Our database now contains whois records of 686 Million (686,261,142) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1596 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [686 Million Domains] $10,000 Details

Keyword: TRAVELWITHME

Reverse Whois » KEYWORD [travelwithme ]  { 366 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1travelwithme.guruGoDaddy.com, LLC21 Jan 201821 Jan 201821 Jan 2019
2travelwithme.todayGoDaddy.com, LLC17 Jun 202528 Jan 202617 Jun 2026
3travelwithme.usGoDaddy.com, LLC17 Apr 202321 Apr 202417 Apr 2024
4travelwithme.bizGoogle, Inc.2 Mar 201620 Feb 20261 Mar 2027
5travelwithme.onlineGoDaddy.com, LLC22 Jul 201718 Mar 202622 Jul 2026
6travelwithme.orgDynadot, LLC9 Apr 20219 Apr 20269 Apr 2027
7travelwithme.liveNamesilo, LLC24 Sep 202524 Mar 2026-
8travelwithme.comMoniker Online Services LLC26 May 200325 Nov 202526 May 2026
9travelwithme.infoGoDaddy.com, LLC7 Feb 200615 Jan 20257 Feb 2027
10travelwithme.netTurnCommerce, Inc. DBA NameBright.com16 Sep 201922 Sep 202516 Sep 2026
11travelwithme.xyz-13 Aug 202518 Aug 202513 Aug 2026
12travelwithme.mobiCSL Computer Service Langenbach GmbH d/b/a joker.c…19 Dec 201621 Dec 201719 Dec 2018
13travelwithme.photoTucows Domains Inc.21 Feb 201726 Feb 201721 Feb 2018
14travelwithme.co-19 Dec 201624 Dec 201718 Dec 2017
15travelwithme.inGoDaddy.com, LLC22 Feb 20146 Feb 202622 Feb 2033
16travelwithme.co.uk-30 Aug 20203 Mar 202630 Aug 2026
17travelwithme.cloudHostinger, UAB2 Dec 20257 Dec 20252 Dec 2026
18travelwithme.agencyGoDaddy.com, LLC17 Feb 202531 Mar 202617 Feb 2026
19travelwithme.lifeName.com, Inc.15 Apr 202615 Apr 202615 Apr 2027
20travelwithme.worldGoDaddy.com, LLC12 Nov 202427 Dec 202512 Nov 2026
21travelwithme.teamRegional Network Information Center, JSC dba RU-CE…4 Dec 20188 Dec 20214 Dec 2022
22travelwithme.clickDynadot, LLC19 Aug 202219 Aug 202419 Aug 2025
23travelwithme.proHostinger, UAB3 Jan 2025--
24travelwithme.vacationsAutomattic Inc.20 Dec 20195 Dec 202520 Dec 2026
25travelwithme.clubNameCheap, Inc.15 Mar 202430 Mar 202615 Mar 2026
26travelwithme.globalPDR Ltd. d/b/a PublicDomainRegistry.com20 Jan 202020 Mar 202020 Jan 2021
27travelwithme.siteeNom, Inc.12 Apr 202313 Apr 202612 Apr 2027
28travelwithme.travelGoDaddy.com, LLC12 Nov 202427 Dec 202512 Nov 2026
29travelwithme.spaceCV. Rumahweb Indonesia9 Aug 202524 Aug 20259 Aug 2026
30travelwithme.pressAutomattic Inc.11 Apr 201927 Mar 202611 Apr 2027
31travelwithme.storeTucows Domains Inc.14 Apr 202416 Mar 202614 Apr 2027
32travelwithme.socialDynadot, LLC31 Jul 202114 Sep 202531 Jul 2026
33travelwithme.appName.com, Inc.19 Jan 20261 Feb 202619 Jan 2027
34travelwithme.be-17 Sep 2019--
35travelwithme.blogGoDaddy.com, LLC16 Oct 20231 Dec 202516 Oct 2026
36travelwithme.ca-29 May 202130 May 202529 May 2027
37travelwithme.funHostinger, UAB13 Feb 202618 Feb 202613 Feb 2027
38travelwithme.it-25 Aug 201710 Sep 202525 Aug 2026
39travelwithme.nl-6 Jan 200428 Jul 2025-
40travelwithme.vipNameCheap, Inc.27 May 202211 Jun 202427 May 2024
41travelwithme.au--19 Sep 2022-
42travelwithme.uk-10 Feb 202511 Jan 202610 Feb 2027
43travelwithme.websiteNameCheap, Inc.6 Apr 20257 Apr 20266 Apr 2027
44travelwithme.latNameCheap, Inc.17 Sep 202329 Nov 202517 Sep 2025
45travelwithme.ioGoDaddy.com, LLC5 Dec 202510 Dec 20255 Dec 2026
46travelwithme.pl-2 Feb 20262 Feb 20262 Feb 2027
