Our database now contains whois records of 624 Million (624,291,459) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1589 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [624 Million Domains] $10,000 Details

Keyword: THESCIENCE

Reverse Whois » KEYWORD [thescience ]  { 4,343 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1thescience.showEpik Inc.1 Mar 202213 Apr 20241 Mar 2024
2thescience.companySibername Internet and Software Technologies Inc.25 Nov 201425 Nov 201425 Nov 2016
3thescience.ninjaNetwork Solutions, LLC3 Jan 20157 Feb 20253 Jan 2025
4thescience.expertNetwork Solutions, LLC3 Jan 20157 Feb 20253 Jan 2025
5thescience.reportGoogle, Inc.12 Feb 20253 Jun 202512 Feb 2026
6thescience.websiteGoDaddy.com, LLC14 Jan 201714 Jan 201714 Jan 2018
7thescience.partyDynadot, LLC17 Aug 201717 Aug 201717 Aug 2018
8thescience.club1API GmbH25 Nov 20161 Dec 202424 Nov 2025
9thescience.newsEpik Inc.1 Mar 202213 Apr 20241 Mar 2024
10thescience.infoALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED23 May 202424 May 202523 May 2026
11thescience.technologyGandi SAS13 Sep 20156 Jan 201713 Sep 2017
12thescience.xyzGandi SAS14 Sep 201519 Aug 201614 Sep 2017
13thescience.academyNameCheap, Inc.12 Apr 202424 May 202512 Apr 2025
14thescience.orgDynadot, LLC1 Feb 201613 May 20251 Feb 2026
15thescience.usGoDaddy.com, LLC19 Jul 202025 Jul 202419 Jul 2026
16thescience.comName.com, Inc.17 Jan 199920 Feb 202517 Jan 2026
17thescience.techNameCheap, Inc.12 Apr 202424 May 202512 Apr 2025
18thescience.spaceCloudFlare, Inc.13 Mar 202518 Mar 202513 Mar 2028
19thescience.host-24 May 201624 May 201624 May 2017
20thescience.in-28 Jan 20107 Jan 201628 Jan 2017
21thescience.scienceNameCheap, Inc.11 Sep 201726 Sep 202311 Sep 2023
22thescience.guruNameCheap, Inc.11 May 202416 Apr 202511 May 2026
23thescience.todayNameCheap, Inc.16 Jan 202521 Jan 202516 Jan 2026
24thescience.bizMesh Digital Limited22 Sep 20139 Jun 202421 Sep 2031
25thescience.storeChengdu West Dimension Digital Technology Co., Ltd…16 May 202417 May 202516 May 2026
26thescience.oneDynadot, LLC22 Dec 201830 Dec 201922 Dec 2020
27thescience.netAnnulet LLC15 May 20062 Jun 202515 May 2026
28thescience.cloudHostinger, UAB11 Dec 201924 Nov 202411 Dec 2025
29thescience.worldNameKing.com Inc.2 Dec 20202 Dec 20202 Dec 2021
30thescience.wtfGoDaddy.com, LLC3 Oct 201727 Jul 20243 Oct 2025
31thescience.siteChengdu West Dimension Digital Technology Co., Ltd…13 May 202414 May 202513 May 2026
32thescience.loveNameCheap, Inc.30 Nov 20175 Nov 202430 Nov 2025
33thescience.ukReserved22 Dec 201522 Dec 201622 Dec 2018
34thescience.co.uk-9 Mar 20175 Mar 20259 Mar 2026
35thescience.zoneGoDaddy.com, LLC15 Mar 201815 Mar 201815 Mar 2019
36thescience.onlineLimited Liability Company "Registrar of domain nam…3 Nov 201830 Oct 20243 Nov 2025
37thescience.pageGoDaddy.com, LLC20 Nov 201820 Nov 201820 Nov 2019
38thescience.proNameCheap, Inc.12 Apr 202424 May 202512 Apr 2025
39thescience.teamAmazon Registrar, Inc.18 Jun 202319 May 202518 Jun 2026
40thescience.directoryGoDaddy.com, LLC17 May 202018 May 202517 May 2026
41thescience.lifeGoDaddy.com, LLC20 Jul 202020 Jul 202020 Jul 2021
42thescience.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 May 20247 May 20256 May 2026
43thescience.moneyKey-Systems, LLC22 Dec 202122 Dec 202122 Dec 2022
44thescience.networkAmazon Registrar, Inc.19 Nov 202220 Oct 202419 Nov 2025
45thescience.blogAutomattic Inc.3 Oct 202411 Nov 20243 Oct 2025
46thescience.liveGoDaddy.com, LLC22 Jan 20233 Apr 202422 Jan 2024
47thescience.devGoogle, Inc.25 Nov 202117 May 202425 Nov 2028
48thescience.co.inNamecroc.com LLC27 Jun 202227 Jun 202327 Jun 2023
49thescience.it-10 Sep 201426 Sep 202410 Sep 2025
50thescience.lolPorkbun, LLC20 Aug 20221 Sep 202320 Aug 2024
51thescience.coolGoDaddy.com, LLC30 Jul 202311 Sep 202430 Jul 2025
52thescience.ltdMesh Digital Limited24 Apr 20235 Jul 202424 Apr 2024
53thescience.shopGoDaddy.com, LLC21 Mar 202412 Apr 202421 Mar 2025
54thescience.com.au--10 May 2025-
55thescience.instituteNameCheap, Inc.12 Apr 202424 May 202512 Apr 2025
56thescience.ru-19 Oct 2018-19 Oct 2025
57thescience.ai----
58thescience.foundationGoDaddy.com, LLC29 Aug 20243 Sep 202429 Aug 2025
59thescience.agencyNameCheap, Inc.25 Oct 202430 Oct 202425 Oct 2025
60thescience.appNameCheap, Inc.25 Dec 2024-25 Dec 2025
61thescience.ioNameCheap, Inc.12 Apr 202412 Apr 202512 Apr 2026
62thescienceofdeduction.co.uk-17 Dec 20186 Jan 202517 Dec 2026
63thescienceofhalo.comWild West Domains, LLC21 Oct 201421 Oct 201421 Oct 2015
64thesciencedaily.com-8 Nov 202320 Jan 20258 Nov 2024
65thesciencedictionary.orgGoDaddy.com, LLC17 Dec 201231 Jan 202517 Dec 2025
66thescienceforum.comGoDaddy.com, LLC18 Oct 200411 Oct 202418 Oct 2025
67thescienceforums.comWest263 International Limited15 Oct 202015 Oct 202015 Oct 2021
68thesciencegeek.comGoDaddy.com, LLC24 Apr 201213 May 202524 Apr 2026
69thescienceofacne.comTurnCommerce, Inc. DBA NameBright.com19 Sep 201024 Aug 202419 Sep 2025
70thescienceofeating.comGoDaddy.com, LLC19 Dec 201120 Dec 202419 Dec 2025
71thesciencepenguin.comGoDaddy.com, LLC27 Nov 201128 Nov 202427 Nov 2025
72thescienceworld.comMarkMonitor Inc.20 May 20142 Aug 202420 May 2026
73thesciencesite.orgEasyspace LTD28 Sep 20213 Sep 202428 Sep 2025
74thescienceofcheating.comTucows Domains Inc.20 Oct 201324 Oct 201420 Oct 2015
75thesciencefictionist.comNameCheap, Inc.23 Oct 201423 Sep 202423 Oct 2025
76thesciencechef.comenom385, Incorporated4 May 20216 May 20254 May 2026
77thescienceofluck.comNameCheap, Inc.25 Oct 201411 Jan 201825 Oct 2024
78thescienceofcricket.comGoDaddy.com, LLC30 May 201431 May 201530 May 2016
79thescienceoforganization.comGoDaddy.com, LLC31 May 20081 Jun 201531 May 2016
80thescienceofknowledge.comGoDaddy.com, LLC31 May 20081 Jun 201531 May 2016
81thescienceofstayingyoung.infoGoDaddy.com, LLC21 May 201421 May 201521 May 2016
82thescienceofstayingyoung.meGoDaddy.com, LLC21 May 201421 May 201521 May 2016
83thescienceofstayingyoung.orgGoDaddy.com, LLC21 May 20142 Jun 201521 May 2016
84thescienceofme.comGoogle, Inc.15 May 202030 Apr 202515 May 2026
85thescienceofsuccess.orgKey-Systems GmbH31 Aug 201217 Feb 202531 Aug 2025
86thescienceofcommunication.comeNom, Inc.19 Feb 20111 Mar 202519 Feb 2026
87thescienceteam.comeNom, Inc.6 Dec 20107 Dec 20246 Dec 2025
88thescienceofpositivethinkingbook.com1&1 Internet AG28 Oct 20147 May 201728 Oct 2017
89thescienceofpeace.comeNom, Inc.16 Apr 201017 Apr 202516 Apr 2026
90thescienceteachers.comeNom, Inc.4 Aug 20119 Jul 20174 Aug 2017
91thescienceofseduction.comeNom, Inc.6 Jan 201218 Feb 20256 Jan 2025
92thescienceofselling.comeNom, Inc.14 Nov 20118 Nov 202414 Nov 2025
93thesciencetimes.comeNom, Inc.4 May 200910 May 20254 May 2026
94thesciencelab.comeNom, Inc.30 Sep 199826 Sep 202429 Sep 2025
95thescienceofnature.comeNom, Inc.9 Oct 201010 Oct 20249 Oct 2025
96thesciencebitch.comGoDaddy.com, LLC31 Jan 20131 Feb 202531 Jan 2026
97thescienceofzen.comGoDaddy.com, LLC8 Apr 20208 Apr 20208 Apr 2021
98thesciences.coGoDaddy.com, LLC1 May 201519 May 201530 Apr 2016
99thescienceofsleep.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Oct 201221 Sep 202430 Oct 2025
100thesciencesleuth.comTucows Domains Inc.20 May 202030 Jun 202320 May 2023
101thescienceofsociety.comGoDaddy.com, LLC11 Feb 202212 Feb 202411 Feb 2026
102thesciencecoach.comTurnCommerce, Inc. DBA NameBright.com17 Jan 201811 Jan 202117 Jan 2026
103thescienceskinny.comHongkong Domain Name Information Management Co., L…12 Nov 202115 Nov 202212 Nov 2022
104thescienceofbeingrich.comGoDaddy.com, LLC24 Mar 200725 Mar 201524 Mar 2016
105thesciencedictionary.comNameCheap, Inc.14 May 200814 Apr 202514 May 2026
106thesciencebookstore.comNetwork Solutions, LLC19 Apr 199918 Feb 202519 Apr 2026
107thesciencesource.comGoDaddy.com, LLC7 Sep 19977 Sep 20246 Sep 2025
108thesciencehouse.orgAmazon Registrar, Inc.1 Aug 20123 Jul 20241 Aug 2025
109thescienceshop.ca-23 Mar 20223 Jun 202523 Mar 2025
110thesciencebehinddating.comGoDaddy.com, LLC12 Jun 201413 Jun 201512 Jun 2016
111thesciencebehindcollegelife.comGoDaddy.com, LLC12 Jun 201413 Jun 201512 Jun 2016
112thesciencebehindselling.comGoDaddy.com, LLC12 Jun 201413 Jun 201512 Jun 2016
113thesciencebehindparenting.comGoDaddy.com, LLC12 Jun 201413 Jun 201512 Jun 2016
114thesciencebehindpolitics.comGoDaddy.com, LLC12 Jun 201413 Jun 201512 Jun 2016
115thesciencebehindgettingwhatyouwant.comGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2015
116thescienceofastrophotography.orgGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2015
117thesciencebehindsales.comName.com, Inc.17 Sep 201718 Aug 202417 Sep 2025
118thescienceofstyle.coGoDaddy.com, LLC16 Jun 201321 Jun 201515 Jun 2015
119thescienceofhandanalysis.comGoDaddy.com, LLC18 Jun 201318 Jun 201518 Jun 2016
120thescienceoflifepurposedecoding.comGoDaddy.com, LLC18 Jun 201318 Jun 201518 Jun 2016
121thescienceacademy.orgGoDaddy.com, LLC18 Aug 20142 Oct 202418 Aug 2025
122thescienceofsafety.orgGoDaddy.com, LLC18 Aug 201419 Aug 201718 Aug 2018
123thescienceteacherswife.comGoDaddy.com, LLC18 Aug 201419 Aug 201618 Aug 2017
124thesciencepage.comeNom1036, Inc.27 Oct 202428 Oct 202427 Oct 2025
125thescienceofcontrol.comGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2019
126thescienceandspiritofhealing.comTucows Domains Inc.21 Jun 201021 Jun 201021 Jun 2017
127thesciencewiz.comNetwork Solutions, LLC24 Jun 201520 Jun 202424 Jun 2025
128thescienceofstress.comGoDaddy.com, LLC1 Mar 20172 Mar 20251 Mar 2026
129thescienceofcuriosity.comGoDaddy.com, LLC20 Oct 20201 Jan 202420 Oct 2023
130thescienceditors.com----
