Our database now contains whois records of 669 Million (669,278,164) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [669 Million Domains] $10,000 Details

Keyword: THRISH

Reverse Whois » KEYWORD [thrish ]  { 143 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1thrish.comGoDaddy.com, LLC5 May 200515 Apr 20255 May 2026
2thrish.org-9 Dec 20248 Feb 20269 Dec 2025
3thrish.click-26 Dec 20242 Jan 202626 Dec 2026
4thrishoolexim.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Nov 20142 Nov 20251 Nov 2026
5thrishul.comDynadot, LLC19 Apr 20213 Dec 202519 Apr 2027
6thrishakthimanthrashramam.comGoDaddy.com, LLC11 Nov 201411 Nov 201411 Nov 2015
7thrishasexmovies.comTucows Domains Inc.9 Dec 201113 Dec 20149 Dec 2015
8thrisha.linkUniregistrar Corp18 Mar 201518 Mar 201518 Mar 2016
9thrishannamartin.comGoDaddy.com, LLC9 Jan 20159 Jan 20159 Jan 2016
10thrishikerpservices.comBigRock Solutions Ltd.21 Aug 201521 Aug 201521 Aug 2016
11thrishahot.comDynadot, LLC28 May 201528 May 201528 May 2016
12thrishaparks.comGoDaddy.com, LLC27 Jun 201527 Jun 201527 Jun 2016
13thrishabath.comGoDaddy.com, LLC11 Jan 201611 Jan 201611 Jan 2017
14thrishyaconsulting.comGoDaddy.com, LLC7 Aug 20157 Aug 20157 Aug 2018
15thrishivaperoor.comHostinger, UAB14 Nov 201510 Nov 202514 Nov 2026
16thrishbeautytech.comGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2017
17thrishrippierealty.comregister.com, Inc.15 Apr 201615 Apr 201615 Apr 2017
18thrishanku.comGoDaddy.com, LLC20 Apr 201612 Jun 202520 Apr 2029
19thrishabathroom.com-31 Jul 201631 Jul 201631 Jul 2017
20thrishaphotos.com-31 Jul 201631 Jul 201631 Jul 2017
21thrish-edeele.com1API GmbH30 Jun 201322 Nov 202530 Jun 2026
22thrishaservices.comHongkong Domain Name Information Management Co., L…10 Nov 202113 Nov 202210 Nov 2022
23thrishacenter.comMelbourne IT, Ltd20 Apr 201031 Mar 201720 Apr 2018
24thrishasex.comTucows Domains Inc.31 Jan 201931 Jan 201931 Jan 2020
25thrishabathroomseen.comPSI-USA, Inc. dba Domain Robot2 Jan 201421 Feb 20172 Jan 2018
26thrishedeele.com1API GmbH30 Jun 201322 Nov 202530 Jun 2026
27thrisha.comHostinger, UAB15 Mar 20021 Aug 202515 Mar 2027
28thrishanude.comGoDaddy.com, LLC16 Jul 200526 Jun 202516 Jul 2026
29thrishnaa.comGoDaddy.com, LLC15 Nov 201527 Jan 202515 Nov 2024
30thrishna.comGoDaddy.com, LLC28 Dec 20138 Dec 202528 Dec 2026
31thrishadevelopers.com-5 Oct 20165 Oct 20165 Oct 2017
32thrishedeele.net1API GmbH30 Jun 201322 Nov 202530 Jun 2026
33thrish-edeele.net1API GmbH30 Jun 201322 Nov 202530 Jun 2026
34thrishulsofttech.comGoDaddy.com, LLC5 Dec 20165 Dec 20165 Dec 2017
35thrishaservices.in-11 Jan 201711 Jan 202511 Jan 2025
36thrishakthihanuman.orgPDR Ltd. d/b/a PublicDomainRegistry.com26 Apr 201726 Jun 201726 Apr 2018
37thrishabrowne.netGoDaddy.com, LLC31 May 201731 May 201731 May 2020
38thrishabrowne.comGoDaddy.com, LLC31 May 201731 May 201731 May 2020
39thrishakthi.orgGoDaddy.com, LLC6 Feb 20266 Feb 20266 Feb 2027
40thrishalanddevelopers.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Aug 201714 Aug 201714 Aug 2018
41thrishula.worldNameCheap, Inc.8 Nov 20179 Nov 20178 Nov 2018
42thrishnarestaurant.co.uk-2 Feb 20112 Feb 20252 Feb 2026
43thrishna-takeaway.co.uk-13 Apr 20141 Apr 201613 Apr 2019
44thrishnaonline.co.uk-1 May 201427 Apr 20161 May 2018
45thrishnacuisine.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…13 Jul 201713 Jul 201713 Jul 2019
46thrishatravels.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Jan 201818 Jan 201818 Jan 2019