47travelwithme.com.au--24 Jan 2026-
48travelwithme.org.uk-22 Jan 202422 Jan 202522 Jan 2025
49travelwithme.aiGoDaddy.com, LLC19 Apr 20234 Apr 202519 Apr 2027
50travelwithme.ccNamesilo, LLC10 Apr 202414 May 202510 Apr 2025
51travelwithme.pt----
52travelwithme.shopTucows Domains Inc.17 Oct 202323 Sep 2025-
53travelwithme.ru-13 Oct 2017-13 Oct 2026
54travelwithme.com.ng-15 Jun 202415 Aug 202515 Jun 2025
55travelwithme.nz-19 Jul 202410 Jul 2025-
56travelwithme.ro-15 Sep 2024--
57travelwithme.africaHosting Concepts B.V. dba Openprovider5 Nov 202415 Nov 20255 Nov 2025
58travelwithme.cfd-3 Jan 202514 Feb 20263 Jan 2026
59travelwithme.jp-15 Jan 20251 Feb 202628 Feb 2026
60travelwithme.my.idReserved31 Dec 20244 Feb 202631 Dec 2025
61travelwithme.se-20 Feb 202518 Feb 202620 Feb 2027
62travelwithme.ltdGoDaddy.com, LLC22 Mar 202522 Mar 202622 Mar 2027
63travelwithme.eu----
64travelwithme.cyouNameCheap, Inc.25 Apr 202526 Apr 202625 Apr 2027
65travelwithme.cz-3 Nov 20253 Nov 20253 Nov 2026
66travelwithme.christmas-16 Feb 20264 Mar 202616 Feb 2027
67travelwithme.homesGoDaddy.com, LLC16 Feb 202625 Mar 202616 Feb 2027
68travelwithmelly.comTucows Domains Inc.15 Nov 201919 Nov 202015 Nov 2020
69travelwithmeeliteclub.comTucows Domains Inc.16 Sep 201320 Sep 201416 Sep 2015
70travelwithmehmet.comTucows Domains Inc.12 Dec 200816 Dec 202112 Dec 2021
71travelwithmek.comAutomattic Inc.14 May 201923 Nov 202514 May 2026
72travelwithmeholiday.comGoogle, Inc.28 Apr 202218 Aug 202528 Apr 2026
73travelwithmercy.comGoDaddy.com, LLC24 Jan 20152 Jan 202525 Oct 2026
74travelwithmeera.comGoDaddy.com, LLC4 Feb 20154 Feb 20154 Feb 2016
75travelwithmee.comNameCheap, Inc.11 Jan 202025 Mar 202611 Jan 2026
76travelwithmelo.comGoDaddy.com, LLC31 Mar 201531 Mar 201531 Mar 2016
77travelwithmedimitramckissic.infoWild West Domains, LLC5 Apr 2015-5 Apr 2016
78travelwithmery.comNameCheap, Inc.2 Feb 20262 Feb 20262 Feb 2027
79travelwithmequeenp.comregister.com, Inc.28 Apr 201528 Apr 201528 Apr 2016
80travelwithmenow.comNetwork Solutions, LLC6 Mar 20266 Mar 20266 Mar 2027
81travelwithmelc.comGoDaddy.com, LLC17 Apr 202429 May 202517 Apr 2025
82travelwithme7.comGoDaddy.com, LLC13 Jun 201513 Jun 201513 Jun 2016
83travelwithmex.comHostinger, UAB25 Jan 202426 Jan 202625 Jan 2027
84travelwithmealert.comGoDaddy.com, LLC26 Sep 201526 Sep 201526 Sep 2016
85travelwithmen.comGoDaddy.com, LLC9 Feb 20249 Feb 20249 Feb 2027
86travelwithme365day.xyzNameCheap, Inc.27 Dec 201527 Dec 201527 Dec 2016
87travelwithmerrill.comTucows Domains Inc.29 Dec 201531 Jan 202629 Dec 2026
88travelwithmeandphotography.comRegistryGate GmbH5 Jan 201610 Feb 20265 Jan 2027
89travelwithme5280.comTucows Domains Inc.22 Jan 201626 Jan 201822 Jan 2018
90travelwithme2016.comGoDaddy.com, LLC12 Feb 201612 Feb 201612 Feb 2017
91travelwithmehz.comNetwork Solutions, LLC10 Feb 201625 Apr 202510 Feb 2025
92travelwithmesrilanka.comNameKing.com Inc.23 Feb 20163 Mar 202623 Feb 2027
93travelwithmetoparadise.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Mar 201630 Mar 201712 Mar 2018
94travelwithme360.comGoDaddy.com, LLC27 Oct 201927 Oct 201927 Oct 2020
95travelwithmegan.comNameCheap, Inc.6 Dec 202417 Jan 20266 Dec 2025
96travelwithmemorymakers.comGoDaddy.com, LLC6 Jun 201614 Oct 20256 Jun 2026
97travelwithmelia.comDomain.com, LLC6 Jun 20166 Jun 20166 Jun 2017
