddy.com, LLC | 23 Dec 2015 | 23 Dec 2015 | 23 Dec 2017 |
| 865 | valentinesdaywishes2016.com | GoDaddy.com, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 866 | valentinesdayweddingspecial.com | GoDaddy.com, LLC | 23 Dec 2015 | 23 Dec 2015 | 23 Dec 2016 |
| 867 | valentinesdayquotes-2016.com | GoDaddy.com, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 868 | valentinesdayimagess.com | BigRock Solutions Ltd. | 3 Oct 2018 | 3 Oct 2018 | 3 Oct 2019 |
| 869 | valentinesdayhub.com | Automattic Inc. | 28 Jan 2024 | 8 Jan 2025 | 28 Jan 2026 |
| 870 | valentinesdaycards2016.com | GoDaddy.com, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 871 | valentinesday2016pictures.com | GoDaddy.com, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 872 | valentines123.com | Internet Domain Services BS Corp | 3 Jun 2018 | 3 Jun 2018 | 3 Jun 2019 |
| 873 | valentines-day-memes.com | DevilDogDomains.com, LLC | 13 Mar 2017 | 17 Mar 2017 | 13 Mar 2018 |
| 874 | valentinesdayimages-sms.com | GoDaddy.com, LLC | 25 Dec 2015 | 25 Dec 2015 | 25 Dec 2016 |
| 875 | valentinesdayquotes-wishes.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 9 Jun 2021 | 9 Jun 2021 | 9 Jun 2022 |
| 876 | valentinesdaycards2016.org | SiteName Ltd. | 19 Apr 2016 | 9 Mar 2017 | 19 Apr 2017 |
| 877 | valentinesday2016messages.com | Enom3, Inc. | 14 Mar 2017 | 6 Jul 2017 | 14 Mar 2018 |
| 878 | valentinesnote.com | BigRock Solutions Ltd. | 26 Dec 2015 | 27 Dec 2015 | 26 Dec 2016 |
| 879 | valentinesdaybook.com | Name.com, Inc. | 26 Sep 2022 | 21 Sep 2025 | 26 Sep 2026 |
| 880 | valentinesdaystatus.com | Dynadot, LLC | 17 Mar 2017 | 17 Jan 2018 | 17 Mar 2019 |
| 881 | valentinesdayimage.org | GMO Internet Inc. | 27 Dec 2015 | 15 Aug 2017 | 27 Dec 2018 |
| 882 | valentinesdaycards-2016.com | GMO Internet Inc. | 18 Mar 2017 | 12 Apr 2017 | 18 Mar 2018 |
| 883 | valentinesday2k16.com | 1&1 Internet AG | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 884 | valentinesday2016card.com | GoDaddy.com, LLC | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 885 | valentinesgiftforhim.com | GoDaddy.com, LLC | 24 Dec 2020 | 7 Mar 2025 | 24 Dec 2026 |
| 886 | valentinesdayquotes2016.org | NameCheap, Inc. | 18 Mar 2021 | 2 Apr 2024 | 18 Mar 2025 |
| 887 | valentinesdayfeb.com | GoDaddy.com, LLC | 28 Dec 2015 | 28 Dec 2015 | 28 Dec 2016 |
| 888 | valentinesweekday.com | West263 International Limited | 14 Apr 2021 | 14 Apr 2021 | 14 Apr 2022 |
| 889 | valentinesdayidea.org | GoDaddy.com, LLC | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 890 | valentinesdaywishes-2016.com | GoDaddy.com, LLC | 3 Nov 2018 | 3 Nov 2018 | 3 Nov 2019 |
| 891 | valentinesdaylover.com | BigRock Solutions Ltd. | 30 Dec 2015 | 5 Feb 2017 | 30 Dec 2017 |
| 892 | valentinesdayevent2016.com | GoDaddy.com, LLC | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2016 |
| 893 | valentinesdaydiamond.com | GoDaddy.com, LLC | 31 Dec 2015 | 31 Dec 2024 | 31 Dec 2026 |
| 894 | valentinesdaycard2016.com | BigRock Solutions Ltd. | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2016 |
| 895 | valentinesdayblog.net | BigRock Solutions Ltd. | 30 Dec 2015 | 29 Feb 2016 | 30 Dec 2017 |
| 896 | valentinescheats.org | GoDaddy.com, LLC | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2016 |
| 897 | valentinescheats.net | GoDaddy.com, LLC | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2016 |