131thesciencelabbar.comTucows Domains Inc.6 Sep 202317 Oct 20246 Sep 2024
132thescienceofpersonalmasterylessons.comGoDaddy.com, LLC1 Mar 20151 Mar 20151 Mar 2016
133thescienceofwellness.comTurnCommerce, Inc. DBA NameBright.com10 Jul 20144 Jul 202010 Jul 2025
134thescienceofdating.comGoDaddy.com, LLC15 Jan 202116 Jan 202515 Jan 2026
135thescienceofpersonality.infoGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2015
136thescienceofgenius.comGoDaddy.com, LLC26 Aug 201412 May 202511 May 2026
137thescienceofhappiness.comNameCheap, Inc.14 Aug 20142 Oct 202114 Aug 2031
138thesciencetree.comGoogle, Inc.18 Jul 202218 Jul 202318 Jul 2024
139thescienceofyourlife.comArsys Internet, S.L. dba NICLINE.COM28 Feb 201828 Feb 201828 Feb 2019
140thescienceofastrophotography.comGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2015
141thescienceofastrophotography.infoGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2015
142thescienceofastrophotography.netGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2015
143thescienceofalpha.comGoDaddy.com, LLC2 Aug 20202 Aug 20202 Aug 2021
144thescienceofmentalphysics.orgGoDaddy.com, LLC12 Nov 201412 Nov 201412 Nov 2015
145thesciencemind.comCronon AG22 Sep 202022 Sep 202021 Sep 2021
146thescienceofyourlife.neteNom, Inc.28 Aug 201427 Jul 201528 Aug 2017
147thescienceofyourlife.orgeNom, Inc.28 Aug 201428 Aug 201428 Aug 2015
148thesciencefictionalist.comGoDaddy.com, LLC13 Sep 201413 Sep 201413 Sep 2016
149thescienceofsecurity.netWild West Domains, LLC13 Sep 201414 Sep 201613 Sep 2017
150thesciencething.comGoDaddy.com, LLC14 Sep 201415 Sep 202414 Sep 2027
151thescienceofbaking.comAmazon Registrar, Inc.3 Aug 20246 Aug 20243 Aug 2025
152thescienceofpastry.comGoDaddy.com, LLC1 Sep 20142 Sep 20161 Sep 2017
153thescienceoftapping.comGoDaddy.com, LLC17 Sep 201417 Sep 202417 Sep 2025
154thescienceoffabulous.comGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
155thescienceoffootball.com-10 Aug 201010 Aug 201010 Aug 2017
156thesciencerevolution.comNamesilo, LLC4 Feb 20215 Apr 20244 Feb 2024
157thesciencefaction.comNetwork Solutions, LLC15 Sep 201416 Aug 202415 Sep 2027
158thesciencegang.comNameCheap, Inc.20 Mar 202421 Mar 202520 Mar 2026
159thescienceoftapping.orgGoDaddy.com, LLC17 Sep 20141 Nov 202417 Sep 2025
160thesciencegirl.orgWild West Domains, LLC14 Nov 201414 Nov 201414 Nov 2015
161thesciencepublishers.comNamesilo, LLC3 Sep 201410 Sep 20243 Sep 2025
162thesciencestop.comGoDaddy.com, LLC4 Sep 201416 Oct 20244 Sep 2024
163thesciencerevolution.orgDomain.com, LLC15 Nov 201428 Jan 201815 Nov 2018
164thesciencesquirrel.comGoDaddy.com, LLC18 Sep 201419 Sep 202418 Sep 2025
165thescienceandmath.comGoDaddy.com, LLC5 Sep 20146 Sep 20145 Sep 2015
166thescienceoftruehealing.comFastDomain Inc.20 Jan 201820 Jan 201820 Jan 2019
167thescienceofliving.orgGoDaddy.com, LLC6 Sep 201419 Sep 20166 Sep 2017
168thesciencedevotional.comGoDaddy.com, LLC30 Sep 201430 Sep 201430 Sep 2015
169thescienceoflongevity.comGoDaddy.com, LLC30 Jan 202530 Jan 202530 Jan 2026
170thescienceoflongevity.neteNom, Inc.9 Sep 20144 Sep 20169 Sep 2017
171thesciencecrew.comGoDaddy.com, LLC1 May 20204 May 20251 May 2026
172thesciencegiant.comGoDaddy.com, LLC18 Feb 202018 Feb 202418 Feb 2026
173thesciencechain.orgTucows Domains Inc.28 Sep 20102 Oct 201428 Sep 2015
174thescienceoftruth.comTurnCommerce, Inc. DBA NameBright.com19 Nov 201413 Nov 202019 Nov 2025
175thesciencetrellis.comNetwork Solutions, LLC3 Oct 201411 Aug 20223 Oct 2025
176thesciencetrellis.netNetwork Solutions, LLC3 Oct 201411 Aug 20223 Oct 2025
177thesciencetrellis.orgNetwork Solutions, LLC3 Oct 201416 Aug 20223 Oct 2025
178thesciencegirl.netWild West Domains, LLC10 Sep 201428 Aug 201610 Sep 2017
179thescienceofmakingdecisions.orgAnnulet LLC7 Oct 201313 Dec 20157 Oct 2017
180thescienceofmakingdecisions.netAnnulet LLC7 Oct 20133 Jan 20177 Oct 2017
181thescienceofstayingyoung.comTurnCommerce, Inc. DBA NameBright.com7 Dec 20216 Jan 20257 Dec 2025
182thescienceofdeliberatelifecreation.comGoDaddy.com, LLC2 Oct 20143 Oct 20162 Oct 2017
183thesciencestory.comGoDaddy.com, LLC27 Dec 201929 Dec 202427 Dec 2025
184thescienceofreselling.comGandi SAS5 Oct 201431 Aug 20175 Oct 2018
185thesciencepost.com1&1 Internet AG16 Feb 201612 Apr 201816 Feb 2026
186thesciencegirlproject.comWild West Domains, LLC20 Nov 201420 Nov 201420 Nov 2015
187thesciencefoundation.comeNom, Inc.1 May 20202 Apr 20251 May 2026
188thescienceofwellbeinginstitute.infoGoDaddy.com, LLC22 Sep 201423 Sep 201822 Sep 2020
189thescienceofwellbeinginstitute.comGoDaddy.com, LLC22 Sep 201423 Sep 201622 Sep 2018
190thescienceofwellbeinginstitute.netGoDaddy.com, LLC22 Sep 201423 Sep 201622 Sep 2018
191thescienceteacher.comGoDaddy.com, LLC20 Aug 200316 Dec 202420 Aug 2025
192thescienceofwellbeinginstitute.orgGoDaddy.com, LLC22 Sep 201423 Sep 201622 Sep 2018
193thescienceofthebrainandaddiction.comGoDaddy.com, LLC23 Sep 201424 Sep 201623 Sep 2017
194thescienceofthebrainandaddiction.orgGoDaddy.com, LLC23 Sep 20148 Oct 201723 Sep 2018
195thescienceofbeinggreat.comTurnCommerce, Inc. DBA NameBright.com21 Nov 201431 Jan 202521 Nov 2024
196thesciencepenguininc.comGoDaddy.com, LLC8 Oct 20148 Oct 20168 Oct 2017
197thesciencetutor.org-23 Dec 202428 Dec 202423 Dec 2025
198thescienceofsimplicity.orgGoDaddy.com, LLC27 Sep 20148 Oct 201727 Sep 2020
199thesciencedude.comGoDaddy.com, LLC3 Oct 202020 Oct 20243 Oct 2025
200thescienceofresale.comGandi SAS27 Sep 201424 Aug 201727 Sep 2018
201thescienceofsuggestion.comGoDaddy.com, LLC24 Sep 201424 Sep 201424 Sep 2016
202thescienceofstylehealthyhairweavesystem.com1&1 Internet AG24 Sep 201411 Aug 202024 Sep 2025
203thesciencecamera.comLaunchpad, Inc.27 Sep 201427 Sep 201427 Sep 2015
204thescienceofthefight.comGoDaddy.com, LLC22 Nov 201422 Nov 201422 Nov 2015
205thescienceofseductionbook.comeNom, Inc.29 Sep 201429 Sep 201429 Sep 2015
206thesciencecity.comGoDaddy.com, LLC10 Oct 201411 Oct 202310 Oct 2025
207thesciencenewstranslator.comWild West Domains, LLC10 Oct 201410 Oct 201410 Oct 2015
208thescienceofspice.comGoogle, Inc.19 Mar 20231 May 202519 Mar 2025
209thescienceofsimplicity.comGoDaddy.com, LLC27 Sep 201427 Sep 201427 Sep 2017
210thescienceofhunting.comGoDaddy.com, LLC27 Sep 202027 Sep 202027 Sep 2021
211thescienceoftouch.comGoDaddy.com, LLC14 Oct 201417 Oct 201614 Oct 2017
212thesciencetvchannel.comGoDaddy.com, LLC14 Oct 201414 Oct 201414 Oct 2015
213thescienceof-fiction.comWild West Domains, LLC19 Oct 201419 Oct 201419 Oct 2015
214thescienceofcancer.comGoDaddy.com, LLC26 Nov 201413 Jan 202526 Nov 2025
215thesciencebehindthemagic.comGoDaddy.com, LLC7 May 20227 May 20227 May 2023
216thescienceofyourself.comArsys Internet, S.L. dba NICLINE.COM28 Feb 201828 Feb 201828 Feb 2019
217thescienceofdeduction.bizRealtime Register B.V.30 Nov 201430 Nov 201429 Nov 2015
218thescienceofbigdata.comGandi SAS30 Nov 201430 Nov 201430 Nov 2015
219thescienceofbigdata.netGandi SAS30 Nov 201430 Nov 201430 Nov 2015
220thesciencewritingblog.comTucows Domains Inc.28 Feb 201828 Feb 201828 Feb 2019
221thescienceoftrading.neteNom, Inc.4 Dec 20145 Dec 20144 Dec 2015
222thescienceofloyalty.comGoDaddy.com, LLC8 Dec 20148 Dec 20148 Dec 2015
223thescienceofthebrothers.comWebfusion Ltd.9 Dec 20142 Dec 20169 Dec 2018
224thescienceofdabs.comeNom, Inc.9 Dec 20149 Dec 20149 Dec 2015
225thescienceportal.comGoDaddy.com, LLC31 Mar 20161 Apr 202431 Mar 2026
226thescienceofjewelry.comeNom, Inc.16 Dec 201421 Nov 201616 Dec 2017
227thescienceofgettingrichonline.comNameCheap, Inc.9 May 20259 May 20259 May 2026
228thesciencedirectory.comGoDaddy.com, LLC16 Dec 201416 Dec 201416 Dec 2015
229thesciencegeneration.comBeijing Lanhai Jiye Technology Co., Ltd23 May 202524 May 202523 May 2026
230thescienceofbeauty.orgGoDaddy.com, LLC17 Jun 202318 Jun 202517 Jun 2027
231thescienceofbeauty.netGoDaddy.com, LLC26 Feb 202427 Feb 202526 Feb 2026
232thescienceofselfimprovement.comProtocol Internet Technology Limited T/A Hosting I…2 Aug 20242 Oct 20242 Aug 2025
233thescienceofsuccessinstitute.comGoDaddy.com, LLC14 Mar 201714 Mar 201714 Mar 2022
234thescienceofmakingbeats.comWild West Domains, LLC21 Dec 201421 Dec 201421 Dec 2015
235thescienceofcoaching.comGoDaddy.com, LLC22 Dec 201422 Dec 202422 Dec 2025
236thescienceleague.comGoogle, Inc.24 Dec 201424 Dec 201424 Dec 2015
237thesciencenerd.comGoDaddy.com, LLC25 Dec 201416 Jan 202525 Dec 2025
238thescienceofaddictivefood.comGoDaddy.com, LLC27 Dec 201427 Dec 201427 Dec 2015
239thesciencesofwallacedwattles.comGMO Internet Inc.31 Dec 201431 Dec 201431 Dec 2015
240thescienceofme.orgWild West Domains, LLC31 Dec 20141 Dec 201631 Dec 2017
241thesciencegeek.orgWild West Domains, LLC1 Jan 20156 Dec 20241 Jan 2027
242thescienceofflight.comTucows Domains Inc.31 Dec 20134 Jan 201531 Dec 2015
243thescienceonline.comeNom, Inc.28 Mar 202327 Feb 202528 Mar 2026
244thesciencekids.comGoDaddy.com, LLC4 Jan 20155 Jan 20254 Jan 2026
245thescienceofhealingyou.xyzNetwork Solutions, LLC15 Jun 201416 Jun 201415 Jun 2015
246thesciencegroup.xyzNetwork Solutions, LLC20 Jun 201423 Jun 201420 Jun 2015
247thescienceproject.nycGoDaddy.com, LLC8 Oct 201413 Oct 20197 Oct 2020
248thescienceofalpha.clubGoDaddy.com, LLC11 Nov 201411 Nov 201410 Nov 2015
249thescienceofskating.comNetwork Solutions, LLC13 Aug 201513 Jun 202513 Aug 2026
250thescienceofgettingrich.websiteCrazy Domains FZ-LLC14 Feb 2015-14 Feb 2016
251thescienceofpersonalmastery.clubGoDaddy.com, LLC2 Mar 201524 Jan 20171 Mar 2018
252thescienceguy.scienceNameshield SAS2 Mar 2015-1 Mar 2016
253thescienceof.scienceAlpnames Limited15 Mar 201515 Mar 201514 Mar 2016