47thrishindustries.comOne.com A/S11 Jun 202412 Jun 202511 Jun 2026
48thrishland.comNameCheap, Inc.6 Apr 20186 Apr 20186 Apr 2019
49thrishenpillay.comTucows Domains Inc.17 May 201821 May 202217 May 2022
50thrishikha.comBigRock Solutions Ltd.13 Jun 201813 Jun 201813 Jun 2019
51thrishankdoorsandply.comHostinger, UAB2 Aug 201828 Sep 20252 Aug 2029
52thrishen.comTucows Domains Inc.16 Oct 201816 Oct 201816 Oct 2019
53thrishcream.comUniregistrar Corp---
54thrishneuroclinik.comDomain.com, LLC21 Nov 201822 Nov 201821 Nov 2019
55thrishtraders.comNetwork Solutions, LLC12 Dec 201812 Dec 201812 Dec 2019
56thrishold.comFujian Domains, Inc.8 Apr 20209 Apr 20208 Apr 2021
57thrishnaitcs.comGoDaddy.com, LLC4 Feb 201918 Mar 20254 Feb 2025
58thrishulsene.comGoDaddy.com, LLC2 Mar 20192 Mar 20192 Mar 2020
59thrishe.comPorkbun, LLC30 Mar 201930 Mar 201930 Mar 2020
60thrishalaentertainments.comGoDaddy.com, LLC20 Aug 201920 Aug 201920 Aug 2021
61thrishulmedia.comGoDaddy.com, LLC21 Aug 20192 Oct 202421 Aug 2024
62thrishaland.comGoDaddy.com, LLC26 Aug 201926 Aug 201926 Aug 2020
63thrishulgigafiber.comGoDaddy.com, LLC7 Dec 202013 Dec 20257 Dec 2026
64thrishdevelopersandbuilders.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Oct 201912 Oct 201912 Oct 2020
65thrishakthi.comGoDaddy.com, LLC22 Apr 202022 Apr 202022 Apr 2022
66thrishafashion.comTucows Domains Inc.29 Apr 20203 May 202129 Apr 2021
67thrishulnews.comBigRock Solutions Ltd.14 Jun 202018 Aug 202514 Jun 2026
68thrishnaharidas.comCosmotown, Inc.21 Feb 20232 Apr 202421 Feb 2024
69thrishul.netGoDaddy.com, LLC25 Jul 20206 Oct 202425 Jul 2024
70thrished-nottable.icuKey-Systems, LLC5 Dec 20198 Aug 20205 Dec 2020
71thrishaandcompany.comGoDaddy.com, LLC16 Sep 202028 Jul 202516 Sep 2025
72thrishultech.comGoDaddy.com, LLC22 Jan 20215 Mar 202522 Jan 2025
73thrishultechedu.comGoDaddy.com, LLC22 Jan 20213 Feb 202422 Jan 2025
74thrishaelectronicsbd.xyzNameCheap, Inc.17 Feb 20253 Mar 202517 Feb 2026
75thrishul.usGoDaddy.com, LLC25 Jul 20205 Sep 202425 Jul 2024
76thrishakthidevalayammetpally.comGoDaddy.com, LLC12 May 202124 Jul 202412 May 2024
77thrishula.comNordreg AB14 Sep 202429 Oct 202514 Sep 2025
78thrishagames.comHosting Concepts B.V. dba Openprovider13 Jul 202113 Jul 202113 Jul 2022
79thrishna.designNameCheap, Inc.8 Feb 202520 Oct 20258 Feb 2026
80thrishva.comAmazon Registrar, Inc.16 Aug 202112 Jul 202516 Aug 2026
81thrishblackell.comGoDaddy.com, LLC1 Sep 20211 Sep 20211 Sep 2022
82thrishul.siteHostinger, UAB24 Sep 202124 Sep 202124 Sep 2022
83thrishakthiaquaservices.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Nov 202112 Nov 202112 Nov 2022
84thrishala.comWeb Commerce Communications Limited dba WebNic.cc19 Nov 202119 Nov 202119 Nov 2026
85thrishank.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Nov 202110 Jan 202629 Nov 2025
86thrishacycles.comGoDaddy.com, LLC23 Dec 202123 Dec 202123 Dec 2022
87thrishaelectronics.xyzNameCheap, Inc.18 Feb 20241 Apr 202518 Feb 2025
88thrishacomunica.comEstrategias WebSite S.L.25 Apr 20225 Jul 202325 Apr 2023
89thrishikerpservices.in-1 Mar 201728 Aug 20251 Mar 2027
90thrisha.hostHostinger, UAB14 Jul 202219 Sep 202314 Jul 2023
91thrishdiruudiaries.comFastDomain Inc.30 Aug 202212 Oct 202430 Aug 2024
92thrishul.websiteHostinger, UAB19 Jan 20244 Mar 202519 Jan 2025
93thrishi.comGandi SAS7 Oct 202217 Nov 20237 Oct 2023
94thrishulpackagingindustries.comTucows Domains Inc.13 Aug 20241 Sep 202513 Aug 2026
95thrisha.xyzDynadot, LLC16 Jun 202417 Jun 202516 Jun 2026