| 898 | valentinescheats.info | GoDaddy.com, LLC | 31 Dec 2015 | - | 31 Dec 2016 |
| 899 | valentinescheats.com | DropCatch.com 524 LLC | 19 Mar 2017 | 20 Mar 2017 | 19 Mar 2018 |
| 900 | valentines-etc.com | Mesh Digital Limited | 31 Dec 2015 | 14 Dec 2016 | 31 Dec 2017 |
| 901 | valentines-dayquotes.com | Chengdu West Dimension Digital Technology Co., Ltd… | 27 May 2021 | 27 May 2021 | 27 May 2022 |
| 902 | valentines-daycards.com | GMO Internet Inc. | 6 Oct 2021 | 6 Oct 2021 | 6 Oct 2022 |
| 903 | valentinesdayinabox.com | GoDaddy.com, LLC | 31 Dec 2015 | 1 Jan 2025 | 31 Dec 2025 |
| 904 | valentinesday2016cards.org | GoDaddy.com, LLC | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2016 |
| 905 | valentinesday2016-images.com | OnlineNIC, Inc. | 26 Feb 2021 | 26 Feb 2021 | 26 Feb 2022 |
| 906 | valentinesdaysms2016.com | GMO Internet Inc. | 2 May 2017 | 27 Jan 2018 | 2 May 2018 |
| 907 | valentinesdaypictures2016.com | GoDaddy.com, LLC | 1 Jan 2016 | 1 Jan 2016 | 1 Jan 2017 |
| 908 | valentinesdaybestquotes.com | BigRock Solutions Ltd. | 1 Jan 2016 | 1 Jan 2016 | 1 Jan 2017 |
| 909 | valentinescaterers.co.uk | - | 9 Jan 2012 | 10 Dec 2013 | 9 Jan 2019 |
| 910 | valentinesdaywhatsappdp.com | GoDaddy.com, LLC | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 911 | valentinesdaypoemsoflove.com | NameCheap, Inc. | 26 Nov 2022 | 7 Feb 2024 | 26 Nov 2023 |
| 912 | valentinesdayimagespictures.com | GoDaddy.com, LLC | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 913 | valentinesdayideasforhim.com | Key-Systems GmbH | 28 Apr 2021 | 28 Apr 2021 | 28 Apr 2022 |
| 914 | valentinesdaygifts2016.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 915 | valentinesdaydresscode.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 916 | valentinesday2016wallpaper.com | GoDaddy.com, LLC | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 917 | valentinesday2016poems.com | GoDaddy.com, LLC | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 918 | valentinesday2016pics.com | GoDaddy.com, LLC | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 919 | valentinesday2016greetings.com | GoDaddy.com, LLC | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 920 | valentinesfortheworld.com | GoDaddy.com, LLC | 3 Jan 2016 | 2 Jan 2025 | 3 Jan 2026 |
| 921 | valentinesdayimagespictures2016.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 922 | valentinesdayimagesfree.com | 1&1 Internet AG | 3 Jan 2016 | 4 Jan 2016 | 3 Jan 2017 |
| 923 | valentinesdaycardsquotes.com | enom395, Incorporated | 23 Mar 2017 | 24 Mar 2017 | 23 Mar 2018 |
| 924 | valentinesday2016x.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 925 | valentinesday14.com | BigRock Solutions Ltd. | 2 Jan 2021 | 2 Jan 2021 | 2 Jan 2022 |
| 926 | valentinesforthe.world | GoDaddy.com, LLC | 3 Jan 2016 | 7 Jan 2025 | 3 Jan 2026 |
| 927 | valentinesfortheworld.club | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 2 Jan 2017 |
| 928 | valentinesdaymessages.net | BigRock Solutions Ltd. | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 929 | valentinesdaycards9.net | BigRock Solutions Ltd. | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 930 | valentinesdaycards2016.xyz | GMO Internet Inc. | 18 Mar 2017 | 18 Mar 2017 | 18 Mar 2018 |
| 931 | valentinesdaylwp.com | GoDaddy.com, LLC | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2017 |