254thesciencenews.scienceAlpnames Limited24 Mar 2015-23 Mar 2016
255thesciencegroup.scienceAlpnames Limited27 Mar 2015-26 Mar 2016
256thesciencetoday.scienceAlpnames Limited30 Mar 2015-29 Mar 2016
257thesciencesyndicate.comGoDaddy.com, LLC13 Aug 201513 Aug 201513 Aug 2016
258thesciencefair.rocksGoDaddy.com, LLC5 May 201511 May 20255 May 2027
259thescienceofsound.orgDomain.com, LLC4 Jan 20155 Feb 20244 Jan 2026
260thesciencekids.orgGoDaddy.com, LLC4 Jan 201515 Feb 20254 Jan 2025
261thesciencekids.netGoDaddy.com, LLC4 Jan 201515 Feb 20254 Jan 2025
262thesciencekids.infoGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2016
263thescienceofnumbers.comGoDaddy.com, LLC16 Feb 202317 Feb 202516 Feb 2027
264thesciencedatabaseonline.comregister.com, Inc.6 Jan 20156 Jan 20156 Jan 2016
265thescienceofaging.comGoDaddy.com, LLC14 Jan 202129 Oct 202214 Jan 2031
266thescienceofbeinghuman.comregister.com, Inc.1 Oct 20221 Oct 20241 Oct 2025
267thescienceofdiets.comeNom, Inc.13 Jan 201513 Jan 201513 Jan 2016
268thescienceofhitting.comNameCheap, Inc.29 Oct 202129 Sep 202329 Oct 2025
269thescienceofgettingrich.todayeNom, Inc.12 Jul 201512 Jul 201512 Jul 2016
270thescienceteacher.globalGoDaddy.com, LLC5 Aug 20154 Oct 20155 Aug 2017
271thescienceofteamwork.comCrazy Domains FZ-LLC18 Jan 201529 Jan 201818 Jan 2018
272thescienceofteams.comKey-Systems GmbH17 Jun 202517 Jun 202517 Jun 2026
273thescienceofteaming.comCrazy Domains FZ-LLC18 Jan 201529 Jan 201818 Jan 2018
274thescienceofgettingrich.orgGoDaddy.com, LLC6 Apr 201821 May 20256 Apr 2026
275thescienceofteamwork.orgCrazy Domains FZ-LLC18 Jan 2015-18 Jan 2016
276thescienceofteamwork.netCrazy Domains FZ-LLC18 Jan 201518 Jan 201518 Jan 2016
277thescienceofinspiredliving.comWebnames.ca Inc.21 Jan 201521 Jan 201521 Jan 2016
278thesciencecourier.com1&1 Internet AG21 Jan 201521 Jan 201521 Jan 2016
279thesciencequotient.comGoDaddy.com, LLC22 Jan 201522 Jan 201522 Jan 2016
280thescienceoforiginality.comFastDomain Inc.24 Jan 201524 Jan 201524 Jan 2016
281thescienceofshopping.comGoDaddy.com, LLC20 Jun 202420 Jun 202420 Jun 2027
282thesciencegarage.orgGoDaddy.com, LLC24 Jan 201524 Jan 201524 Jan 2016
283thescienceofcoffee.comGoogle, Inc.12 Jan 20185 Jan 202512 Jan 2026
284thesciencedoor.comGoDaddy.com, LLC28 Jan 201528 Jan 201528 Jan 2016
285thescienceofneuroplasticity.orgTucows Domains Inc.19 Aug 201523 Aug 201719 Aug 2018
286thescienceofneuroplasticity.netTucows Domains Inc.19 Aug 201523 Aug 201719 Aug 2017
287thescienceofneuroplasticity.comTucows Domains Inc.19 Aug 201523 Aug 201719 Aug 2017
288thescienceofgettingrichonline.neteNom, Inc.28 Jan 201528 Jan 201528 Jan 2016
289thesciencedoor.orgGoDaddy.com, LLC28 Jan 201524 Jan 201728 Jan 2018
290thesciencedoor.netGoDaddy.com, LLC28 Jan 201528 Jan 201528 Jan 2016
291thesciencedoor.infoGoDaddy.com, LLC28 Jan 20152 Feb 202028 Jan 2021
292thescienceofsabbathrest.comGoogle, Inc.1 Feb 20151 Feb 20151 Feb 2016
293thesciencefictionwriter.comOldWorldAliases.com LLC14 Dec 201915 Dec 201914 Dec 2020
294thescienceofsabbathrest.netGoogle, Inc.1 Feb 20151 Feb 20151 Feb 2016
295thescienceofracism.org1API GmbH19 Aug 201520 Aug 201619 Aug 2017
296thesciencemetals.comTucows Domains Inc.2 Feb 20156 Feb 20172 Feb 2017
297thescienceofsabbathrest.orgGoogle, Inc.1 Feb 20151 Feb 20151 Feb 2016
298thescienceofmakeup.comGoDaddy.com, LLC4 Feb 20154 Feb 20154 Feb 2017
299thescienceandartofbrewing.comGoDaddy.com, LLC3 Feb 20153 Feb 20153 Feb 2016
300thescienceofstartingup.comName.com, Inc.4 Feb 201513 Jan 20174 Feb 2018
301thescienceofscalingup.comName.com, Inc.4 Feb 201513 Jan 20174 Feb 2018
302thescienceofhonestskincare.comNameshield SAS3 Feb 20152 Feb 20253 Feb 2026
303thescienceofhonestskincare.bizGoDaddy.com, LLC4 Feb 20154 Feb 20153 Feb 2016
304thescienceofhonestskincare.orgGoDaddy.com, LLC4 Feb 20154 Feb 20154 Feb 2016
305thescienceofhonestskincare.netGoDaddy.com, LLC4 Feb 20154 Feb 20154 Feb 2016
306thescienceofhonestskincare.infoGoDaddy.com, LLC4 Feb 2015-4 Feb 2016
307thesciencepartnership.comeNom, Inc.7 Feb 20157 Feb 20157 Feb 2016
308thescienceofliberty.comeNom, Inc.8 Feb 20157 Jan 20168 Feb 2018
309thescienceoflanguage.comLaunchpad, Inc.8 Feb 201524 Jan 20258 Feb 2027
310thesciencetimes.orgPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 201511 Nov 20152 Nov 2016
311thesciencefrog.comNetwork Solutions, LLC20 Aug 201520 Aug 201520 Aug 2016
312thescienceofthemind.comTucows Domains Inc.9 Feb 201513 Feb 20199 Feb 2019
313thescienceandspiritbridge.comWild West Domains, LLC10 Feb 201510 Feb 201510 Feb 2016
314thesciencecentre.orgGoDaddy.com, LLC16 Oct 201627 Nov 201716 Oct 2018
315thescienceofselfhelp.comGoDaddy.com, LLC18 Jun 202116 Oct 202218 Jun 2026
316thescienceofseeding.comGoDaddy.com, LLC10 Feb 201524 Mar 202510 Feb 2025
317thescienceofseeding.orgGoDaddy.com, LLC10 Feb 201524 Mar 202510 Feb 2025
318thescienceofseeding.netGoDaddy.com, LLC10 Feb 201524 Mar 202510 Feb 2025
319thescienceofseeding.infoGoDaddy.com, LLC10 Feb 201524 Mar 202510 Feb 2025
320thescienceofcannabis.org1&1 Internet AG10 Feb 201527 Mar 202510 Feb 2026
321thescienceoflifelonghappiness.comGoDaddy.com, LLC11 Feb 201511 Feb 201511 Feb 2016
322thescienceoffeelinggood.comGoDaddy.com, LLC12 Mar 202012 Mar 202012 Mar 2021
323thesciencetrilogy.comTucows Domains Inc.12 Feb 201512 Feb 201512 Feb 2018
324thesciencenavigator.comWild West Domains, LLC12 Feb 201513 Jan 202512 Feb 2027
325thesciencecuisine.comeNom, Inc.12 Feb 201512 Feb 201512 Feb 2016
326thesciencediet.netGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2016
327thescienceofattraction.comGoDaddy.com, LLC20 Oct 201630 Sep 202220 Oct 2026
328thesciencequest.comGMO Internet Inc.11 May 202511 May 202511 May 2026
329thescienceofthinning.comeNom, Inc.20 Feb 201520 Feb 201520 Feb 2016
330thescienceguide.comFastDomain Inc.7 Jun 20179 Jun 20257 Jun 2026
331thescienceofpersonalmasterycourse.comGoDaddy.com, LLC4 Aug 20235 Aug 20244 Aug 2025
332thescienceofpersonalmastery.comInterNetworX Ltd. & Co. KG26 Feb 201513 Feb 202526 Feb 2026
333thescienceobserver.comGoDaddy.com, LLC28 Feb 201928 Feb 201928 Feb 2020
334thescienceeditors.comWix.com Ltd.27 Apr 202328 Mar 202527 Apr 2026
335thescienceofsoul.infoDomain.com, LLC27 Feb 201514 Mar 201727 Feb 2018
336thescienceclubshow.comeNom, Inc.27 Feb 201510 Apr 202427 Feb 2024
337thescienceofcompliance.comNetwork Solutions, LLC12 Sep 201813 Sep 202412 Sep 2025
338thescienceofsuccessmasterycourse.comGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2016
339thescienceofsuccessmastery.comGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2016
340thescienceofreality.comGoDaddy.com, LLC25 Dec 202323 Dec 202425 Dec 2025
341thesciencerockstar.comGoDaddy.com, LLC23 Aug 201523 Aug 201523 Aug 2017
342thescienceofsleeptraining.comGoDaddy.com, LLC23 Aug 201523 Aug 201523 Aug 2016
343thescienceofsimplegolf.comNetwork Solutions, LLC23 Aug 201524 Jun 202423 Aug 2027
344thesciencechallenge.orgTucows Domains Inc.19 Aug 201323 Aug 201519 Aug 2016
345thescienceofreality.orgGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2016
346thescienceofpersonalmastery.usGoDaddy.com, LLC2 Mar 201524 Jan 20171 Mar 2018
347thescienceofpersonalmastery.orgGoDaddy.com, LLC2 Mar 201524 Jan 20172 Mar 2018
348thescienceofpersonalmastery.infoGoDaddy.com, LLC2 Mar 201524 Jan 20172 Mar 2018
349thescienceofreality.netGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2016
350thescienceofpersonalmastery.netGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2016
351thesciencewriters.comGoDaddy.com, LLC3 Jun 20253 Jun 20253 Jun 2028
352thescienceofviral.comAscio Technologies, Inc. Danmark - Filial af Ascio…5 Mar 20155 Mar 20155 Mar 2016
353thescienceunion.comSquarespace Domains LLC22 Mar 202122 May 202422 Mar 2024
354thesciencebehind.orgNameCheap, Inc.25 Dec 20208 Feb 202525 Dec 2025
355thescienceofgettingrich2015.comeNom, Inc.31 Aug 201731 Aug 201731 Aug 2018
356thescienceofgettingwhatyouwant.infoGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
357thescienceofgettingwhatyouwant.netGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
358thescienceofrecruitment.com1&1 Internet AG11 Mar 201512 Mar 201711 Mar 2018
359thescienceofcharisma.comDomain.com, LLC11 Mar 201519 Feb 202511 Mar 2026
360thesciencelabforkids.comGoDaddy.com, LLC11 Mar 201511 Mar 201511 Mar 2016
361thescienceofgettingwhatyouwant.orgGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
362thescienceofpain.comGoDaddy.com, LLC28 Jul 202129 Jul 202428 Jul 2025
363thescienceofbeautyga.comFastDomain Inc.13 Mar 201513 Mar 201713 Mar 2018
364thescienceofsuccessforteens.comGoDaddy.com, LLC15 Mar 201515 Mar 201515 Mar 2016
365thescienceclub.bizTucows Domains Inc.12 Mar 201315 Mar 201511 Mar 2015
366thesciencefictionportal.comFabulous.com Pty Ltd.19 Jan 200016 Mar 201519 Jan 2016
367thescienceofnaming.comNamesilo, LLC20 Feb 201218 Mar 201520 Feb 2016
368thesciencecupboard.comGoDaddy.com, LLC7 Jan 20197 Jan 20197 Jan 2020
369thesciencereview.netGoogle, Inc.17 Mar 201517 Mar 201517 Mar 2016
370thescienceproject.infoGoDaddy.com, LLC17 Mar 201527 Dec 201917 Mar 2021
371thescienceofbeinghealthy.comGoDaddy.com, LLC19 Mar 201519 Mar 201519 Mar 2016
372thesciencecottage.comGoDaddy.com, LLC20 Mar 201530 Apr 202520 Mar 2025
373thescienceofbbq.comGoDaddy.com, LLC20 Mar 201521 Mar 202520 Mar 2026
374thescienceschool.comDropCatch.com 1072 LLC24 Apr 202524 Apr 202524 Apr 2026
375thescienceexperiment.comTucows Domains Inc.15 Jul 202016 Jun 202515 Jul 2026
376thesciencedog.comAutomattic Inc.20 Dec 201830 Nov 202420 Dec 2025