98travelwithmebag.comTucows Domains Inc.12 Jun 201616 Jun 201712 Jun 2017
99travelwithme-amandine.comGoDaddy.com, LLC15 Jun 201615 Jun 201615 Jun 2017
100travelwithme37.infoGoDaddy.com, LLC24 Jun 201624 Jun 201624 Jun 2017
101travelwithme37.comGoDaddy.com, LLC24 Jun 201624 Jun 201624 Jun 2018
102travelwithmeaning.lifeeNom, Inc.16 Jun 201621 Jun 201616 Jun 2017
103travelwithme2.menAlpnames Limited17 Jun 201622 Jun 201617 Jun 2017
104travelwithmeposter.com-29 Aug 201629 Aug 201629 Aug 2017
105travelwithmeamoira.comGoDaddy.com, LLC8 Sep 20169 Sep 20258 Sep 2026
106travelwithmeto.comWild West Domains, LLC2 Feb 20143 Jan 20262 Feb 2027
107travelwithmeis.com-18 Apr 20256 Apr 202618 Apr 2027
108travelwithmershawn.comGoDaddy.com, LLC27 Feb 20139 Feb 202627 Feb 2027
109travelwithmeaning.comGoDaddy.com, LLC20 Jul 201421 Jul 202520 Jul 2026
110travelwithmevacations.comGoDaddy.com, LLC21 Oct 201314 Oct 201521 Oct 2016
111travelwithmedi.comGoDaddy.com, LLC16 Feb 201217 Feb 202616 Feb 2027
112travelwithmelandronnie.comTucows Domains Inc.13 Oct 200917 Oct 202113 Oct 2021
113travelwithmetta.comGoDaddy.com, LLC15 Oct 201216 Oct 201415 Oct 2016
114travelwithmer.comAutomattic Inc.8 Apr 20198 Apr 20198 Apr 2020
115travelwithmeryl.comGoDaddy.com, LLC3 Sep 201215 Oct 20253 Sep 2025
116travelwithmetoitaly.comTucows Domains Inc.26 Sep 201011 Sep 201726 Sep 2019
117travelwithmeridian.comThe Registry at Info Avenue, LLC d/b/a Spirit Comm…4 May 20122 Apr 20254 May 2026
118travelwithmelissa.comTucows Domains Inc.30 Aug 201216 Aug 202530 Aug 2026
119travelwithmea.comGoDaddy.com, LLC11 Apr 200318 Apr 202611 Apr 2027
120travelwithmel.comName.com, Inc.10 Jun 202510 Jun 202510 Jun 2026
121travelwithmeglutenfree.comGoDaddy.com, LLC1 May 20132 May 20161 May 2017
122travelwithmecom.comTucows Domains Inc.10 Oct 201614 Oct 201710 Oct 2017
123travelwithmea.orgGoDaddy.com, LLC9 Mar 20254 Mar 20269 Mar 2027
124travelwithmetw.com-29 Oct 201629 Oct 201629 Oct 2017
125travelwithmeraki.comNamesilo, LLC3 Dec 20164 Dec 20253 Dec 2026
126travelwithme112.comAutomattic Inc.29 Dec 201629 Nov 201729 Dec 2018
127travelwithmeforfree.comGoDaddy.com, LLC12 Jan 201713 Jan 202512 Jan 2027
128travelwithmeko.comGoogle, Inc.15 Jan 201731 Dec 202515 Jan 2027
129travelwithmeme.comFastDomain Inc.16 Feb 201731 Jan 202616 Feb 2027
130travelwithmeaning.netAmazon Registrar, Inc.28 Feb 201719 Mar 202528 Feb 2026
131travelwithmehdi.comWeb Commerce Communications Limited dba WebNic.cc12 Mar 201717 Nov 202512 Mar 2027
132travelwithme-alexv.comFastDomain Inc.1 Apr 20171 Apr 20171 Apr 2018
133travelwithmeeks.comTucows Domains Inc.14 Apr 201718 Apr 201814 Apr 2018
134travelwithme247blog.comAutomattic Inc.26 May 201723 Nov 202526 May 2026
135travelwithmetoday.comHosting Concepts B.V. dba Openprovider17 Apr 202617 Apr 202617 Apr 2027
136travelwithmeibelle.comLaunchpad, Inc.10 Aug 201710 Aug 201710 Aug 2018
137travelwithmeli.comDomain.com, LLC6 Oct 20176 Oct 20176 Oct 2018
138travelwithmechon.com1&1 Internet AG19 Oct 201719 Oct 201719 Oct 2018
139travelwithmemakesyouhappy.vacationsGoogle, Inc.21 Oct 201721 Oct 201721 Oct 2018
140travelwithme4free.comLaunchpad, Inc.7 Nov 20177 Nov 20177 Nov 2018
141travelwithmelba.comAscio Technologies, Inc. Danmark - Filial af Ascio…19 Nov 201719 Nov 201719 Nov 2018