| 932 | valentinesdayideas-2016.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 933 | valentinesdaycruise.com | GoDaddy.com, LLC | 16 Aug 2023 | 31 Aug 2025 | 16 Aug 2026 |
| 934 | valentinesdaycardsmessageslovewallpaper.com | GoDaddy.com, LLC | 3 Apr 2017 | 3 Apr 2017 | 3 Apr 2018 |
| 935 | valentinesday2016image.com | GoDaddy.com, LLC | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 936 | valentinesday2016-quotes.com | GoDaddy.com, LLC | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 937 | valentinesday-wishes2016.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 938 | valentinesday-quotes2016.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 939 | valentinesday-cards2016.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 940 | valentineshauntedhouses.com | GoDaddy.com, LLC | 5 Jan 2016 | 16 Nov 2025 | 15 Nov 2028 |
| 941 | valentineshauntedhouse.com | GoDaddy.com, LLC | 5 Jan 2016 | 16 Nov 2025 | 15 Nov 2028 |
| 942 | valentinesgala.com | Metaregistrar BV Applications | 25 Mar 2025 | 6 Jul 2025 | 25 Mar 2026 |
| 943 | valentinesfantasyplaymates.com | register.com, Inc. | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 944 | valentinesdayquotes-cards.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 945 | valentinesdaymsg.com | GMO Internet Inc. | 29 Jun 2019 | 30 Jun 2019 | 29 Jun 2020 |
| 946 | valentinesdayimages-2016.com | GoDaddy.com, LLC | 7 Nov 2018 | 7 Nov 2018 | 7 Nov 2019 |
| 947 | valentinesday-2016.org | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 948 | valentinesdayimages.xyz | GoDaddy.com, LLC | 6 Jan 2016 | 4 Mar 2016 | 6 Jan 2017 |
| 949 | valentinesdaywishess2016.com | GoDaddy.com, LLC | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 950 | valentinesdays2016images.com | GoDaddy.com, LLC | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 951 | valentinesdayimageshd.com | Namesilo, LLC | 15 Jan 2019 | 16 Jan 2019 | 15 Jan 2020 |
| 952 | valentinescardsimages.com | eNom650, Inc. | 13 Dec 2020 | 13 Dec 2020 | 13 Dec 2021 |
| 953 | valentinessday.com | NameCheap, Inc. | 1 Nov 2023 | 1 Nov 2023 | 1 Nov 2024 |
| 954 | valentinesideasforhim.com | PSI-USA, Inc. dba Domain Robot | 3 Apr 2021 | 5 Apr 2021 | 3 Apr 2022 |
| 955 | valentinesgiftsforhimher.com | DropCatch.com 1144 LLC | 28 Dec 2023 | 7 Feb 2025 | 28 Dec 2024 |
| 956 | valentinesdaylovesms2016.com | Namesilo, LLC | 7 Jan 2022 | 8 Jan 2022 | 7 Jan 2023 |
| 957 | valentinesdaygiftideasforhim.com | eNom, Inc. | 21 Aug 2021 | 3 Nov 2024 | 21 Aug 2024 |
| 958 | valentinesday16.com | Name.com, Inc. | 7 Jan 2016 | 7 Jan 2016 | 7 Jan 2017 |
| 959 | valentinesday-2016images.com | NameCheap, Inc. | 21 Feb 2023 | 3 Apr 2024 | 21 Feb 2024 |
| 960 | valentineslover.com | Tucows Domains Inc. | 3 Feb 2024 | 16 Mar 2025 | 3 Feb 2025 |
| 961 | valentinesdaywallpaper2016.com | GoDaddy.com, LLC | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 962 | valentinesdays-2016.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 963 | valentinesday2016ideas.com | GoDaddy.com, LLC | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 964 | valentines-day.xyz | NameCheap, Inc. | 11 Apr 2023 | 1 May 2025 | 11 Apr 2026 |
| 965 | valentinesdayreview.com | West263 International Limited | 21 Oct 2020 | 21 Oct 2020 | 21 Oct 2021 |
| 966 | valentinesdayquote.org | GoDaddy.com, LLC | 9 Jan 2016 | 14 Jan 2017 | 9 Jan 2018 |