377thescienceaustraliaparty.orgGoDaddy.com, LLC20 Mar 201520 Mar 201520 Mar 2017
378thescienceaustraliaparty.mobiGoDaddy.com, LLC20 Mar 201520 Mar 201520 Mar 2017
379thescienceisin.comTucows Domains Inc.24 Jun 201723 Jun 202424 Jun 2025
380thescienceofgood.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201729 Nov 201729 Nov 2018
381thescienceofskincare.comTucows Domains Inc.16 Apr 202027 May 202516 Apr 2025
382thescienceofimpossible.orgGoDaddy.com, LLC26 Mar 20157 Apr 202426 Mar 2025
383thescienceofimpossible.netGoDaddy.com, LLC26 Mar 201526 Mar 201526 Mar 2016
384thescienceofimpossible.infoGoDaddy.com, LLC26 Mar 201525 Jan 201726 Mar 2019
385thescienceofwallacedwattles.comTucows Domains Inc.28 Mar 201528 Mar 201528 Mar 2017
386thesciencesafarico.orgeNom, Inc.27 Mar 201528 Mar 201727 Mar 2018
387thescienceguy.netGoDaddy.com, LLC28 Mar 201528 Mar 201528 Mar 2016
388thescienceofnascar.netGoDaddy.com, LLC29 Mar 201529 Mar 201529 Mar 2016
389thescienceofnascar.mobiGoDaddy.com, LLC29 Mar 201529 Mar 201529 Mar 2016
390thescienceofdna.comGoDaddy.com, LLC30 Mar 201531 Mar 201530 Mar 2020
391thescienceofnascar.orgGoDaddy.com, LLC29 Mar 201529 Mar 201529 Mar 2016
392thescienceoffitness.comGoDaddy.com, LLC24 Feb 200529 Oct 202224 Feb 2027
393thescienceshack.comGoDaddy.com, LLC27 Aug 201913 Sep 202427 Aug 2025
394thescienceofmath.comPorkbun, LLC12 May 202111 May 202512 May 2026
395thescienceofsequencing.comWebfusion Ltd.7 Apr 20155 Apr 20177 Apr 2019
396thescienceoffoods.comeNom, Inc.2 Sep 20152 Sep 20152 Sep 2016
397thescienceofmagic.netAbove.com Pty Ltd.16 Apr 202227 Jun 202316 Apr 2023
398thescienceofjump.comGoDaddy.com, LLC2 Sep 20152 Sep 20152 Sep 2017
399thescienceofperfectgolf.comGoDaddy.com, LLC8 Apr 20158 Apr 20158 Apr 2020
400thescienceisreal.comLaunchpad, Inc.28 Jun 201713 Jun 202528 Jun 2026
401thescienceacademy.netHostinger, UAB6 Nov 20246 Jan 20256 Nov 2026
402thescienceworld.netWix.com Ltd.8 May 20219 May 20258 May 2026
403thescienceofperfectgolf.orgGoDaddy.com, LLC8 Apr 20158 Apr 20158 Apr 2016
404thescienceofperfectgolf.netGoDaddy.com, LLC8 Apr 20158 Apr 20158 Apr 2016
405thescienceofperfectgolf.infoGoDaddy.com, LLC8 Apr 2015-8 Apr 2016
406thescienceofdifferentiationforbusiness.comWebnames.ca Inc.3 Sep 20153 Sep 20153 Sep 2016
407thesciencementor.comGoDaddy.com, LLC11 Sep 201826 Oct 202311 Sep 2025
408thescienceofvalue.comGoDaddy.com, LLC2 Apr 20192 Apr 20192 Apr 2020
409thescienceofsmalltalk.comGoDaddy.com, LLC12 Apr 201512 Apr 201512 Apr 2016
410thescienceofessentialnutrients.usGoDaddy.com, LLC4 Sep 20159 Sep 20203 Sep 2025
411thescienceofessentialnutrients.orgGoDaddy.com, LLC4 Sep 201511 Jul 20244 Sep 2025
412thescienceofessentialnutrients.netGoDaddy.com, LLC4 Sep 201519 Sep 20224 Sep 2025
413thescienceofessentialnutrients.infoGoDaddy.com, LLC4 Sep 201511 Jul 20244 Sep 2025
414thescienceofessentialnutrients.comGoDaddy.com, LLC4 Sep 201519 Sep 20224 Sep 2025
415thescienceleaks.comTucows Domains Inc.13 Apr 201117 Apr 201513 Apr 2016
416thesciencebusiness.comNamesilo, LLC16 Apr 201516 Apr 201716 Apr 2017
417thesciencefaculty.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…6 Apr 20226 Apr 20226 Apr 2023
418thesciencefictioncircle.com1&1 Internet AG18 Apr 201512 Apr 201818 Apr 2026
419thescienceofconsciousness.orgInstra Corporation Pty Ltd.19 Apr 20231 May 202419 Apr 2025
420thesciencewrap.comGoDaddy.com, LLC25 Apr 201526 Apr 201525 Apr 2016
421thescienceshark.comregister.com, Inc.25 Apr 201525 Apr 201525 Apr 2016
422thesciencemediagroup.comeNom, Inc.25 Apr 201525 Apr 201525 Apr 2016
423thescienceofgreed.comTurnCommerce, Inc. DBA NameBright.com16 Jul 201923 Aug 202216 Jul 2025
424thescienceoffitness.infoGoDaddy.com, LLC27 Apr 2015-27 Apr 2016
425thesciencesixsmanlavan.comGoDaddy.com, LLC28 Apr 201528 Apr 201528 Apr 2016
426thescienceofgreed.orgeNom, Inc.27 Apr 201529 Mar 201727 Apr 2018
427thescienceofgreed.neteNom, Inc.27 Apr 201515 May 201727 Apr 2018
428thescienceoffitness.usGoDaddy.com, LLC27 Apr 201527 Apr 201526 Apr 2016
429thescienceoffitness.orgGoDaddy.com, LLC27 Apr 201527 Apr 201527 Apr 2016
430thescienceoffitness.netGoDaddy.com, LLC27 Apr 201527 Apr 201527 Apr 2016
431thesciencechronicle.comAutomattic Inc.1 Oct 201911 Sep 20241 Oct 2025
432thescienceofzombies.comGoDaddy.com, LLC6 Sep 20216 Sep 20216 Sep 2022
433thesciencemug.comGoDaddy.com, LLC8 Sep 20158 Sep 20158 Sep 2016
434thescienceofcricketbatting.comeNom, Inc.1 May 201530 May 20171 May 2018
435thescienceemporium.comNetwork Solutions, LLC9 Mar 201821 Apr 20249 Mar 2024
436thesciencelab.netGoDaddy.com, LLC30 Apr 201519 Jun 202418 Jun 2025
437thesciencelab.infoGoDaddy.com, LLC30 Apr 201514 Jun 202530 Apr 2026
438thesciencenanny.comGoDaddy.com, LLC4 May 20154 May 20154 May 2016
439thescienceofvoices.comGoDaddy.com, LLC9 Sep 20159 Sep 20159 Sep 2016
440thescienceofus.comGoDaddy.com, LLC2 Feb 20183 Feb 20252 Feb 2026
441thesciencefairy.orgeNom, Inc.9 Sep 201516 Aug 20249 Sep 2025
442thescienceofaffluence.comGoDaddy.com, LLC5 Oct 20225 Oct 20245 Oct 2026
443thesciencemic.comGoDaddy.com, LLC5 May 20156 May 20255 May 2026
444thesciencegirls.netFastDomain Inc.5 May 20156 Jun 20175 May 2017
445thesciencemic.infoGoDaddy.com, LLC5 May 20157 Apr 20175 May 2018
446thesciencemic.orgGoDaddy.com, LLC5 May 20157 Apr 20175 May 2018
447thesciencemic.netGoDaddy.com, LLC5 May 20155 May 20155 May 2016
448thesciencefair.usGoDaddy.com, LLC5 May 20155 May 20174 May 2019
449thescienceofluck.asiaGandi SAS11 Sep 201511 Sep 201511 Sep 2016
450thesciencedelusion.infoGoDaddy.com, LLC7 May 201527 Dec 20197 May 2021
451thescienceofvibration.comFastDomain Inc.10 May 201512 May 202510 May 2026
452thescienceofseo.comMoniker Online Services LLC14 Oct 202012 Oct 202414 Oct 2025
453thescienceofhemp.comName.com, Inc.12 May 201525 Jul 202412 May 2024
454thescienceherald.comHostinger, UAB17 Jul 202317 Jul 202317 Jul 2025
455thesciencebro.comGoDaddy.com, LLC3 Nov 202215 Jan 20243 Nov 2023
456thescienceherald.netTucows Domains Inc.9 May 201313 May 20159 May 2016
457thescienceherald.orgTucows Domains Inc.9 May 201313 May 20179 May 2018
458thescienceofsoap.comGoDaddy.com, LLC16 May 201516 May 201516 May 2016
459thescienceofmagic.comeNom, Inc.30 Jul 201527 Jul 202430 Jul 2025
460thescienceparty.comGoDaddy.com, LLC9 Apr 201210 Apr 20259 Apr 2026
461thescienceofmeditation.comGoDaddy.com, LLC17 Dec 202118 Dec 202417 Dec 2025
462thescienceofthesecret.comFastDomain Inc.20 May 201520 May 201720 May 2018
463thescienceofmusic.comOne.com A/S24 Feb 202324 Feb 202524 Feb 2026
464thescienceexplorer.comGoDaddy.com, LLC21 May 201512 Nov 202411 Nov 2027
465thescienceofinformation.com----
466thescienceofinfo.comDropCatch.com 1249 LLC10 Aug 201710 Aug 201710 Aug 2018
467thescienceofsurprise.usGoDaddy.com, LLC13 Sep 201513 Sep 201512 Sep 2016
468thescienceofsurprise.orgGoDaddy.com, LLC13 Sep 201513 Sep 201513 Sep 2016
469thescienceofsurprise.comGoDaddy.com, LLC13 Sep 201513 Sep 201513 Sep 2016
470thesciencereporter.comGoDaddy.com, LLC23 May 201522 Apr 202523 May 2026
471thesciencesmith.comGoDaddy.com, LLC24 May 20155 Aug 202424 May 2024
472thesciencept.comPDR Ltd. d/b/a PublicDomainRegistry.com25 May 201522 May 202525 May 2026
473thesciencepost.orgDreamHost, LLC25 May 201525 May 201525 May 2016
474thescienceofrealestateinvesting.comGoDaddy.com, LLC27 May 201528 May 202527 May 2026
475thescienceofmentoring.comGoDaddy.com, LLC27 May 201528 May 202527 May 2026
476thescienceoffear.comName.com, Inc.28 May 20156 May 201728 May 2018
477thescienceofimagination.comGoDaddy.com, LLC19 Apr 201719 Apr 201719 Apr 2019
478thesciencebehindthestrokes.comFastDomain Inc.30 May 201528 Jan 202530 May 2026
479thescienceofsimple.netCloudFlare, Inc.28 May 201526 May 202528 May 2026
480thescienceofillustration.comDropCatch.com 639 LLC5 Nov 202216 Jan 20245 Nov 2023
481thesciencecollaboratory.comDomain.com, LLC31 May 201531 May 201531 May 2016
482thescienceclass.comGoDaddy.com, LLC8 Feb 20259 Feb 20258 Feb 2026
483thesciencecollaboratory.netDomain.com, LLC31 May 201531 May 201531 May 2016
484thescienceofgettinganything.comPorkbun, LLC1 Jun 201514 Jul 20241 Jun 2024
485thesciencecollaboratory.orgDomain.com, LLC31 May 2015-31 May 2016
486thescienceofbaseball.comGoogle, Inc.30 Oct 201930 Oct 201930 Oct 2020
487thescienceofhemp.orgName.com, Inc.1 Jun 20151 Jun 20151 Jun 2016
488thescienceisin.orgTucows Domains Inc.2 Jun 20151 Jun 20172 Jun 2018
489thescienceofweedshow.comDomain.com, LLC7 Jun 20157 Jun 20157 Jun 2016
490thescienceoflosingweight.comGoDaddy.com, LLC10 Jun 201522 Apr 202510 Jun 2026
491thescienceofbeingyourself.comGoDaddy.com, LLC11 Jun 201511 Jun 201511 Jun 2016
492thescience-blog.comeNom, Inc.11 Jun 201511 Jun 201511 Jun 2016
493thesciencecommunicationscoach.comFastDomain Inc.14 Jun 201514 Jun 201514 Jun 2016
494thesciencecommunicationcoach.comFastDomain Inc.14 Jun 201514 Jun 201514 Jun 2016
495thescienceofwisdom.orgGoDaddy.com, LLC12 Jun 201512 Jun 201512 Jun 2016
496thescienceofwinninglove.com----
497thesciencefictionblog.comGandi SAS14 Jun 201314 Jun 201314 Jun 2017
498thescienceofwater.comGoDaddy.com, LLC20 Jun 201821 Jun 202320 Jun 2028
499thesciencecommunicationproject.comGoDaddy.com, LLC18 Jun 201518 Jun 201518 Jun 2017
500thescienceofexchange.comGoDaddy.com, LLC20 Jun 201520 Jun 201520 Jun 2016
501thescienceofmakingmoneyonline.comWild West Domains, LLC20 Sep 201520 Sep 201520 Sep 2016
502thescienceofdriving.comGoDaddy.com, LLC21 Sep 201521 Sep 201521 Sep 2017
503thesciencemagazine.comGoDaddy.com, LLC9 Mar 20229 Feb 20249 Mar 2026
504thesciencebehindfitness.comLaunchpad, Inc.22 Jun 20157 Jun 201722 Jun 2018