96thrishainteriors.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jan 202321 Mar 20248 Jan 2024
97thrishakthiprojects.comGoDaddy.com, LLC9 Feb 202322 Mar 20249 Feb 2024
98thrishma.comAmazon Registrar, Inc.1 Nov 201727 Sep 20251 Nov 2026
99thrishworks.comNameCheap, Inc.21 Aug 202024 Aug 202521 Aug 2026
100thrishtilabs.comWix.com Ltd.4 Sep 20205 Aug 20254 Sep 2026
101thrishika.comGoDaddy.com, LLC7 Apr 20218 Apr 20257 Apr 2026
102thrishon.comGoDaddy.com, LLC2 Mar 202213 Apr 20232 Mar 2023
103thrishind.comCosmotown, Inc.10 Jun 202430 Jun 202510 Jun 2026
104thrishul.orgGoDaddy.com, LLC25 Jul 20205 Oct 202425 Jul 2024
105thrishultech.orgGoDaddy.com, LLC22 Jan 20214 Mar 202422 Jan 2024
106thrishrofy.co.uk-23 Sep 20215 Oct 202223 Sep 2023
107thrishal.comGoDaddy.com, LLC8 May 20238 May 20238 May 2026
108thrishakrishna.comDomain.com, LLC11 Sep 202325 Oct 202411 Sep 2024
109thrishareddydeluxeboyshostel.orgPDR Ltd. d/b/a PublicDomainRegistry.com28 Nov 20239 Jan 202528 Nov 2024
110thrishaseo.comHosting Concepts B.V. dba Openprovider11 Dec 202321 Jan 202511 Dec 2024
111thrishulstoneexports.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jan 20249 Dec 20258 Jan 2027
112thrisha-sha.comNameCheap, Inc.24 Jan 20247 Mar 202524 Jan 2025
113thrisha20.comNameCheap, Inc.24 Jan 20247 Mar 202524 Jan 2025
114thrishafc.comGoDaddy.com, LLC9 Feb 202419 Feb 20249 Feb 2027
115thrishamartinrealty.comGoDaddy.com, LLC1 Mar 20241 Mar 20241 Mar 2027
116thrishamartin.comGoDaddy.com, LLC1 Mar 20241 Mar 20251 Mar 2026
117thrishmontessorichildcarecentre.com.au--3 Dec 2025-
118thrishna.co.uk-2 Jun 20215 Mar 20252 Jun 2026
119thrishagroup.comGoDaddy.com, LLC19 Apr 202431 May 202519 Apr 2025
120thrishanka.comGoogle, Inc.18 Oct 202429 Nov 202518 Oct 2025
121thrishevents.comNameCheap, Inc.1 Nov 20241 Nov 20251 Nov 2026
122thrishkiga.comAutomattic Inc.19 Nov 20242 Jan 202619 Nov 2025
123thrisha-internship.onlineAutomattic Inc.17 Nov 20249 Dec 202517 Nov 2026
124thrishyahandlooms.linkPDR Ltd. d/b/a PublicDomainRegistry.com31 Jan 202516 Feb 202531 Jan 2026
125thrishool.comHostinger, UAB3 Jun 20253 Jun 20253 Jun 2026
126thrishaexpensetracker.comGoDaddy.com, LLC19 Jul 202519 Jul 202519 Jul 2026
127thrishenterprises.comGoogle, Inc.24 Jul 202524 Jul 202524 Jul 2026
128thrisha.netHostinger, UAB1 Aug 20251 Aug 20251 Aug 2027
129thrishulsherigar.comHostinger, UAB5 Aug 20255 Aug 20255 Aug 2026
130thrisha.onlineHostinger, UAB7 Aug 202512 Aug 20257 Aug 2028
131thrishavbuilders.comGoDaddy.com, LLC27 Aug 202527 Aug 202527 Aug 2028
132thrishakthiinfradevelopers.comGoDaddy.com, LLC28 Aug 202528 Aug 202528 Aug 2028
133thrishunakatram28.com1&1 Internet AG19 Sep 202519 Sep 202519 Sep 2026
134thrishasuresh.comGoDaddy.com, LLC4 Oct 20256 Oct 20254 Oct 2026
135thrishakti.orgHostinger, UAB24 Oct 202529 Oct 202524 Oct 2026
136thrishitowing.comHostinger, UAB29 Oct 202529 Oct 202529 Oct 2026
137thrishulindustries.comBigRock Solutions Ltd.8 Nov 20258 Jan 20268 Nov 2035
138thrishfinancecoaching.comName.com, Inc.19 Nov 202519 Nov 202519 Nov 2026
139thrishulikareddy.comHostinger, UAB5 Dec 20255 Dec 20255 Dec 2026
140thrishekajewels.comHostinger, UAB6 Dec 20256 Dec 20256 Dec 2026
141thrishan.comGoDaddy.com, LLC18 Dec 202518 Dec 202518 Dec 2026
142thrishnavijay.comCrazy Domains FZ-LLC21 Dec 202521 Dec 202521 Dec 2026
143thrishastudio.shopGoDaddy.com, LLC1 Feb 20261 Feb 20261 Feb 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=thrish

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now