142travelwithmevlog.comNetwork Solutions, LLC21 Nov 201721 Nov 201721 Nov 2018
143travelwithme-kimberly.comAutomattic Inc.10 Dec 201710 Dec 201710 Dec 2018
144travelwithmeaning.co.uk-28 Feb 201725 Jan 202528 Feb 2026
145travelwithmeaning.ukGandi SAS28 Feb 201728 Feb 201728 Feb 2018
146travelwithmehannah.comAutomattic Inc.11 Jan 201822 Dec 202511 Jan 2027
147travelwithmelodie.comGoDaddy.com, LLC16 Jun 202216 Jun 202416 Jun 2026
148travelwithmetravel.com1&1 Internet AG27 Mar 201827 Mar 201827 Mar 2019
149travelwithmenepal.comGMO Internet Inc.13 Jun 202425 Jul 202513 Jun 2025
150travelwithmeinus.comOVH sas18 Apr 201819 Apr 202518 Apr 2026
151travelwithmeg.comGoDaddy.com, LLC24 Jan 202224 Jan 202624 Jan 2028
152travelwithmeet.comOVH sas12 May 201812 May 201812 May 2019
153travelwithmeandsee.comFastDomain Inc.6 Jun 201810 Jun 20256 Jun 2028
154travelwithmekafordrn.comGoDaddy.com, LLC20 Jun 201821 Jun 202520 Jun 2026
155travelwithmeco.comTucows Domains Inc.21 Jun 201825 Jun 202221 Jun 2022
156travelwithmeanywhere.comGoDaddy.com, LLC29 Jun 201813 Jul 202529 Jun 2026
157travelwithmetaliag.comNetwork Solutions, LLC11 Jul 201821 Jun 202411 Jul 2026
158travelwithmedicare.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Jul 201818 Jul 201818 Jul 2019
159travelwithme247.com1&1 Internet AG23 Jul 20182 Aug 202023 Jul 2021
160travelwithmeetch.comGoDaddy.com, LLC10 Aug 201810 Aug 201810 Aug 2019
161travelwithmeghan.comHostinger, UAB4 Mar 20225 Feb 20264 Mar 2027
162travelwithmeej.comGoogle, Inc.13 Oct 201813 Oct 201813 Oct 2019
163travelwithme-jessicamaire.comGoDaddy.com, LLC5 Nov 20185 Nov 20185 Nov 2019
164travelwithmefree.comNameCheap, Inc.12 Nov 201812 Nov 201812 Nov 2019
165travelwithmecanbefree.comGoDaddy.com, LLC3 Jan 20193 Jan 20193 Jan 2020
166travelwithmeechannel.comNetwork Solutions, LLC15 Jan 201916 Jan 201915 Jan 2020
167travelwithmeek.comGoogle, Inc.24 Jun 20253 Nov 202524 Jun 2026
168travelwithmeik.comAutomattic Inc.9 Feb 20199 Feb 20199 Feb 2020
169travelwithmetucson.comGoDaddy.com, LLC13 Feb 201913 Feb 201913 Feb 2020
170travelwithmethursday.comGoDaddy.com, LLC13 Feb 201913 Feb 201913 Feb 2020
171travelwithmestore.comTucows Domains Inc.3 Mar 201913 Apr 20203 Mar 2020
172travelwithmeonline.comGoDaddy.com, LLC10 Mar 201910 Mar 201910 Mar 2020
173travelwithme8.comHangzhou AiMing Network Co., LTD7 Mar 20269 Mar 20267 Mar 2027
174travelwithmelloney.pageGoogle, Inc.30 Mar 201930 Mar 201930 Mar 2020
175travelwithme-l.comAutomattic Inc.2 Apr 20192 Apr 20192 Apr 2020
176travelwithmegha.comGoDaddy.com, LLC30 Apr 201930 Apr 201930 Apr 2020
177travelwithmegg.comNetwork Solutions, LLC26 Jan 20219 Mar 202626 Jan 2026
178travelwithme007.comGoDaddy.com, LLC12 Jun 201912 Jun 202512 Jun 2026
179travelwithmel.netSquarespace Domains LLC31 Mar 202516 Mar 202631 Mar 2027
180travelwithme11.comGoogle, Inc.15 Jun 201915 Jun 201915 Jun 2020
181travelwithmerit.comNetwork Solutions, LLC7 Jul 20197 Jul 20197 Jul 2020
182travelwithmeng.comNameCheap, Inc.11 Jul 201912 Jul 202511 Jul 2026
183travelwithmetocuba.comMesh Digital Limited29 Jul 201929 Jul 201929 Jul 2020
184travelwithmeandsam.com1&1 Internet AG26 Aug 201926 Aug 201926 Aug 2020
185travelwithmebro.comGoDaddy.com, LLC18 Sep 201918 Sep 201918 Sep 2020
186travelwithmecbd.comGoDaddy.com, LLC19 Sep 201919 Sep 201919 Sep 2020
187travelwithmeyl.comDropCatch.com 458 LLC3 Dec 202413 Feb 20263 Dec 2025
188travelwithme24x7.comAutomattic Inc.12 Oct 201923 Nov 202512 Oct 2026
189travelwithmeworld.comeNom, Inc.10 Mar 202110 Mar 202110 Mar 2022
190travelwithmego.comDreamHost, LLC31 Oct 201931 Oct 201931 Oct 2020
191travelwithmeredith.comGoDaddy.com, LLC25 Nov 201926 Nov 202525 Nov 2027
192travelwithmevirtually.com-19 Feb 202423 Mar 202519 Feb 2025
193travelwithmeindia.comGoDaddy.com, LLC23 Dec 20196 Mar 202523 Dec 2024
194travelwithmes.comAutomattic Inc.7 Jan 20207 Jan 20207 Jan 2021
195travelwithmeili.comGoDaddy.com, LLC17 Jan 202028 Feb 202617 Jan 2026
196travelwithmemoriesinthemaking.comGoDaddy.com, LLC23 Jan 20204 Feb 202423 Jan 2025
197travelwithmefairytaleconcierge.comTucows Domains Inc.25 Jan 202029 Jan 202325 Jan 2023
198travelwithmeeta.comGoDaddy.com, LLC29 Jan 202029 Jan 202029 Jan 2023
199travelwithmedication.comKey-Systems GmbH21 Feb 202023 Dec 202521 Feb 2026
200travelwithmeblog.comGoogle, Inc.28 Feb 202013 Feb 202628 Feb 2027
201travelwithmelon.comAutomattic Inc.2 Mar 20202 Mar 20202 Mar 2021
202travelwithmecreatively.comLaunchpad, Inc.15 Apr 202026 Feb 202615 Apr 2027
203travelwithmeonairbnb.comGoDaddy.com, LLC2 May 202015 May 20252 May 2026
204travelwithmeasoulsjourney.comGoDaddy.com, LLC13 Jun 202025 Jul 202313 Jun 2023
205travelwithmeri.comTucows Domains Inc.27 Jun 202012 Jun 202527 Jun 2026
206travelwithmedhi.com1API GmbH17 Jul 202030 Aug 202317 Jul 2023
207travelwithmeashleyp.comGoDaddy.com, LLC1 Sep 20201 Sep 20201 Sep 2021
208travelwithmeorion.comLaunchpad, Inc.15 Nov 202028 Dec 202315 Nov 2023
209travelwithmetro.comGoDaddy.com, LLC24 Nov 202024 Nov 202024 Nov 2021
210travelwithmecoastalvacations.comNetwork Solutions, LLC27 Nov 202027 Nov 202027 Nov 2021
211travelwithmerritt.comSquarespace Domains LLC29 Jan 202529 Jan 202529 Jan 2028
212travelwithmeproducts.comGoDaddy.com, LLC21 Dec 202021 Dec 202021 Dec 2021
213travelwithmekp.comGoDaddy.com, LLC30 Jan 202130 Jan 202130 Jan 2023
214travelwithme2.comRealtime Register B.V.15 Feb 202416 Feb 202515 Feb 2026
215travelwithmeon.com1&1 Internet AG22 Feb 202122 Feb 202122 Feb 2027
216travelwithmehereandthere.comAutomattic Inc.6 Mar 20216 Mar 20216 Mar 2022
217travelwithmelanie.comTucows Domains Inc.6 Apr 202122 Mar 20266 Apr 2027
218travelwithmehul.comHosting Concepts B.V. dba Openprovider8 Apr 20218 Apr 20218 Apr 2022
219travelwithmebeyondborders.comGoogle, Inc.21 Apr 202122 Apr 202321 Apr 2024
220travelwithmegh.comDropCatch.com 685 LLC10 Aug 202321 Oct 202410 Aug 2024
221travelwithmely.comDomain.com, LLC27 Jun 202127 Jun 202127 Jun 2022
222travelwithme-twm.comTucows Domains Inc.6 Aug 202110 Aug 20226 Aug 2022
223travelwithme247.xyzHostinger, UAB21 Aug 202122 Aug 202121 Aug 2022
224travelwithmelinda.comGoDaddy.com, LLC22 Aug 20217 Nov 202522 Aug 2026
225travelwithme32.comGoDaddy.com, LLC24 Sep 202126 Sep 202124 Sep 2022
226travelwithmevacations.netGoogle, Inc.26 Sep 202127 Nov 202326 Sep 2023
227travelwithmealcoholfree.comGoDaddy.com, LLC24 Nov 20215 Feb 202424 Nov 2023
228travelwithmelanin.comGoDaddy.com, LLC11 Dec 202121 Feb 202411 Dec 2023
229travelwithmetiu.comAutomattic Inc.11 Dec 202111 Dec 202111 Dec 2022
230travelwithmelove.comKey-Systems GmbH30 Dec 20213 Feb 202630 Dec 2026
231travelwithme123.topWeb Commerce Communications Limited dba WebNic.cc30 Mar 202230 Mar 202330 Mar 2024
232travelwithmenow.netFastDomain Inc.29 May 202230 Jun 202329 May 2023
233travelwithmegan08734.comWix.com Ltd.20 Jun 202231 Jul 202320 Jun 2023
234travelwithme1.storeBeget LLC26 Jun 202231 Aug 202326 Jun 2023
235travelwithmena.comGoDaddy.com, LLC2 Aug 20223 Aug 20252 Aug 2026
236travelwithme365.comHosting Concepts B.V. dba Openprovider8 Aug 202220 Dec 20258 Aug 2026
237travelwithmervis.comNameCheap, Inc.11 Mar 202430 Mar 202511 Mar 2026
238travelwithme3d.comGoDaddy.com, LLC12 Oct 202224 Dec 202312 Oct 2023
239travelwithmetravelagency.netGoogle, Inc.2 Nov 20222 Jan 20252 Nov 2024
240travelwithmeachell.comGoogle, Inc.11 Nov 202211 Nov 202311 Nov 2024
241travelwithmeleonz.comGoDaddy.com, LLC26 Nov 202227 Nov 202526 Nov 2026
242travelwithmegg.onlineNetwork Solutions, LLC18 Dec 202229 Feb 202418 Dec 2023
243travelwithmedico.comCosmotown, Inc.27 Dec 20227 Mar 202427 Dec 2023
244travelwithmeech.comTucows Domains Inc.18 Feb 20257 Feb 202618 Feb 2027
245travelwithmelinda.orgGoogle, Inc.18 Jan 20239 Feb 202418 Jan 2024
246travelwithmead.comCloudFlare, Inc.19 Jan 202328 Feb 202419 Jan 2024
247travelwithmearound.worldGoDaddy.com, LLC22 Jan 20233 Apr 202422 Jan 2024
248travelwithmeetr.comTucows Domains Inc.25 Jan 202310 Jan 202625 Jan 2027
249travelwithmexico.comGoogle, Inc.2 Feb 202316 Apr 20262 Feb 2026
250travelwithmeheather.comFastDomain Inc.13 Feb 202327 Apr 202413 Feb 2024
251travelwithmetogreece.comTucows Domains Inc.13 Feb 202325 Mar 202413 Feb 2024
252travelwithmeclub.comGoDaddy.com, LLC17 Nov 201717 Nov 202517 Nov 2026
253travelwithmeagency.orgGoDaddy.com, LLC28 Feb 202310 Apr 202428 Feb 2024
254travelwithmeade.comGoogle, Inc.8 Mar 202321 Feb 20268 Mar 2027
255travelwithmesantorini.comGoDaddy.com, LLC15 Mar 202322 Mar 202615 Mar 2027
256travelwithmetea.comWix.com Ltd.18 Jan 202019 Dec 202518 Jan 2027
257travelwithmeena.comeNom, Inc.20 Jan 202024 Apr 202620 Jan 2027
258travelwithmega.comregister.com, Inc.21 Mar 20233 May 202421 Mar 2024
259travelwithmermaids.comGoDaddy.com, LLC7 Mar 20218 Mar 20267 Mar 2027
260travelwithmeem.com-27 Mar 20233 May 202427 Mar 2024
261travelwithmeugc.comSquarespace Domains LLC27 Mar 202327 May 202427 Mar 2024
262travelwithmeichelle.comWix.com Ltd.28 Jul 20217 Sep 202428 Jul 2024
263travelwithmeta.comGoDaddy.com, LLC6 Nov 202118 Dec 20236 Nov 2023
264travelwithmeldden.comFastDomain Inc.5 Apr 20237 Apr 20265 Apr 2027
265travelwithmelb.comWix.com Ltd.6 Apr 202317 May 20256 Apr 2025
266travelwithmejamaica.comGoDaddy.com, LLC7 Apr 20238 Apr 20267 Apr 2027
267travelwithmetours.comGoDaddy.com, LLC8 Apr 202311 Apr 20258 Apr 2027
268travelwithme365.netGoDaddy.com, LLC8 Apr 20239 Apr 20258 Apr 2027
269travelwithmefotography.comGoDaddy.com, LLC11 Feb 202211 Feb 202511 Feb 2028
270travelwithmemagazine.comWix.com Ltd.26 Feb 20228 May 202326 Feb 2023
271travelwithmethe.worldMesh Digital Limited4 Mar 20207 Feb 20254 Mar 2026
272travelwithmelore.com-4 Jun 20225 Jun 20254 Jun 2026
273travelwithmejax.comGoDaddy.com, LLC15 Apr 202316 Apr 202615 Apr 2027
274travelwithmeandadhd.comNameCheap, Inc.21 Apr 202322 Mar 202621 Apr 2027
275travelwithmel.nlThe Registrar Company B.V.19 Dec 201717 Mar 2021-
276travelwithmeaning.orgGoDaddy.com, LLC4 Oct 20259 Oct 20254 Oct 2026
277travelwithmelody.comNameCheap, Inc.14 Mar 202614 Mar 202614 Mar 2027
278travelwithmeayb2.comWix.com Ltd.7 May 202317 Jun 20247 May 2024
279travelwithmeon.co.uk-22 Feb 202121 Feb 202622 Feb 2027
280travelwithmefriday.comGoDaddy.com, LLC12 May 202313 May 202512 May 2026
281travelwithmenna.comWebfusion Ltd.16 May 202327 Jun 202516 May 2025
282travelwithmegs.comGoDaddy.com, LLC17 May 202328 Jul 202417 May 2024
283travelwithmeldden.blogAutomattic Inc.27 May 202322 Nov 202527 May 2026
284travelwithmeagency.comGoDaddy.com, LLC7 Jun 20238 Jun 20257 Jun 2027
285travelwithmeeh.comWix.com Ltd.12 Jun 202323 Jul 202412 Jun 2024
286travelwithmegk.comGoDaddy.com, LLC15 Jun 202315 Jun 202515 Jun 2026
287travelwithmebellaiza.comWix.com Ltd.23 Jun 202327 Jun 202523 Jun 2026
288travelwithmecenter.comHostinger, UAB30 Jun 20234 Jun 202530 Jun 2026
289travelwithmeeran.comGoDaddy.com, LLC5 Aug 202316 Sep 20245 Aug 2024
290travelwithmesharonb.comGoDaddy.com, LLC11 Aug 202325 Aug 202511 Aug 2026
291travelwithme-allenb.comGoDaddy.com, LLC14 Sep 202320 Sep 202514 Sep 2027
292travelwithmekatrena.comSquarespace Domains LLC15 Sep 202327 Nov 202515 Sep 2025
293travelwithmejennymcghie.comHosting Concepts B.V. dba Openprovider26 Oct 202323 Dec 202526 Oct 2026
294travelwithmee.netAutomattic Inc.27 Oct 202327 Oct 202327 Oct 2024
295travelwithmenicb.co.uk-15 Nov 202310 Nov 202515 Nov 2026
296travelwithmebaby.comGoDaddy.com, LLC23 Nov 202330 Oct 202523 Nov 2026
297travelwithmetomorocco.comRealtime Register B.V.14 Dec 202315 Dec 202514 Dec 2026
298travelwithmell.comSquarespace Domains LLC13 Jan 202424 Feb 202513 Jan 2025
299travelwithmenna.blogAutomattic Inc.8 Feb 20248 Feb 20248 Feb 2025
300travelwithmedicalplans.comGoDaddy.com, LLC8 Feb 202422 Apr 20258 Feb 2025
301travelwithmedicalinsurance.comGoDaddy.com, LLC11 Feb 202425 Mar 202511 Feb 2025
302travelwithmethod.comAutomattic Inc.21 Feb 20245 Apr 202521 Feb 2025
303travelwithmeraki.infoGoogle, Inc.25 Feb 202415 Feb 202625 Feb 2027
304travelwithmeandyou.comRealtime Register B.V.26 Feb 202427 Feb 202626 Feb 2027
305travelwithme444.comGoDaddy.com, LLC13 Mar 202414 Mar 202613 Mar 2027
306travelwithmebymarie.blog-14 Jul 202512 Sep 202514 Jul 2026
307travelwithmeida.comGoDaddy.com, LLC4 Apr 202416 Jun 20254 Apr 2025
308travelwithmee.vipGoDaddy.com, LLC12 Apr 202417 Oct 202512 Apr 2027
309travelwithmezz.comGoogle, Inc.12 Apr 202428 Mar 202612 Apr 2027
310travelwithmes.blog-15 Jul 202513 Sep 202515 Jul 2026
311travelwithme-jp.shopNameKing.com Inc.18 Dec 202318 Jan 202518 Dec 2025
312travelwithmetosuccess.comGoDaddy.com, LLC6 May 202421 Mar 20266 May 2026
313travelwithme7.onlineHostinger, UAB14 May 202427 Jun 202514 May 2025
314travelwithmegan.co.uk-27 May 202427 May 202427 May 2025
315travelwithmesoulguidance.comAutomattic Inc.11 Jun 202423 Nov 202511 Jun 2026
316travelwithmemorymakingmoma.comGoDaddy.com, LLC20 Jun 202421 Jun 202520 Jun 2026
317travelwithmethailand.comDynadot, LLC22 Jul 202423 Jul 202522 Jul 2026
318travelwithmelissacaitlin.comTucows Domains Inc.12 Aug 202422 Sep 202512 Aug 2025
319travelwithmeontheroadagain.comGoDaddy.com, LLC24 Aug 20245 Nov 202524 Aug 2025
320travelwithmehailey.comregister.com, Inc.31 Aug 20241 Sep 202531 Aug 2026
321travelwithme-luggages.comNameCheap, Inc.3 Sep 202415 Oct 20253 Sep 2025
322travelwithmei.onlineNetwork Solutions, LLC12 Sep 20242 Sep 202512 Sep 2026
323travelwithmei.comNetwork Solutions, LLC12 Sep 202412 Sep 202412 Sep 2027
324travelwithmelah.comWix.com Ltd.18 Sep 202428 Nov 202518 Sep 2025
325travelwithmemories.comGoogle, Inc.28 Sep 20249 Nov 202528 Sep 2025
326travelwithmetouragency.orgSquarespace Domains LLC4 Oct 202415 Nov 20254 Oct 2025
327travelwithmelody.orgNameCheap, Inc.12 Oct 202417 Sep 202512 Oct 2026
328travelwithmebytrain.comGoDaddy.com, LLC30 Oct 202431 Oct 202530 Oct 2026
329travelwithmenna.orgAutomattic Inc.7 Nov 202424 Nov 20257 Nov 2026
330travelwithmeagan.comGoDaddy.com, LLC7 Nov 20247 Nov 20247 Nov 2027
331travelwithmedicine.comRegistryGate GmbH12 Nov 202417 Dec 202512 Nov 2026
332travelwithme00.comGoogle, Inc.16 Nov 20241 Nov 202516 Nov 2026
333travelwithmey.comNameCheap, Inc.12 Jan 20258 Jan 202612 Jan 2027
334travelwithmelona.comCosmotown, Inc.13 Jan 202526 Mar 202613 Jan 2026
335travelwithmeee.comNameCheap, Inc.14 Jan 202525 Feb 202614 Jan 2026
336travelwithmemilan.linkPDR Ltd. d/b/a PublicDomainRegistry.com17 Jan 202527 Feb 202617 Jan 2026
337travelwithmettina.comHostinger, UAB23 Jan 20257 Apr 202623 Jan 2026
338travelwithmeschissa.comAutomattic Inc.26 Jan 20256 Jan 202626 Jan 2027
339travelwithmegan.ca-3 Apr 20244 Mar 20263 Apr 2027
340travelwithmelih.comGoDaddy.com, LLC4 Mar 20254 Mar 20254 Mar 2028
341travelwithmei-mei.comCloudFlare, Inc.10 Mar 20254 Mar 202610 Mar 2027
342travelwithmelanieandfitzroy.comGoDaddy.com, LLC19 Apr 202519 Apr 202519 Apr 2027
343travelwithme35.ru-26 May 2025-26 May 2026
344travelwithmecasi.comTucows Domains Inc.3 Jun 20253 Jun 20253 Jun 2026
345travelwithmeds.comNameCheap, Inc.24 Jun 202524 Jun 202524 Jun 2026
346travelwithmeconsultancy.comName.com, Inc.27 Jul 202527 Jul 202527 Jul 2026
347travelwithmekd.comCloudFlare, Inc.5 Aug 202512 Aug 20255 Aug 2026
348travelwithmeagle.comAutomattic Inc.21 Aug 202523 Nov 202521 Aug 2026
349travelwithmeglutenfree2.blogAutomattic Inc.26 Aug 202522 Nov 202526 Aug 2026
350travelwithmeadventure.comWix.com Ltd.8 Sep 20258 Sep 20258 Sep 2027
351travelwithmeadventure.netWix.com Ltd.8 Sep 20258 Sep 20258 Sep 2027
352travelwithmedestinations.comGoDaddy.com, LLC8 Sep 20258 Sep 20258 Sep 2028
353travelwithmeglutenfree2.orgAutomattic Inc.2 Oct 202525 Nov 20252 Oct 2026
354travelwithmejennyp.comName.com, Inc.8 Nov 20258 Nov 20258 Nov 2027
355travelwithme2.orgNameCheap, Inc.19 Nov 202510 Dec 202519 Nov 2026
356travelwithmelanka.comHostinger, UAB21 Nov 202521 Nov 202521 Nov 2026
357travelwithmejo.comAutomattic Inc.14 Dec 202514 Dec 202514 Dec 2026
358travelwithmegane.com1&1 Internet AG22 Dec 202522 Dec 202522 Dec 2026
359travelwithmeganlee.comDreamHost, LLC1 Jan 20261 Jan 20261 Jan 2027
360travelwithmel.infoNetwork Solutions, LLC9 Feb 20269 Feb 20269 Feb 2028
361travelwithmerav.comWix.com Ltd.17 Feb 202619 Feb 202617 Feb 2027
362travelwithmeanistone.comNameCheap, Inc.17 Feb 202617 Feb 202617 Feb 2027
363travelwithmedia.comOne.com A/S23 Feb 202624 Feb 202623 Feb 2027
364travelwithmendis.comNameCheap, Inc.9 Mar 20269 Mar 20269 Mar 2027
365travelwithmed.comCloudFlare, Inc.2 Apr 20262 Apr 20262 Apr 2027
366travelwithme299.blogAutomattic Inc.26 Apr 202626 Apr 202626 Apr 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=travelwithme

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now