505thesciencespace.comNorthNames Inc2 Feb 20252 Feb 20252 Feb 2026
506thescienceexchange.netMelbourne IT, Ltd21 Sep 201521 Sep 201521 Sep 2020
507thescienceeye.comTucows Domains Inc.20 Jun 201424 Jun 201520 Jun 2016
508thesciencelawyer.comGoDaddy.com, LLC26 Jun 201527 Jun 202426 Jun 2025
509thescienceofsmiling.comGoDaddy.com, LLC22 Sep 201523 Sep 202422 Sep 2025
510thescienceofsmile.comGoDaddy.com, LLC22 Sep 201523 Sep 202422 Sep 2025
511thescienceofconfidence.comGoDaddy.com, LLC23 Jan 202023 Jan 202523 Jan 2026
512thesciencegasm.comFastDomain Inc.1 Jul 20151 Jul 20171 Jul 2018
513thescienceduo.comPorkbun, LLC30 Jun 20151 Jul 202430 Jun 2025
514thescienceleaks.orgPDR Ltd. d/b/a PublicDomainRegistry.com29 Jun 201529 Jun 201529 Jun 2016
515thesciencefictiondaily.comGoDaddy.com, LLC23 Sep 201524 Sep 202423 Sep 2025
516thescienceofromance.comGoDaddy.com, LLC2 Jul 20152 Jul 20152 Jul 2016
517thesciencechallenge.comAnnulet LLC27 May 201412 Jul 201727 May 2018
518thescienceadventureonline.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Jul 20156 Jul 20156 Jul 2016
519thesciencenetwork.comGoDaddy.com, LLC14 Oct 200315 Dec 202414 Oct 2025
520thesciencelablc.comNameCheap, Inc.8 Jul 201521 Jun 20248 Jul 2025
521thescienceofhealth.orgGoDaddy.com, LLC7 Jul 20157 Jul 20177 Jul 2018
522thesciencenetwork.org-1 Jan 20252 Apr 20251 Jan 2027
523thesciencenetwork.net-2 Jan 20252 Jan 20252 Jan 2026
524thesciencetribune.orgGoDaddy.com, LLC25 Sep 201526 Sep 201625 Sep 2017
525thesciencetribune.infoGoDaddy.com, LLC25 Sep 201526 Sep 201625 Sep 2017
526thesciencetribune.netGoDaddy.com, LLC25 Sep 201525 Sep 201525 Sep 2016
527thesciencetribune.comWix.com Ltd.14 Jul 202318 Jul 202414 Jul 2025
528thescienceofhappiness.orgPDR Ltd. d/b/a PublicDomainRegistry.com8 Jul 201522 May 20248 Jul 2025
529thescienceupdate.comWix.com Ltd.24 Sep 20224 Dec 202324 Sep 2023
530thescienceofwoo.comGoDaddy.com, LLC10 Jul 201510 Jul 201510 Jul 2017
531thescienceofthefunny.comGoDaddy.com, LLC11 Jul 201511 Jul 201511 Jul 2016
532thescienceisnotsettled.comGoDaddy.com, LLC26 Sep 201512 Jun 202426 Sep 2027
533thescienceofthefunny.netGoDaddy.com, LLC11 Jul 201511 Jul 201511 Jul 2016
534thescienceofmondays.comGoDaddy.com, LLC16 Jul 201516 Jul 201516 Jul 2016
535thescienceofhustle.comGoDaddy.com, LLC15 Apr 201915 Apr 201915 Apr 2021
536thesciencescholar.comGoDaddy.com, LLC19 Jul 202319 Jul 202319 Jul 2026
537thescienceprivatehub.comGoDaddy.com, LLC17 Jul 201517 Jul 201517 Jul 2017
538thescienceofhair.comeNom, Inc.18 Jul 201522 Jul 202418 Jul 2025
539thescienceofhair.bizGoDaddy.com, LLC18 Jul 201518 Jul 201517 Jul 2016
540thesciencesite.infoNameCheap, Inc.1 Nov 20246 Nov 20241 Nov 2025
541thescienceofhair.infoGoDaddy.com, LLC18 Jul 201518 Jul 201718 Jul 2018
542thescienceofhair.orgGoDaddy.com, LLC18 Jul 201519 Jul 201718 Jul 2018
543thescienceofhair.netGoDaddy.com, LLC18 Jul 201518 Jul 201518 Jul 2017
544thescienceofbehavior.comeNom, Inc.20 Jul 201520 Jul 201520 Jul 2016
545thescienceofeverything.netGoDaddy.com, LLC26 Jun 202228 Jun 202426 Jun 2025
546thescienceofspin.comFastDomain Inc.28 Sep 201528 Sep 201528 Sep 2016
547thesciencelibrarian.netWild West Domains, LLC28 Sep 201528 Sep 201528 Sep 2016
548thescienceoflivingonline.comGoDaddy.com, LLC18 Oct 201818 Oct 201818 Oct 2019
549thesciencerascal.orgGoDaddy.com, LLC21 Jul 201521 Jul 201521 Jul 2016
550thesciencerascal.netGoDaddy.com, LLC21 Jul 201521 Jul 201521 Jul 2016
551thesciencerascal.infoGoDaddy.com, LLC21 Jul 2015-21 Jul 2016
552thescienceofyes.comNameCheap, Inc.23 Jul 202122 Jul 202223 Jul 2023
553thescienceofawesome.comWix.com Ltd.28 Mar 202026 Feb 202528 Mar 2026
554thescienceofease.netGoDaddy.com, LLC23 Jul 201523 Jul 201523 Jul 2017
555thescienceofthelambs.comGoDaddy.com, LLC24 Jul 201524 Jul 201524 Jul 2017
556thescienceadvisors.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Jul 201524 Jul 201524 Jul 2016
557thesciencefair.orgGoDaddy.com, LLC19 Dec 20162 Feb 202519 Dec 2025
558thesciencedaily.org1&1 Internet AG24 Jul 2015-24 Jul 2016
559thesciencebible.comBrandsight, Inc.26 Jul 201525 Jun 202426 Jul 2025
560thesciencetojobsearching.comGoDaddy.com, LLC28 Jul 201528 Jul 201528 Jul 2016
561thesciencetojobsearching.netGoDaddy.com, LLC28 Jul 201528 Jul 201528 Jul 2016
562thesciencetojobsearching.infoGoDaddy.com, LLC28 Jul 2015-28 Jul 2016
563thescienceofsurfacing.comGoDaddy.com, LLC28 Jul 201529 Jul 202428 Jul 2027
564thesciencebay.comGoDaddy.com, LLC26 Jul 201826 Jul 201826 Jul 2019
565thesciencetojobsearching.orgGoDaddy.com, LLC28 Jul 201528 Jul 201528 Jul 2016
566thescienceofsurfacing.netGoDaddy.com, LLC28 Jul 201529 Jul 202428 Jul 2027
567thescienceofwisdom.comEranet International Limited3 Nov 202421 Dec 20243 Nov 2025
568thesciencelife.comFastDomain Inc.20 Jun 20175 Jun 202420 Jun 2025
569thescienceschool.orgTucows Domains Inc.30 May 202020 May 202530 May 2026
570thescienceacademyindia.comGoDaddy.com, LLC4 Aug 20154 Aug 20154 Aug 2016
571thescienceisneversettled.comGoDaddy.com, LLC6 Aug 201519 Sep 20226 Aug 2025
572thescienceteacher.netGoDaddy.com, LLC5 Aug 20155 Aug 20155 Aug 2017
573thescienceisneversettled.netGoDaddy.com, LLC6 Aug 201519 Sep 20226 Aug 2025
574thescienceisneversettled.infoGoDaddy.com, LLC6 Aug 201511 Jul 20246 Aug 2025
575thescienceisneversettled.orgGoDaddy.com, LLC6 Aug 201510 Jul 20246 Aug 2025
576thesciencecream.comTurnCommerce, Inc. DBA NameBright.com10 Aug 201515 Jan 202010 Aug 2025
577thescienceof.vodkaUniregistrar Corp11 Sep 201511 Sep 201511 Sep 2016
578thescienceoffoodchoice.comFastDomain Inc.6 Oct 201520 Sep 20246 Oct 2025
579thescienceofidh.orgMarkMonitor Inc.7 Oct 201511 Sep 20237 Oct 2025
580thescienceofidh.netMarkMonitor Inc.7 Oct 20152 Aug 20247 Oct 2025
581thescienceofidh.infoMarkMonitor Inc.7 Oct 201511 Sep 20237 Oct 2025
582thescienceofidh.comMarkMonitor Inc.7 Oct 20152 Aug 20247 Oct 2025
583thescienceacademystemmagnet.orgGoDaddy.com, LLC8 Oct 20156 Sep 20248 Oct 2025
584thescienceofsure.comGoDaddy.com, LLC9 Oct 201510 Oct 20249 Oct 2026
585thescienceofmentalresilience.comDomain.com, LLC9 Oct 201518 Dec 20169 Oct 2017
586thescienceofacting.comHostinger, UAB15 Jul 202414 Sep 202415 Jul 2025
587thesciencepanda.comDreamHost, LLC3 Apr 202228 Feb 20253 Apr 2026
588thescienceofknowingwhere.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Oct 201524 Jun 202417 Oct 2025
589thesciencecode.comGoDaddy.com, LLC22 Jun 201722 Jun 201722 Jun 2019
590thesciencefictionsection.comTucows Domains Inc.16 Oct 200620 Oct 201516 Oct 2016
591thescienceofuniversalliving.comGoDaddy.com, LLC21 Oct 201516 Oct 202421 Oct 2026
592thescienceofsalmonfishing.comTucows Domains Inc.22 Oct 201522 Aug 202422 Oct 2026
593thescienceofgettingrich.guruGoDaddy.com, LLC22 Oct 20156 Jan 201722 Oct 2017
594thescienceofgettingrich.educationGoDaddy.com, LLC22 Oct 20156 Dec 201922 Oct 2020
595thescienceofgettingrich.centerGoDaddy.com, LLC22 Oct 20156 Dec 201922 Oct 2020
596thescienceofbaseballpitching.comTucows Domains Inc.19 Oct 200523 Oct 201519 Oct 2016
597thesciencebehindclimatechange.comGoDaddy.com, LLC22 Oct 201522 Oct 201522 Oct 2016
598thescienceofprofitingwithsocialmedia.comGoDaddy.com, LLC24 Oct 201524 Oct 201524 Oct 2016
599thesciencewitch.comNameCheap, Inc.26 Mar 202427 Mar 202426 Mar 2026
600thescienceissettled.comTucows Domains Inc.26 Feb 202127 Jan 202526 Feb 2026
601thescienceinnutrition.comeNom, Inc.28 Oct 201528 Oct 201528 Oct 2016
602thescienceofgettingrichdecoded.comeNom, Inc.30 Oct 201530 Oct 201530 Oct 2016
603thesciencemachine.comGoDaddy.com, LLC30 Oct 201526 Oct 202430 Oct 2025
604thescienceofgreatcare.comTucows Domains Inc.27 Jun 201827 Jun 201827 Jun 2019
605thescienceprjct.comLaunchpad, Inc.4 Nov 20154 Nov 20154 Nov 2016
606thescienceparty.useNom, Inc.5 Nov 20155 Nov 20154 Nov 2016
607thescienceofserving.comLaunchpad, Inc.6 Nov 201527 Oct 20166 Nov 2018
608thescienceofghostbusters.comMarkMonitor Inc.5 Nov 20155 Oct 20165 Nov 2017
609thescienceofgettingrich-download.comGoDaddy.com, LLC5 Nov 20155 Nov 20155 Nov 2016
610thescienceofbeingwell-download.comGoDaddy.com, LLC5 Nov 20155 Nov 20155 Nov 2016
611thescienceofbeinggreat-download.comGoDaddy.com, LLC5 Nov 20155 Nov 20155 Nov 2016
612thesciencebreaker.orgAscio Technologies, Inc. Danmark - Filial af Ascio…7 Nov 201522 Dec 20247 Nov 2025
613thesciencehouse.infoUK-2 Limited8 Nov 20158 Nov 20158 Nov 2016
614thescienceencyclopedia.comGoDaddy.com, LLC8 Nov 20158 Nov 20158 Nov 2016
615thescienceoffitness.bizGoDaddy.com, LLC9 Nov 20159 Nov 20158 Nov 2016
616thesciencepages.comFastDomain Inc.10 Nov 201510 Nov 201510 Nov 2016
617thescienceoffitness.fitGoDaddy.com, LLC9 Nov 20159 Nov 20159 Nov 2016
618thescienceindex.com-20 Feb 202120 Feb 202120 Feb 2022
619thesciencecapsule.comTucows Domains Inc.10 Nov 201510 Nov 201510 Nov 2016
620thescienceandart.comNameCheap, Inc.11 Nov 201512 Oct 202411 Nov 2025
621thesciencelion.comGoDaddy.com, LLC11 Nov 201511 Nov 201511 Nov 2016
622thescienceofcannabis.comDynadot, LLC2 Feb 202213 Mar 20242 Feb 2024
623thesciencereview.comGoDaddy.com, LLC13 Nov 201529 Nov 202413 Nov 2025
624thescienceofreincarnation.orgGoDaddy.com, LLC16 Nov 201528 Nov 202416 Nov 2025
625thescienceofmalemagnetism.netGoDaddy.com, LLC19 Nov 201519 Nov 201519 Nov 2016
626thescienceofmalemagnetism.comGoDaddy.com, LLC19 Nov 201519 Nov 201519 Nov 2016
627thescienceofalliance.comWild West Domains, LLC21 Nov 201521 Nov 201521 Nov 2016
628thesciencetruth.comFastDomain Inc.23 Nov 201523 Nov 201623 Nov 2017
629thesciencebeast.comGoDaddy.com, LLC23 Nov 201523 Nov 201523 Nov 2016
630thescienceofkink.comCrazy Domains FZ-LLC24 Nov 20155 Dec 201724 Nov 2017
631thescienceoffulfillment.comNameCheap, Inc.5 Jun 20196 May 20255 Jun 2026
632thesciencetech.orgCV. Rumahweb Indonesia25 Nov 201525 Nov 201625 Nov 2017
633thescienceoffashion.com1&1 Internet AG25 Nov 201512 Apr 201825 Nov 2025
634thescienceofdiamonds.comGoDaddy.com, LLC25 Nov 201525 Nov 201525 Nov 2016
635thesciencelover.comGoDaddy.com, LLC17 Oct 202017 Oct 202017 Oct 2021
636thesciencebreakfast.comDreamHost, LLC29 Nov 201529 Oct 202429 Nov 2025
637thescienceadvantage.com1&1 Internet AG29 Nov 201530 Nov 201629 Nov 2017
638thescienceandtheart.comNameCheap, Inc.24 Oct 201824 Oct 202424 Oct 2025
639thescienceofthejams.comFastDomain Inc.1 Dec 20151 Dec 20151 Dec 2016
640thesciencetohitting.comTucows Domains Inc.5 Dec 20159 Dec 20165 Dec 2016
641thesciencebehindthelawofattraction.comGoDaddy.com, LLC4 Dec 20154 Dec 20154 Dec 2016
642thescienceofmarketing.comTurnCommerce, Inc. DBA NameBright.com28 Oct 200511 Jan 202528 Oct 2024
643thescienceoffishing.comTucows Domains Inc.10 Feb 20239 Feb 202510 Feb 2026
644thescienceofexaminationsuccess.com1&1 Internet AG6 Dec 20157 Dec 20166 Dec 2017
645thescienceofholidays.comGoDaddy.com, LLC8 Dec 20158 Dec 20158 Dec 2017
646thescienceofhuman.orgLimited Liability Company "Registrar of domain nam…8 Dec 20157 Dec 20168 Dec 2017
647thescienceofhuman.netLimited Liability Company "Registrar of domain nam…8 Dec 20158 Dec 20158 Dec 2016
648thescienceofhuman.infoLimited Liability Company "Registrar of domain nam…8 Dec 20159 Dec 20198 Dec 2020
649thescienceofhuman.comHosting Concepts B.V. dba Openprovider22 Feb 202122 Feb 202122 Feb 2022
650thescienceofdrones.comGoDaddy.com, LLC9 Dec 20159 Dec 20159 Dec 2016
651thescienceofthespirit.comGoDaddy.com, LLC14 Dec 201514 Dec 201514 Dec 2016
652thesciencez.comGoDaddy.com, LLC15 Dec 201515 Dec 201515 Dec 2016
653thescienceofparties.comGoDaddy.com, LLC15 Dec 201516 Dec 202315 Dec 2025
654thesciencemal.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Dec 201516 Dec 201516 Dec 2016
655thescienceofcooking.inforegister.com, Inc.18 Dec 20151 Feb 202218 Dec 2030
656thescienceofabundance.comDomain.com, LLC30 Dec 202310 Dec 202430 Dec 2025
657thesciencecup.comGoDaddy.com, LLC21 Dec 201521 Dec 201521 Dec 2016
658thescienceofthoughtleadership.comLaunchpad, Inc.22 Dec 201522 Dec 201522 Dec 2016
659thescienceclinic.netGoDaddy.com, LLC24 Dec 201524 Dec 201524 Dec 2016
660thescienceclinic.infoGoDaddy.com, LLC24 Dec 201525 Dec 201624 Dec 2017
661thescienceclinic.comGoDaddy.com, LLC24 Dec 201511 Jan 202524 Dec 2026
662thescienceclinic.orgGoDaddy.com, LLC24 Dec 201525 Dec 201624 Dec 2017
663thesciencesutras.comTucows Domains Inc.26 Dec 201525 Dec 202426 Dec 2025
664thesciencestand.comGoDaddy.com, LLC28 Dec 201528 Dec 201528 Dec 2016
665thesciencehustlepodcast.comGoogle, Inc.29 Dec 201529 Dec 201529 Dec 2016
666thesciencehustleblog.comGoogle, Inc.29 Dec 201529 Dec 201529 Dec 2016
667thesciencehustle.comGoogle, Inc.29 Dec 201529 Dec 201529 Dec 2016
668thesciencedoghouse.comGoDaddy.com, LLC29 Dec 201530 Dec 202329 Dec 2025
669thesciencereviews.comGoDaddy.com, LLC30 Dec 201530 Dec 201530 Dec 2016
670thescienceofsellingonline.comAmazon Registrar, Inc.30 Dec 201525 Nov 202430 Dec 2025
671thescienceofdata.comGoDaddy.com, LLC30 Dec 201511 Feb 202530 Dec 2025
672thescienceofchic.comGoDaddy.com, LLC31 Dec 201531 Dec 201531 Dec 2016
673thescienceofbooty.comGoDaddy.com, LLC31 Dec 201531 Dec 201531 Dec 2017
674thesciencepodcast.comGoDaddy.com, LLC21 Jun 201723 Jun 202421 Jun 2025
675thescienceofsmoking.comGoDaddy.com, LLC4 Jan 20164 Jan 20164 Jan 2017
676thescienceofflight.netTucows Domains Inc.31 Dec 20134 Jan 201631 Dec 2016
677thescienceoftravel.comNamesilo, LLC3 Apr 20184 Apr 20243 Apr 2025
678thesciencesingers.comGoDaddy.com, LLC5 Jan 20165 Jan 20165 Jan 2017
679thescienceofbliss.comGoDaddy.com, LLC19 Nov 200720 Nov 202419 Nov 2026
680thescienceofgettingrichnow.comGoDaddy.com, LLC7 Jan 20167 Jan 20167 Jan 2017
681thescienceofgetting.comGoDaddy.com, LLC25 Dec 202130 Dec 202325 Dec 2025
682thesciencestudent.comFastDomain Inc.11 Jan 201611 Jan 201611 Jan 2017
683thescienceofexercise.comNameCheap, Inc.28 Jun 201829 May 201928 Jun 2020
684thescienceofgettingrichnow.orgGoDaddy.com, LLC7 Jan 20168 Jan 20177 Jan 2018
685thescienceofflight.orgTucows Domains Inc.31 Dec 20134 Jan 201631 Dec 2016
686thescienceofmarriage.comTucows Domains Inc.13 Jan 201617 Jan 202013 Jan 2020
687thescienceandartofpitching.comTucows Domains Inc.10 Jan 200614 Jan 201610 Jan 2017
688thescienceofless.comNetwork Solutions, LLC14 Jan 20165 Mar 201714 Jan 2018
689thesciencebehindskinbycaseyjaexx.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Jan 201614 Jan 201614 Jan 2017
690thescienceofscent.comDomain.com, LLC16 Jan 20161 Jan 202516 Jan 2026
691thescienceeducator.comWix.com Ltd.4 Jul 20214 Jun 20244 Jul 2025
692thescienceofpersonalchange.comRebel.com Corp.16 Jan 20165 Dec 201616 Jan 2018
693thesciencematters.comNameCheap, Inc.4 Mar 20254 Mar 20254 Mar 2028
694thesciencestudios.comGoDaddy.com, LLC21 Jan 201621 Jan 201621 Jan 2018
695thescienceoffit.comTurnCommerce, Inc. DBA NameBright.com27 Oct 20174 Oct 202027 Oct 2025
696thescienceandspiritualityofsuccess.comGoDaddy.com, LLC24 Jan 201624 Jan 201624 Jan 2017
697thesciencebehind.comWebfusion Ltd.24 Jan 201625 Jan 202524 Jan 2027
698thesciencebox.orgRegister NV dba Register.eu27 Jan 201613 Mar 202527 Jan 2026
699thescienceofpurpose.comGoDaddy.com, LLC28 Nov 201928 Nov 202428 Nov 2025
700thescienceoffantasy.comFastDomain Inc.29 Jan 20164 Feb 201729 Jan 2018
701thescienceofearth.comNameCheap, Inc.31 Jul 202211 Sep 202331 Jul 2023
702thescienceofgettingrichmastery.comTucows Domains Inc.31 Jan 20164 Feb 201931 Jan 2019
703thescienceshow.liveGoDaddy.com, LLC1 Feb 201618 Mar 20171 Feb 2018
704thescienceofmuscle.comGoogle, Inc.3 Jun 20233 Aug 20243 Jun 2024
705thescienceofyoga.neteNom, Inc.2 Feb 201616 Apr 20252 Feb 2025
706thescienceofalchemy.comGoDaddy.com, LLC3 Feb 20163 Feb 20163 Feb 2017
707thescienceofprogress.comGoDaddy.com, LLC30 Nov 202430 Nov 202430 Nov 2025
708thescienceofsmart.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Feb 201623 Jan 20178 Feb 2018
709thescienceofslim.comDynadot, LLC6 Aug 20237 Aug 20246 Aug 2025
710thescienceoflean.comeNom, Inc.21 Jun 201921 Jun 201921 Jun 2020
711thescienceoftennis.comGoogle, Inc.22 Mar 202122 Mar 202122 Mar 2022
712thescienceofpitching.comTucows Domains Inc.7 Feb 200511 Feb 20167 Feb 2017
713thescienceleaf.comGoogle, Inc.12 Feb 201612 Feb 201612 Feb 2017
714thesciencegym.comGoDaddy.com, LLC28 Mar 202028 Mar 202428 Mar 2026
715thescienceofmetabolism.comGoDaddy.com, LLC14 Feb 201614 Feb 201614 Feb 2017
716thescienceoflearninggroup.comGoDaddy.com, LLC15 Feb 201619 Feb 202415 Feb 2026
717thesciencebarn.comGoDaddy.com, LLC13 Feb 201613 Feb 201613 Feb 2017
718thescienceofaces.comNamesilo, LLC17 Feb 201620 Apr 202517 Feb 2026
719thescienceofaces.orgNamesilo, LLC18 Feb 20164 Apr 202518 Feb 2026
720thescienceofaces.netNamesilo, LLC17 Feb 201624 Aug 201717 Feb 2018
721thescienceofspiritualtalking.comCrazy Domains FZ-LLC18 Feb 20162 Feb 202518 Feb 2026
722thescienceofimpulse.comWebfusion Ltd.17 Feb 201618 Feb 202517 Feb 2026
723thescienceofspiritualtalking.orgCrazy Domains FZ-LLC18 Feb 20167 Feb 202518 Feb 2026
724thescienceofjiujitsu.comGoDaddy.com, LLC11 Jan 202211 Jan 202411 Jan 2026
725thescienceofjiujitsu.netGoDaddy.com, LLC21 Feb 201621 Feb 201621 Feb 2017
726thescienceisclear.netGoDaddy.com, LLC23 Feb 201623 Feb 201623 Feb 2017
727thescienceisclear.comTurnCommerce, Inc. DBA NameBright.com12 May 201812 Feb 202512 May 2025
728thescienceisclear.orgGoDaddy.com, LLC23 Feb 201624 Feb 201723 Feb 2018
729thesciencerobot.comGoogle, Inc.24 Feb 201610 Feb 202524 Feb 2026
730thesciencecorporation.com1&1 Internet AG26 Feb 201627 Feb 201726 Feb 2018
731thescienceoftruth.orgGoDaddy.com, LLC13 Dec 202027 Jan 202513 Dec 2025
732thescienceofsleep.orgDomain.com, LLC29 Feb 201629 Feb 201628 Feb 2017
733thescienceofsleep.netDomain.com, LLC29 Feb 201629 Feb 201628 Feb 2017
734thescienceofsitting.comregister.com, Inc.23 May 20244 Sep 202423 May 2026
735thescienceofgettingrich.bizNameCheap, Inc.27 Feb 20243 Feb 202527 Feb 2026
736thescienceofchai.comeNom, Inc.2 Mar 20162 Mar 20162 Mar 2017
737thescienceofillustration.orgWild West Domains, LLC3 Mar 20161 Feb 20173 Mar 2018
738thescienceofsweat.comGoDaddy.com, LLC13 Jul 202114 Jul 202313 Jul 2025
739thescienceofmindfulness.comGoDaddy.com, LLC28 Jun 202328 Jun 202428 Jun 2025
740thescienceofskiing.comDomainPeople, Inc.11 Mar 201610 Feb 201711 Mar 2018
741thescienceofhumandynamics.usGoDaddy.com, LLC11 Mar 201611 Mar 201610 Mar 2017
742thescienceofhumandynamics.orgGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
743thescienceofhumandynamics.infoGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
744thescienceofhumandynamics.bizGoDaddy.com, LLC11 Mar 201615 Aug 201610 Mar 2017
745thescienceoffinancialdynamics.usGoDaddy.com, LLC11 Mar 201611 Mar 201610 Mar 2017
746thescienceoffinancialdynamics.orgGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
747thescienceoffinancialdynamics.infoGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
748thescienceoffinancialdynamics.bizGoDaddy.com, LLC11 Mar 201615 Aug 201610 Mar 2017
749thescienceofbusinessdynamics.orgGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
750thescienceofbusinessdynamics.netGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
751thescienceofbusinessdynamics.infoGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
752thescienceofbusinessdynamics.bizGoDaddy.com, LLC11 Mar 201615 Aug 201610 Mar 2017
753thescienceofhumandynamics.netGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
754thescienceoffinancialdynamics.netGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
755thescienceofhumandynamics.comGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
756thescienceoffinancialdynamics.comGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
757thescienceofbusinessdynamics.comGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
758thesciencefair.infoDomain.com, LLC15 Mar 2016-15 Mar 2017
759thesciencedigital.com1&1 Internet AG15 Mar 201616 Mar 201715 Mar 2018
760thesciencesvr.comGoDaddy.com, LLC16 Mar 201616 Mar 201616 Mar 2017
761thescienceofseminars.comGoDaddy.com, LLC30 Jul 201930 Jul 201930 Jul 2020
762thesciencembg.comGoDaddy.com, LLC17 Mar 201617 Mar 201617 Mar 2017
763thescienceofsearchenginemarketing.com1&1 Internet AG18 Mar 201619 Mar 201718 Mar 2018
764thescienceofprogrammaticadvertising.com1&1 Internet AG18 Mar 201619 Mar 201718 Mar 2018
765thescienceoflandingpages.com1&1 Internet AG18 Mar 201619 Mar 201718 Mar 2018
766thescienceofdigitalmarketing.com1&1 Internet AG18 Mar 201619 Mar 201718 Mar 2018
767thescienceofdigitalbusiness.com1&1 Internet AG18 Mar 201619 Mar 201718 Mar 2018
768thescienceofdigital.comOVH sas18 Mar 201619 Mar 202418 Mar 2025
769thescienceofconversionrateoptimization.com1&1 Internet AG18 Mar 201619 Mar 201718 Mar 2018
770thescienceofasea.netGoDaddy.com, LLC18 Mar 201619 Mar 202518 Mar 2026
771thesciencedigitalbusiness.com1&1 Internet AG18 Mar 201619 Mar 201718 Mar 2018
772thesciencemag.comGoDaddy.com, LLC23 May 202228 May 202523 May 2026
773thescienceguyusa.netGoDaddy.com, LLC19 Mar 201619 Mar 201619 Mar 2017
774thescienceguyusa.comGoDaddy.com, LLC19 Mar 201619 Mar 201619 Mar 2017
775thescienceguyus.comGoDaddy.com, LLC19 Mar 201619 Mar 201619 Mar 2017
776thesciencesisters.comWix.com Ltd.29 Mar 20201 Mar 202429 Mar 2026
777thescienceofasea.usGoDaddy.com, LLC21 Mar 201621 Mar 201720 Mar 2018
778thescienceofhealthdynamics.comGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
779thescienceoflearningdynamics.orgGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
780thescienceoflearningdynamics.netGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
781thescienceoflearningdynamics.infoGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
782thescienceoflearningdynamics.bizGoDaddy.com, LLC23 Mar 201615 Aug 201622 Mar 2017
783thescienceofhealthdynamics.orgGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
784thescienceofhealthdynamics.netGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
785thescienceofhealthdynamics.infoGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
786thescienceofhealthdynamics.bizGoDaddy.com, LLC23 Mar 201615 Aug 201622 Mar 2017
787thescienceoffreemarketcapitalism.orgGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
788thescienceoffreemarketcapitalism.netGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
789thescienceoffreemarketcapitalism.infoGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
790thescienceoffreemarketcapitalism.bizGoDaddy.com, LLC23 Mar 201615 Aug 201622 Mar 2017
791thescienceboutique.orgDreamHost, LLC22 Mar 201624 Feb 202522 Mar 2026
792thescienceoflearningdynamics.comGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
793thescienceofgettingrichclub.comWeb4Africa Inc13 Mar 202513 Mar 202513 Mar 2026
794thescienceoffreemarketcapitalism.comGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
795thescienceofdating.accountantPDR Ltd. d/b/a PublicDomainRegistry.com22 Mar 201622 Mar 201621 Mar 2017
796thescienceofcelebrationak.comLaunchpad, Inc.22 Mar 20164 Jun 202522 Mar 2025
797thescienceoflearningdynamics.usGoDaddy.com, LLC23 Mar 201623 Mar 201622 Mar 2017
798thescienceofhealthdynamics.usGoDaddy.com, LLC23 Mar 201623 Mar 201622 Mar 2017
799thescienceoffreemarketcapitalism.usGoDaddy.com, LLC23 Mar 201623 Mar 201622 Mar 2017
800thesciencefictionpsychologist.comTucows Domains Inc.22 Mar 201422 Mar 201422 Mar 2017
801thescienceofimpression.comGoDaddy.com, LLC27 Mar 201627 Mar 201627 Mar 2017
802thescienceofrock.comWild West Domains, LLC29 Mar 201629 Mar 201629 Mar 2017
803thescienceportal.orgGoDaddy.com, LLC31 Mar 20161 Apr 201731 Mar 2018
804thescienceofblog.comGoDaddy.com, LLC30 Mar 201630 Mar 201630 Mar 2017
805thescienceportal.netGoDaddy.com, LLC31 Mar 201631 Mar 201631 Mar 2017
806thescienceportal.infoGoDaddy.com, LLC31 Mar 201612 May 202031 Mar 2021
807thescienceofintuition.orgWild West Domains, LLC1 Apr 20169 Mar 20251 Apr 2026
808thescienceofepigenetics.comGoDaddy.com, LLC1 Apr 20161 Apr 20161 Apr 2017
809thescienceofbeingwellsharingwealth.comGoDaddy.com, LLC1 Apr 20161 Apr 20161 Apr 2017
810thesciencedelusion.comFastDomain Inc.1 Apr 20161 Apr 20161 Apr 2017
811thescienceofdiversity.infoGoDaddy.com, LLC3 Apr 20163 Apr 20163 Apr 2017
812thescienceofdiversity.orgGoDaddy.com, LLC3 Apr 201618 May 20253 Apr 2026
813thescienceofdiversity.netGoDaddy.com, LLC3 Apr 20163 Apr 20163 Apr 2017
814thescienceofdiversity.comGoDaddy.com, LLC3 Apr 20164 Apr 20253 Apr 2026
815thescienceinformer.comGoDaddy.com, LLC4 Apr 20164 Apr 20164 Apr 2017
816thescienceofbeinghealthyandwealthy.comGoDaddy.com, LLC5 Apr 20165 Apr 20165 Apr 2017
817thesciencecollaborative.netGMO Internet Inc.8 Apr 20168 Apr 20168 Apr 2017
818thescienceolympics.com-10 Apr 201610 Apr 201610 Apr 2017
819thescienceolympics.orgNetwork Solutions, LLC10 Apr 201610 Apr 201610 Apr 2017
820thescienceofgettingrichaccelerator.com-11 Apr 201611 Apr 201611 Apr 2017
821thescienceeater.comGoDaddy.com, LLC11 Apr 201611 Apr 201611 Apr 2017
822thesciencehour.comGoDaddy.com, LLC12 Apr 201612 Apr 201612 Apr 2017
823thescienceofconnectology.comGoDaddy.com, LLC14 Apr 201614 Apr 201614 Apr 2017
824thesciencebook.netWix.com Ltd.12 Aug 202116 Aug 202212 Aug 2022
825thescienceofbusiness.comGoDaddy.com, LLC13 Jul 201827 Jun 202413 Jul 2025
826thesciencenoone.comGoDaddy.com, LLC20 Apr 201625 Apr 202520 Apr 2027
827thescienceguys.comTurnCommerce, Inc. DBA NameBright.com9 Jul 20182 Feb 20259 Jul 2026
828thesciences.infoGoDaddy.com, LLC22 Apr 201622 Apr 201622 Apr 2017
829thesciencepress.orgTucows Domains Inc.22 Apr 201625 Feb 201722 Apr 2018
830thesciencefoundation.orgeNom, Inc.1 May 20207 Apr 20251 May 2026
831thescienceofwoowoo.comGoDaddy.com, LLC24 Apr 20165 Jun 202524 Apr 2025
832thescienceofsin.comTucows Domains Inc.26 Apr 201126 Apr 201126 Apr 2017
833thescienceofgreatleadership.comNetwork Solutions, LLC29 Apr 201629 Apr 201629 Apr 2017
834thesciencesociety.comGandi SAS29 Jan 201328 Dec 202429 Jan 2026
835thesciencetheatrecompany.comGoDaddy.com, LLC2 May 20162 May 20162 May 2017
836thesciencetheatre.comGoDaddy.com, LLC13 May 202013 May 202013 May 2022
837thesciencetheatercompany.comGoDaddy.com, LLC2 May 20162 May 20162 May 2017
838thesciencetheater.comGoDaddy.com, LLC2 May 20162 May 20162 May 2017
839thesciencedepot.orgGoDaddy.com, LLC3 May 201618 Apr 20173 May 2018
840thescienceforex.infoGoDaddy.com, LLC5 May 20165 May 20165 May 2017
841thescienceofjoy.comWild West Domains, LLC6 May 20166 Apr 20256 May 2026
842thescienceofcve.comGoogle, Inc.7 May 201622 Apr 20257 May 2026
843thesciencecooperative.orgGoDaddy.com, LLC7 May 20167 May 20257 May 2026
844thescienceforge.comAutomattic Inc.28 Apr 20228 Apr 202528 Apr 2026
845thesciencepen.comFastDomain Inc.24 Jan 20239 Jan 202524 Jan 2026
846thesciencediaries.comWix.com Ltd.5 Oct 20209 Oct 20245 Oct 2025
847thescienceofgiving.comGoDaddy.com, LLC21 May 201622 May 202521 May 2026
848thescienceofdonors.comGoDaddy.com, LLC21 May 201626 May 202521 May 2026
849thescienceofenergywork.comGoDaddy.com, LLC23 May 201623 May 201623 May 2017
850thesciencescoop.comTurnCommerce, Inc. DBA NameBright.com24 May 201612 Feb 202524 May 2025
851thescienceofnursing.comWix.com Ltd.26 Jan 202130 Jan 202326 Jan 2023
852thesciencewizard.comAnnulet LLC15 Aug 20222 Oct 202415 Aug 2025
853thescienceofbeingawesome.comGoDaddy.com, LLC29 May 201629 May 201629 May 2017
854thescienceofnutrition.lifeGoDaddy.com, LLC1 Jun 20166 Jan 20171 Jun 2018
855thescienceofnutrition.todayGoDaddy.com, LLC1 Jun 20166 Jan 20171 Jun 2018
856thescienceofnutrition.orgGoDaddy.com, LLC1 Jun 20161 Aug 20161 Jun 2018
857thescienceofnutrition.netGoDaddy.com, LLC1 Jun 20161 Jun 20161 Jun 2018
858thescienceofnutrition.infoGoDaddy.com, LLC1 Jun 20162 Jun 20181 Jun 2020
859thesciencesheep.comGoDaddy.com, LLC2 Jun 20162 Jun 20162 Jun 2017
860thesciencemomblog.comeNom, Inc.30 Mar 202030 Mar 202030 Mar 2021
861thesciencevault.comNameCheap, Inc.27 Sep 202427 Sep 202427 Sep 2025
862thesciencesofnutrition.comGoDaddy.com, LLC2 Jun 20163 Jun 20242 Jun 2026
863thescienceofsuccessfulliving.orgSibername Internet and Software Technologies Inc.19 Oct 202424 Oct 202419 Oct 2025
864thescienceofsuccessfulliving.comGoDaddy.com, LLC3 Jun 20164 Jun 20253 Jun 2026
865thesciencetraveler.comGoogle, Inc.8 Feb 202124 Jan 20258 Feb 2026
866thescienceofgrowingrich.comGoDaddy.com, LLC11 Jun 201611 Jun 201611 Jun 2017
867thescienceofmagnetizingmillions.comGoDaddy.com, LLC13 Jun 201613 Jun 201613 Jun 2019
868thescienceinstitute.comTucows Domains Inc.28 Aug 202430 Aug 202428 Aug 2025
869thescienceofretail.comGoDaddy.com, LLC12 Dec 201912 Dec 202412 Dec 2025
870thescienceoftheatomthatisquantum.comGoDaddy.com, LLC16 Jun 201616 Jun 201616 Jun 2017
871thescienceofmanagingsales.comTucows Domains Inc.12 Jun 201212 Jun 201212 Jun 2017
872thesciencemagazines.com-15 Jun 201615 Jun 201615 Jun 2017
873thesciencekat.comAutomattic Inc.7 Apr 202120 May 20257 Apr 2025
874thescienceofwanderlust.comDreamHost, LLC19 Jun 201619 Jun 201619 Jun 2017
875thescienceofstupid.comeNom, Inc.19 Jun 201619 Jun 201619 Jun 2017
876thesciencewiz.netGoDaddy.com, LLC22 Jun 201622 Jun 201622 Jun 2019
877thesciencepub.comGoDaddy.com, LLC8 Sep 20218 Sep 20218 Sep 2022
878thescienceoffreshideas.comDreamHost, LLC24 Jun 201624 May 202524 Jun 2026
879thesciencehedgehog.comGoDaddy.com, LLC29 Jul 201830 Jul 202429 Jul 2027
880thesciencematrix.comHongkong Domain Name Information Management Co., L…10 Nov 202113 Nov 202210 Nov 2022
881thescienceofcbd.comBeijing Lanhai Jiye Technology Co., Ltd29 Oct 202331 Dec 202429 Oct 2024
882thescienceofcanna.comWebfusion Ltd.3 Jul 20163 Jul 20163 Jul 2018
883thescienceoftime.comNamesilo, LLC6 Jul 201616 Jul 20186 Jul 2019
884thescienceninjas.infoGoDaddy.com, LLC7 Jun 20167 Jun 20167 Jun 2017
885thescienceninjas.orgGoDaddy.com, LLC7 Jun 20167 Jun 20167 Jun 2017
886thescienceofeducation.orgGoDaddy.com, LLC5 Sep 201920 Oct 20245 Sep 2025
887thescienceninjas.netGoDaddy.com, LLC7 Jun 20167 Jun 20167 Jun 2017
888thescienceninjas.comFastDomain Inc.7 Jun 201620 Jul 20247 Jun 2024
889thescienceinquiry.com-10 Jul 201610 Jul 201610 Jul 2017
890thesciencepirate.comGoDaddy.com, LLC10 Jul 201611 Jul 202410 Jul 2025
891thescienceofdentistry.comGoDaddy.com, LLC1 Oct 20091 Oct 20231 Oct 2032
892thescienceofacne.orgGoDaddy.com, LLC12 Jul 201621 Dec 201612 Jul 2018
893thesciencetype.comGoDaddy.com, LLC13 Jul 201613 Jul 202413 Jul 2026
894thesciences.educationGoDaddy.com, LLC13 Oct 201727 Nov 201913 Oct 2020
895thescienceline.orgGoDaddy.com, LLC14 Jul 201610 May 201714 Jul 2018
896thesciencetosuccess.comGoDaddy.com, LLC16 Jan 201417 Jan 202516 Jan 2026
897thescienceofsugar.bizGoDaddy.com, LLC24 Oct 201314 Oct 201523 Oct 2016
898thescienceofyouthfulaging.bizCrazy Domains FZ-LLC19 Sep 201129 Sep 202118 Sep 2021
899thescienceofcompassion.bizGoDaddy.com, LLC1 Aug 201429 Jul 201731 Jul 2018
900thescienceofhappinessatwork.bizGoDaddy.com, LLC14 Mar 201114 Mar 201713 Mar 2019
901thescienceofdestiny.bizGoDaddy.com, LLC14 Jan 202120 Jan 202514 Jan 2026
902thescienceofbeingwell.bizNameCheap, Inc.23 Mar 202123 Mar 202123 Mar 2022
903thesciencenetwork.bizNameCheap, Inc.10 Jun 202510 Jun 202510 Jun 2026
904thescienceofsuccess.bizGoDaddy.com, LLC6 Apr 20126 Apr 20175 Apr 2018
905thescienceofart.bizDomainPeople, Inc.16 Aug 200927 Sep 202315 Aug 2023
906thescienceofskin.bizeNom, Inc.9 Nov 20096 Nov 20248 Nov 2025
907thescienceofdoinggood.bizGoDaddy.com, LLC2 Aug 201412 Aug 20151 Aug 2016
908thesciencedemystifier.comTucows Domains Inc.19 Jul 20164 Jul 202419 Jul 2025
909thescienceinquran.com-18 Jul 201418 Jul 201418 Jul 2017
910thescienceofosteopathy.orgArsys Internet, S.L. dba NICLINE.COM22 Jul 201625 Aug 201722 Jul 2018
911thescienceandsoul.comGoDaddy.com, LLC10 Apr 202510 Apr 202510 Apr 2026
912thescienceofgettingrichjourney.comGoDaddy.com, LLC23 Jul 201624 Jul 202423 Jul 2025
913thesciencewizardskn.comFastDomain Inc.23 Jul 201623 Jul 201723 Jul 2018
914thescienceofhome.comGoDaddy.com, LLC6 May 20227 May 20246 May 2026
915thescienceofdeduction.netPDR Ltd. d/b/a PublicDomainRegistry.com29 Jul 201430 Jul 201729 Jul 2019
916thescienceoftea.comeNom, Inc.21 Oct 201422 Sep 201721 Oct 2017
917thesciencestream.scienceGoDaddy.com, LLC30 Jul 20169 Sep 201729 Jul 2017
918thescienceofcreatingyourlife.com-1 Aug 20161 Aug 20161 Aug 2017
919thescienceofaddiction.comGoDaddy.com, LLC7 Jan 202416 Jan 20257 Jan 2026
920thesciencemagnet.orgGoDaddy.com, LLC25 Oct 201721 Jul 202425 Oct 2027
921thescienceofscents.comGoDaddy.com, LLC6 Aug 20246 Aug 20246 Aug 2025
922thescienceofsence.com-7 Aug 20167 Aug 20167 Aug 2017
923thescienceofsense.com-7 Aug 20167 Aug 20167 Aug 2017
924thescienceofmeditation.orgWild West Domains, LLC7 Aug 201613 Jul 20247 Aug 2025
925thescienceofcannabisinstitute.comeNom, Inc.9 Aug 20168 Aug 20169 Aug 2018
926thescienceoffarming.com-9 Aug 20169 Aug 20169 Aug 2017
927thesciencebandwagon.com-9 Aug 20169 Aug 20169 Aug 2017
928thescienceacademyindia.orgGoDaddy.com, LLC12 Aug 201623 Sep 201712 Aug 2018
929thesciencetranslator.comGoDaddy.com, LLC25 Jun 202325 Jun 202325 Jun 2025
930thescienceenthusiasts.comGoogle, Inc.14 Aug 201614 Sep 201714 Aug 2017
931thescienceofgettingrichforatheists.com-14 Aug 201614 Aug 201614 Aug 2017
932thescienceofgettingrichforteens.comCronon AG3 Mar 202522 Apr 20253 Mar 2026
933thesciencecafe.comGoDaddy.com, LLC21 Oct 202022 Oct 202421 Oct 2025
934thescienceofstorage.com-17 Aug 201617 Aug 201617 Aug 2017
935thescienceofstorage.netNetwork Solutions, LLC1 Jul 202013 Sep 20231 Jul 2023
936thescienceofstorage.orgGoDaddy.com, LLC17 Aug 201617 Aug 201717 Aug 2018
937thescienceofemotion.comregister.com, Inc.20 Sep 20229 Sep 202420 Sep 2025
938thescienceofmismanagement.com-19 Aug 201619 Aug 201619 Aug 2017
939thescienceoffabric.com-20 Aug 201620 Aug 201620 Aug 2021
940thesciencematters.netGoogle, Inc.25 Apr 201825 Apr 201825 Apr 2019
941thescienceofstuck.comGoDaddy.com, LLC22 Aug 201618 Oct 202422 Aug 2025
942thesciencetalkers.comGoDaddy.com, LLC23 Sep 201923 Sep 201923 Sep 2020
943thescienceofthebeyond.com-23 Aug 201623 Aug 201623 Aug 2017
944thescienceofbeyond.com-23 Aug 201623 Aug 201623 Aug 2017
945thesciencetalkers.net-23 Aug 201623 Aug 201623 Aug 2017
946thesciencetalkers.orgeNom, Inc.23 Aug 20165 Oct 201723 Aug 2018
947thescienceofobservation.comGoDaddy.com, LLC24 Aug 201624 Aug 201624 Aug 2017
948thesciencefeed.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Apr 202210 Jun 202329 Apr 2023
949thesciencelink.comNameCheap, Inc.30 Apr 202231 Mar 202530 Apr 2026
950thescienceofmakingmoney.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Jul 20225 Jul 20244 Jul 2025
951thescienceofmakingmoney.infoGoDaddy.com, LLC27 Aug 20168 Oct 201727 Aug 2018
952thescienceofglow.comOVH sas28 Aug 201629 Aug 202428 Aug 2025
953thescienceishard.comFastDomain Inc.29 Aug 20161 Oct 201729 Aug 2017
954thescienceoftruckdriverrecruiting.comTucows Domains Inc.31 Aug 20164 Sep 202131 Aug 2021
955thesciencescribe.comGoDaddy.com, LLC1 Sep 201613 Oct 20241 Sep 2024
956thescienceofyouthfulness.comGoogle, Inc.2 Sep 20162 Oct 20172 Sep 2017
957thescienceofyouthfullness.comGoogle, Inc.2 Sep 20162 Oct 20172 Sep 2017
958thescienceofchangingyourlife.com-4 Sep 20164 Sep 20164 Sep 2017
959thesciencespiritual.comDreamHost, LLC4 Sep 201617 Oct 20174 Sep 2017
960thescienceoffriendship.comGKG.NET, INC.6 Sep 201624 Jan 20176 Sep 2019
961thescienceofbikes.com-9 Sep 20169 Sep 20169 Sep 2017
962thesciencelaunch.com-9 Sep 20169 Sep 20169 Sep 2017
963thescienceproject.us-9 Sep 20169 Sep 20168 Sep 2017
964thesciencehole.com-15 Sep 201615 Sep 201615 Sep 2017
965thesciencethetruth.com-18 Sep 201618 Sep 201618 Sep 2018
966thesciencefictioncafe.comeNom, Inc.18 Sep 201631 Oct 201718 Sep 2017
967thesciencebug.comFastDomain Inc.19 Sep 201619 Sep 201719 Sep 2018
968thescienceofmeditation.infoGoDaddy.com, LLC16 Sep 201617 Sep 201916 Sep 2020
969thescienceofaccuracy.comNameCheap, Inc.6 Dec 202129 Nov 20226 Dec 2027
970thescienceteacher.co.uk-29 May 200628 May 202529 May 2026
971thescienceoftheheart.comGoDaddy.com, LLC21 Sep 20165 Nov 201821 Sep 2019
972thesciencethehype.com-21 Sep 201621 Sep 201621 Sep 2018
973thesciencestarters.orgeNom, Inc.22 Sep 201624 Aug 201722 Sep 2018
974thesciencestarters.comeNom, Inc.22 Sep 201622 Aug 201722 Sep 2018
975thescienceofwaterfalls.comTucows Domains Inc.23 Sep 201627 Sep 201923 Sep 2019
976thescienceride.com-26 Sep 201626 Sep 201626 Sep 2017
977thesciencearcade.comTurnCommerce, Inc. DBA NameBright.com14 Dec 20238 Dec 202414 Dec 2025
978thesciencebehindskin.com-27 Sep 201627 Sep 201627 Sep 2018
979thesciencevessel.com-28 Sep 201628 Sep 201628 Sep 2017
980thescienceofthe23rdpsalm.comGoDaddy.com, LLC28 Sep 201629 Sep 202228 Sep 2026
981thesciencehour.orgGoDaddy.com, LLC29 Sep 201629 Sep 201629 Sep 2017
982thesciencezine.scienceeNom, Inc.1 Oct 201612 Nov 201730 Sep 2017
983thescienceofskin.comGoDaddy.com, LLC19 May 200719 May 202519 May 2026
984thescienceofheat.comGoDaddy.com, LLC28 Aug 202428 Aug 202428 Aug 2027
985thescienceofwhy.comNetwork Solutions, LLC9 May 201310 Mar 20259 May 2026
986thescienceofyoga.comTurnCommerce, Inc. DBA NameBright.com18 Apr 201312 Apr 202118 Apr 2026
987thescienceandentertainmentlab.comSynergy Wholesale Pty Ltd15 Apr 201422 Mar 202515 Apr 2026
988thescienceprojectstore.comNetwork Solutions, LLC20 Jul 200320 May 202520 Jul 2028
989thesciencecouncil.comGoDaddy.com, LLC11 Mar 200912 Mar 202411 Mar 2026
990thescienceofeckharttolle.comGoDaddy.com, LLC4 Sep 20134 Sep 20134 Sep 2016
991thescienceofsafersleeping.comWebfusion Ltd.25 Nov 200818 Nov 201725 Nov 2018
992thescienceprofessor.comTurnCommerce, Inc. DBA NameBright.com3 Jun 201928 May 20203 Jun 2025
993thesciencewriter.comGoDaddy.com, LLC11 Oct 200215 Dec 202411 Oct 2025
994thescienceofreiki.com1&1 Internet AG6 Sep 201012 Apr 20186 Sep 2025
995thescienceoflifeinthe21stcentury.comGoDaddy.com, LLC3 Aug 201220 Sep 201619 Sep 2017
996thescienceofbreath.comGoDaddy.com, LLC10 Dec 200811 Dec 202410 Dec 2025
997thescienceplace.comKey-Systems GmbH12 Jul 201211 Jun 202512 Jul 2026
998thesciencemagician.comGoDaddy.com, LLC12 Feb 201011 Feb 201512 Feb 2017
999thescienceofhumanpotential.comNameCheap, Inc.1 Oct 202312 Dec 20241 Oct 2024
1000thescienceattorneys.comGoDaddy.com, LLC27 Nov 201328 Nov 201527 Nov 2016

Displaying 1,000 out of 4,343 domains starting with the keyword "THESCIENCE". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=thescience

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now