| 967 | valentinesdayhd.com | GoDaddy.com, LLC | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 968 | valentinesday2016exclusive.com | GoDaddy.com, LLC | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 969 | valentines-day-2016.com | GoDaddy.com, LLC | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 970 | valentines-2016.com | GoDaddy.com, LLC | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 971 | valentinesdaywishess-2016.com | GoDaddy.com, LLC | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2017 |
| 972 | valentinesdaycupcakes.com | eNom, Inc. | 10 Jan 2016 | 10 Jan 2016 | 10 Jan 2017 |
| 973 | valentinesdaycookies.com | NameCheap, Inc. | 8 Oct 2023 | 20 Dec 2024 | 8 Oct 2024 |
| 974 | valentinesday-wallpaper.com | GoDaddy.com, LLC | 10 Jan 2016 | 10 Jan 2016 | 10 Jan 2017 |
| 975 | valentinesdaywallpapers.xyz | NameCheap, Inc. | 11 Jan 2016 | 18 Feb 2016 | 11 Jan 2017 |
| 976 | valentinesday2016.xyz | NameCheap, Inc. | 11 Jan 2016 | 18 Feb 2016 | 11 Jan 2017 |
| 977 | valentinestuffs.com | GoDaddy.com, LLC | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2017 |
| 978 | valentinesdayswishes.com | Moon Shot Domains, LLC | 13 Dec 2022 | 26 Feb 2024 | 13 Dec 2023 |
| 979 | valentinesdayquotescard.com | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 980 | valentinesdayquote-2016.com | DropCatch.com 1489 LLC | 17 Jun 2023 | 18 Jul 2024 | 17 Jun 2024 |
| 981 | valentinesdaymilwaukee.com | GoDaddy.com, LLC | 11 Jan 2016 | 12 Jan 2025 | 11 Jan 2026 |
| 982 | valentinesdayafloat.com | Melbourne IT, Ltd | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2018 |
| 983 | valentinesdayquoets.com | FastDomain Inc. | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 984 | valentinesdayfundraiser.com | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 985 | valentinesday2016i.com | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 986 | valentineschoco.club | NameCheap, Inc. | 12 Jan 2016 | 13 Jan 2017 | 11 Jan 2018 |
| 987 | valentines-day-cards-2016.com | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 988 | valentinesgala.net | GoDaddy.com, LLC | 12 Jan 2016 | 22 Feb 2025 | 12 Jan 2025 |
| 989 | valentinesday2016ideas.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Jan 2016 | 13 Jan 2017 | 11 Jan 2018 |
| 990 | valentinespics.org | GoDaddy.com, LLC | 7 Jan 2016 | 7 Jan 2016 | 7 Jan 2017 |
| 991 | valentinesdaypics.org | Namesilo, LLC | 23 Mar 2017 | 23 May 2017 | 23 Mar 2018 |
| 992 | valentinesdayquotesh.com | GMO Internet Inc. | 3 Apr 2017 | 3 Apr 2017 | 3 Apr 2018 |
| 993 | valentinesdayimagesideas.com | GoDaddy.com, LLC | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 994 | valentinesdayideas2k16.com | GoDaddy.com, LLC | 13 Jan 2016 | 14 Jan 2016 | 13 Jan 2017 |
| 995 | valentinesdayhdimages.com | FastDomain Inc. | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 996 | valentinesdayimageshq.com | GoDaddy.com, LLC | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2017 |
| 997 | valentinesdayideascards.com | GMO Internet Inc. | 3 Apr 2017 | 22 Apr 2017 | 3 Apr 2018 |
| 998 | valentines-gifts.net | Launchpad, Inc. | 19 Jan 2018 | 19 Jan 2018 | 19 Jan 2019 |
| 999 | valentinesquotes2016.com | 1&1 Internet AG | 15 Jan 2016 | 16 Jan 2017 | 15 Jan 2018 |
| 1000 | valentinesloverun.com | GoDaddy.com, LLC | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
Displaying 1,000 out of 5,582 domains starting with the keyword "VALENTINES". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=valentines
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |