Our database now contains whois records of 675 Million (675,350,399) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [675 Million Domains] $10,000 Details

Keyword: THEPHARMA

Reverse Whois » KEYWORD [thepharma ]  { 1,661 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1thepharma.comGoDaddy.com, LLC26 Dec 200831 Jan 202626 Dec 2026
2thepharma.xyzGMO Internet Inc.11 Mar 202512 Mar 202611 Mar 2027
3thepharma.academyAutomattic Inc.10 Mar 202310 Mar 202310 Mar 2024
4thepharma.netGoDaddy.com, LLC20 Jul 202423 Dec 202520 Jul 2026
5thepharma.orgDropCatch.com 1504 LLC11 Mar 202612 Mar 202611 Mar 2027
6thepharma.storeHostinger, UAB4 Jan 202517 Feb 20264 Jan 2026
7thepharma.companyGoDaddy.com, LLC12 Dec 201917 Dec 201912 Dec 2020
8thepharma.infoNetwork Solutions, LLC20 Jul 20201 Oct 202420 Jul 2024
9thepharma.mediaHosting Ukraine LLC7 Aug 202019 Jan 20267 Aug 2034
10thepharma.clubGoDaddy.com, LLC5 Apr 20215 Apr 20215 Apr 2022
11thepharma.digitalGoDaddy.com, LLC5 Jan 202317 Mar 20245 Jan 2024
12thepharma.onlineEuroDNS S.A.7 Aug 202015 May 20257 Aug 2032
13thepharma.uk-21 Jun 202220 Jun 202521 Jun 2026
14thepharma.shopGo China Domains, LLC26 Sep 20166 Jun 202426 Sep 2024
15thepharma.ru-21 Oct 2021-21 Oct 2026
16thepharma.newsGoDaddy.com, LLC4 Oct 202418 Nov 20254 Oct 2026
17thepharma.su-26 Oct 2024-26 Oct 2025
18thepharma.eu----
19thepharmacyexpress.comGransy s.r.o. d/b/a subreg.cz8 Jul 201828 Jul 20258 Jul 2026
20thepharmacyone.comAbove.com Pty Ltd.31 May 201515 Feb 202631 May 2026
21thepharmaletter.comWebfusion Ltd.6 Aug 200921 Jul 20256 Aug 2026
22thepharmacyproject.comTucows Domains Inc.21 Oct 20146 Oct 202521 Oct 2026
23thepharmacynyc.comGoDaddy.com, LLC9 Jun 202321 Jul 20259 Jun 2025
24thepharmacyone-24.comNameCheap, Inc.14 Jul 201814 Jul 201814 Jul 2019
25thepharmas.comGoDaddy.com, LLC4 Apr 20204 Apr 20204 Apr 2021
26thepharmatimes.in-31 Dec 201130 Dec 202531 Dec 2026
27thepharmacytechniciancertificationhq.comTucows Domains Inc.20 Oct 201324 Oct 201420 Oct 2015
28thepharmacy.com.au--22 Nov 2025-
29thepharmacistminute.comGoDaddy.com, LLC28 May 200929 May 201528 May 2016
30thepharmacy-lakeland.comGoDaddy.com, LLC2 Jun 20132 Jun 20152 Jun 2016
31thepharmacy24.comAbove.com Pty Ltd.7 Jan 20236 Jan 20247 Jan 2027
32thepharmaceuticalcompany.com-10 Aug 202312 Aug 202410 Aug 2025
33thepharmaceuticaldelivery.comGoDaddy.com, LLC9 Nov 200717 Apr 20159 Nov 2018
34thepharmacy.bizGoDaddy.com, LLC5 Dec 202024 Oct 20255 Dec 2025
35thepharmablog2014.com----
36thepharmacyone24h.comSibername Internet and Software Technologies Inc.24 Jun 201412 Jan 201524 Jun 2016
37thepharmaceuticalmarketersdirectory.comGoDaddy.com, LLC13 Jun 201113 Jun 201513 Jun 2016
38thepharmacycompany.comNameCheap, Inc.18 Sep 202518 Sep 202518 Sep 2026
39thepharmacyhistory.orgGoDaddy.com, LLC16 Jun 201028 Jun 201516 Jun 2016
40thepharmacyworld.comGoDaddy.com, LLC6 Nov 201417 Sep 20226 Nov 2026
41thepharmacistsoap.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2017
42thepharmacychannel.orgMesh Digital Limited16 Aug 20149 Aug 201616 Aug 2017
43thepharmamom.comWild West Domains, LLC30 Aug 201430 Jul 202530 Aug 2026
44thepharmacycafe.comDropCatch.com 1494 LLC30 Nov 201830 Nov 201830 Nov 2019
45thepharmacistsolution.comGandi SAS15 Sep 201415 Sep 202515 Sep 2026
46thepharmacyaffiliate.comName.com, Inc.24 Sep 202524 Sep 202524 Sep 2026
47thepharmacyplus.comGoDaddy.com, LLC27 Nov 202328 Nov 202527 Nov 2026
48thepharmacynoda.comGoDaddy.com, LLC2 Oct 20143 Oct 20252 Oct 2026
49thepharmapartner.comGoDaddy.com, LLC25 May 202525 May 202525 May 2026
50thepharmacistsguide.comTucows Domains Inc.30 Sep 201425 Jan 202630 Sep 2026
51thepharmacy1.comGoDaddy.com, LLC21 Jun 202530 Jun 202521 Jun 2026
52thepharmaceuticalcare.comBigRock Solutions Ltd.24 Nov 201424 Nov 201424 Nov 2015
53thepharmaweb.comNominalia Internet S.L.14 Oct 201424 Sep 201614 Oct 2017
54thepharmacist.usGoDaddy.com, LLC1 Dec 20146 Dec 201730 Nov 2018
55thepharmacist.netGoDaddy.com, LLC4 Jul 20235 Jul 20254 Jul 2026
56thepharmacymart.comTucows Domains Inc.30 Nov 20134 Dec 201430 Nov 2015
57thepharmaspark.comDreamHost, LLC6 Dec 20148 Dec 20166 Dec 2017
58thepharmacyquality.comNamesilo, LLC6 Dec 20146 Dec 20146 Dec 2015
59thepharmacyportal.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…15 Dec 202013 Jan 202415 Dec 2024
60thepharmacity.comGKG.NET, INC.5 Mar 202213 Oct 20245 Mar 2026
61thepharmacykiosk.comRebel.com Corp.28 Dec 201428 Dec 201428 Dec 2015
62thepharmacyreview.orgDynadot, LLC28 Dec 201412 Oct 201528 Dec 2015
63thepharmacyonthesquare.comGoDaddy.com, LLC2 Jan 20152 Jan 20152 Jan 2016
64thepharmaacademy.associatesEasyspace LTD23 Jul 201423 Jul 201423 Jul 2015
65thepharmacist.socialKey-Systems, LLC4 Jun 201416 Oct 20144 Jun 2015
66thepharmacy.nycGoDaddy.com, LLC18 Oct 201724 Oct 202518 Oct 2026
67thepharmacy.expertNetwork Solutions, LLC21 Dec 201421 Dec 201421 Dec 2015
68thepharmacist.websiteNameCheap, Inc.21 Dec 201421 Dec 201421 Dec 2015
69thepharmacy.vetGoDaddy.com, LLC25 Dec 20148 Feb 201725 Dec 2017
70thepharmacy.xyz-28 Aug 202220 Oct 202528 Aug 2026
71thepharmacy-rx.comNameCheap, Inc.6 Jan 20157 Jan 20266 Jan 2027
72thepharmaportal.comHostinger, UAB5 Aug 20255 Aug 20255 Aug 2026
73thepharmacytechniciancertification.comSun Tzu 888, LLC21 Jan 201521 Jan 201521 Jan 2016
74thepharmaportal.orgMesh Digital Limited20 Jan 201513 Jan 201720 Jan 2019
75thepharmaportal.netWebfusion Ltd.20 Jan 201513 Jan 201720 Jan 2019
76thepharmaclub.comNameCheap, Inc.21 Mar 202521 Mar 202521 Mar 2026
77thepharmacyatlakeoconee.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jan 201523 Jan 201523 Jan 2016
78thepharmapress.comBeijing Lanhai Jiye Technology Co., Ltd30 Jul 20231 Oct 202430 Jul 2024
79thepharmaworld.comNamesilo, LLC2 Jul 20256 Aug 20252 Jul 2026
80thepharmacyforum.comAmazon Registrar, Inc.3 Jul 201729 May 20253 Jul 2026
81thepharmacistmovie.comTucows Domains Inc.2 Feb 20086 Feb 20152 Feb 2016
82thepharmacytechnicianguide.comeNom, Inc.13 Feb 201513 Feb 201513 Feb 2016
83thepharmaceuticalsales.comGoDaddy.com, LLC12 Feb 201512 Feb 201512 Feb 2016
84thepharmacyshoponline.comNetlynx Inc.26 Feb 201526 Feb 201526 Feb 2016
85thepharmacyandfountainatthephoenix.comFastDomain Inc.26 Feb 201526 Feb 201526 Feb 2016
86thepharmacydepot.comNordreg AB9 Oct 20258 Dec 20259 Oct 2026
87thepharmaset.comNameCheap, Inc.24 Aug 201527 Aug 202524 Aug 2026
88thepharmacy.usTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…4 Jul 20235 Jul 20244 Jul 2024
89thepharmacyofjohnstithpemberton.comGoDaddy.com, LLC18 Mar 201518 Mar 201518 Mar 2016
90thepharmacyatchenalcurve.comGoDaddy.com, LLC21 Mar 201521 Mar 201521 Mar 2017
91thepharmacistconsultant.comGoDaddy.com, LLC28 Oct 201828 Oct 201828 Oct 2019
92thepharmacynm.comGoDaddy.com, LLC24 Mar 201524 Mar 201524 Mar 2017
93thepharmacytime.comNamesilo, LLC16 Jul 202117 Jul 202116 Jul 2022
94thepharmacypeople.orgPDR Ltd. d/b/a PublicDomainRegistry.com25 Mar 201525 Mar 201525 Mar 2016
95thepharmacypeople.netBigRock Solutions Ltd.25 Mar 201525 Mar 201525 Mar 2016
96thepharmacynewsletter.comFastDomain Inc.14 Aug 201930 Jul 202514 Aug 2026
97thepharmaz.comGoDaddy.com, LLC4 Apr 20158 Apr 20254 Apr 2026
98thepharmasolutions.comGoDaddy.com, LLC15 Sep 202310 Dec 202315 Sep 2026
99thepharmaman.comGoDaddy.com, LLC10 Aug 202510 Aug 202510 Aug 2028
100thepharmacy.onlinePapaki Ltd.28 Apr 202025 Apr 202428 Apr 2026
101thepharmacodex.comGoogle, Inc.29 Aug 201515 Aug 202529 Aug 2026
102thepharmall.comKey-Systems GmbH3 Sep 201528 Nov 20253 Sep 2026
103thepharmacywebsiteco.comWebfusion Ltd.3 Sep 20153 Sep 20153 Sep 2017
104thepharmacyatwellington.usGoDaddy.com, LLC3 Sep 20153 Sep 20162 Sep 2017
105thepharmacyatwellington.orgGoDaddy.com, LLC3 Sep 201518 Oct 20253 Sep 2026
106thepharmacyatwellington.netGoDaddy.com, LLC3 Sep 20154 Aug 20258 Feb 2027
107thepharmaclothing.comCV. Rumahweb Indonesia29 Nov 2017-29 Nov 2018
108thepharmaceuticallist.com1&1 Internet AG10 Apr 201511 Apr 201710 Apr 2018
109thepharmafactory.comDomeneshop AS dba domainnameshop.com5 Sep 201510 Feb 20265 Sep 2026
110thepharmageddon.comGoDaddy.com, LLC17 Apr 201517 Apr 201517 Apr 2016
111thepharmarelief.comTucows Domains Inc.22 Apr 201526 Apr 201722 Apr 2017
112thepharmaone.comDreamHost, LLC22 Apr 201524 Jun 201622 Apr 2018
113thepharmacyshoplex.comNamesilo, LLC22 Apr 201523 Apr 202522 Apr 2026
114thepharmacypage.comNetEarth One Inc. d/b/a NetEarth27 Apr 201527 Apr 201527 Apr 2016
115thepharmacology.comTurnCommerce, Inc. DBA NameBright.com14 Jul 20178 Jul 202014 Jul 2026
116thepharmacysavingscard.comGoDaddy.com, LLC30 Apr 201530 Apr 201530 Apr 2016
117thepharmacylittlerock.comGoDaddy.com, LLC5 May 20154 Aug 20258 Feb 2027
118thepharmacyatwellingtonhills.comGoDaddy.com, LLC5 May 20154 Feb 20238 Feb 2027
119thepharmacyatwellington.comGoDaddy.com, LLC5 May 201515 Jul 20258 Feb 2027
120thepharmacyreview.comNameCheap, Inc.6 Mar 20236 Mar 20266 Mar 2027
121thepharmacyaccountants.comGoDaddy.com, LLC7 May 20157 May 20157 May 2020
122thepharmacytattoos.comGoDaddy.com, LLC11 May 201511 May 201511 May 2017
123thepharmacytattoos.orgGoDaddy.com, LLC11 May 201511 May 201511 May 2016
124thepharmacytattoos.netGoDaddy.com, LLC11 May 201511 May 201511 May 2016
125thepharmacytattoos.infoGoDaddy.com, LLC11 May 2015-11 May 2016
126thepharmadrugstore.comKey-Systems GmbH1 Aug 20162 Jun 20251 Aug 2026
127thepharmaclinic.comGoDaddy.com, LLC30 Nov 20201 Dec 202530 Nov 2026
128thepharmacyshop.netMat Bao Trading & Service Company Limited d/b/a Ma…21 Jul 20237 Jul 202521 Jul 2026
129thepharmacistmom.comNetwork Solutions, LLC9 Oct 202422 Dec 20259 Oct 2025
130thepharmacyhealthtablets.comGoDaddy.com, LLC21 May 201521 May 201521 May 2016
131thepharmacywebshop.comWebfusion Ltd.28 May 201521 May 201728 May 2018
132thepharmacyatuptown.comName.com, Inc.15 Sep 201515 Sep 201515 Sep 2016
133thepharmacytechnicianjobs.comGMO Internet Inc.30 May 201510 Jul 201729 May 2017
134thepharmacytowncenter.com1&1 Internet AG30 May 201512 Apr 201830 May 2026
135thepharmacypatricksquare.com1&1 Internet AG30 May 201531 May 202530 May 2026
136thepharmacyclemson.com1&1 Internet AG30 May 201531 May 202530 May 2026
137thepharmacy-patricksquare.com1&1 Internet AG30 May 201512 Apr 201830 May 2026
138thepharmacy-clemson.com1&1 Internet AG30 May 201512 Apr 201830 May 2026
139thepharmacygrid.comGoDaddy.com, LLC3 Jun 20153 Jun 20153 Jun 2017
140thepharmagency.netPDR Ltd. d/b/a PublicDomainRegistry.com2 Jun 201514 Aug 20252 Jun 2025
141thepharmacytimes.com1&1 Internet AG9 Jun 201521 Oct 20249 Jun 2026
142thepharmacymall.comGoDaddy.com, LLC16 Jan 202327 Jan 202616 Jan 2027
143thepharmacareercompass.com1&1 Internet AG18 Sep 201518 Sep 201518 Sep 2016
144thepharmacysource.comBeijing Lanhai Jiye Technology Co., Ltd29 Aug 20259 Mar 202629 Aug 2026
145thepharmalist.comGoogle, Inc.18 Jun 20153 Jun 202518 Jun 2026
146thepharmacistlist.comGoogle, Inc.18 Jun 20153 Jun 202518 Jun 2026
147thepharmacyplace.comeNom, Inc.22 Sep 201515 Jan 202622 Sep 2026
148thepharmatimes.comGoDaddy.com, LLC6 Oct 202120 Sep 20256 Oct 2027
149thepharmaceuticalconference.orgNamesilo, LLC23 Sep 20156 Apr 201723 Sep 2017
150thepharmacopia.comGoDaddy.com, LLC14 Jul 201514 Jul 201514 Jul 2016
151thepharmasolution.comGoDaddy.com, LLC1 Dec 202413 Dec 20251 Dec 2026
152thepharmacyexpress.netCJSC Registrar R0115 Jul 20158 Jul 202515 Jul 2026
153thepharmasolution.infoGoDaddy.com, LLC16 Jul 2015-16 Jul 2016
154thepharmacyconsultants.comGoDaddy.com, LLC17 Jul 201513 Aug 202428 Aug 2026
155thepharmacyatwestlandmapledrugs.comGoDaddy.com, LLC27 Jul 201728 Jul 202527 Jul 2026
156thepharmacystudent.comWix.com Ltd.24 Sep 20234 Nov 202524 Sep 2025
157thepharmacyservice.com-20 Jul 201520 Jul 201520 Jul 2017
158thepharmacyclub.comGoDaddy.com, LLC21 Jul 201528 Jan 202621 Jul 2026
159thepharmacyclub.bizGoDaddy.com, LLC21 Jul 201521 Jul 201520 Jul 2016
160thepharmadispatch.com-3 Mar 20223 Mar 20223 Mar 2023
161thepharmacyclub.usGoDaddy.com, LLC21 Jul 201521 Jul 201520 Jul 2017
162thepharmacyclub.orgGoDaddy.com, LLC21 Jul 201521 Jul 201521 Jul 2016
163thepharmacyclub.netGoDaddy.com, LLC21 Jul 201521 Jul 201521 Jul 2016
164thepharmacyclub.infoGoDaddy.com, LLC21 Jul 2015-21 Jul 2016
165thepharmacyone-24h.comCJSC Registrar R0124 Jul 201518 Oct 201724 Jul 2018
166thepharmadirectory.comPheenix, Inc.29 Jul 201523 Jul 201729 Jul 2018
167thepharmacyblueprint.comGoDaddy.com, LLC30 Jul 201530 Jul 202530 Jul 2027
168thepharmacyrecords.comName.com, Inc.7 Aug 20157 Aug 20157 Aug 2016
169thepharmabrands.comGoDaddy.com, LLC10 Sep 202510 Sep 202510 Sep 2026
170thepharmacyphotography.comregister.com, Inc.14 Oct 201529 Sep 201614 Oct 2017
171thepharmacoreport.neteNom, Inc.20 Oct 201520 Oct 201520 Oct 2016
172thepharmacoreport.infoNameCheap, Inc.20 Oct 201520 Oct 201520 Oct 2016
173thepharmacoreport.comDropCatch.com 693 LLC7 Jan 201716 Feb 20187 Jan 2019
174thepharmacoreport.orgeNom, Inc.20 Oct 201520 Oct 201520 Oct 2016
175thepharmareview.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Oct 201525 Oct 201525 Oct 2016
176thepharmacyacademy.comCSC Corporate Domains, Inc.7 Dec 20173 Dec 20257 Dec 2026
177thepharmabilling.comGoDaddy.com, LLC27 Oct 201527 Oct 201527 Oct 2017
178thepharmacycard.bizGoDaddy.com, LLC20 Nov 201531 Dec 202519 Nov 2025
179thepharmacyonerx.comNICENIC INTERNATIONAL GROUP CO., LIMITED30 Jun 20219 Sep 202430 Jun 2024
180thepharmacup.comTucows Domains Inc.25 Nov 201129 Nov 201525 Nov 2016
181thepharmacyondemand.comGoDaddy.com, LLC19 Feb 202120 Feb 202619 Feb 2027
182thepharmafist.comBeijing Lanhai Jiye Technology Co., Ltd27 Feb 202511 Mar 202627 Feb 2027
183thepharmacysonomacounty.comGoDaddy.com, LLC16 Dec 201528 Dec 202516 Dec 2026
184thepharmacyone24.netCJSC Registrar R0125 Dec 201525 Dec 201525 Dec 2016
185thepharmacyapp.comGoogle, Inc.19 Aug 202219 Oct 202419 Aug 2024
186thepharmacy.coachNamesilo, LLC1 Jan 20161 Jan 20161 Jan 2017
187thepharmacistlife.comNameCheap, Inc.6 Jan 201619 Feb 20266 Jan 2027
188thepharmacy.proGoDaddy.com, LLC12 Sep 202327 Oct 202512 Sep 2026
189thepharmacyamerica.comRegister.it SPA13 Jan 201613 Jan 201613 Jan 2017
190thepharmacistclinic.comTucows Domains Inc.1 Sep 202420 Aug 20251 Sep 2026
191thepharmacysonomacounty.orgGoDaddy.com, LLC17 Jan 201629 Jan 202617 Jan 2027
192thepharmacysonomacounty.netGoDaddy.com, LLC17 Jan 201629 Jan 202617 Jan 2027
193thepharmacysonomacounty.infoGoDaddy.com, LLC17 Jan 201629 Jan 202617 Jan 2027
194thepharmaplus.com-14 Apr 202214 Apr 202314 Apr 2024
195thepharmasynergy.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Jan 20167 Feb 202626 Jan 2027
196thepharmacybar.comGoDaddy.com, LLC26 Jan 201626 Jan 201626 Jan 2018
197thepharmacyconference.com1&1 Internet AG28 Feb 200810 Oct 202528 Feb 2027
198thepharmacyinsider.comGoDaddy.com, LLC7 Jun 202019 Aug 20257 Jun 2025
199thepharmacychannel.comTurnCommerce, Inc. DBA NameBright.com31 Jan 201612 Mar 202531 Jan 2025
200thepharmacy.infoPapaki Ltd.28 Apr 20207 Nov 2025-
201thepharmashop.com-14 Jul 20245 Aug 202514 Jul 2026
202thepharmacistweb.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…1 Aug 202217 Aug 20231 Aug 2023
203thepharmacyone-rx.comEpik Inc.19 Jul 202230 Aug 202319 Jul 2023
204thepharmacyphilly.orgWild West Domains, LLC15 Jul 201419 Jun 202515 Jul 2027
205thepharmacy.vinKey-Systems, LLC27 Feb 201629 Sep 201727 Feb 2018
206thepharmacy.wineKey-Systems, LLC27 Feb 201627 Feb 201627 Feb 2017
207thepharmacistandyou.orgNetwork Solutions, LLC26 Feb 201624 Feb 201726 Feb 2018
208thepharmacompany.cloudGoDaddy.com, LLC29 Feb 201615 Feb 201728 Feb 2018
209thepharmaco.cloudGoDaddy.com, LLC29 Feb 201615 Feb 201728 Feb 2018
210thepharmagroup.orgregister.com, Inc.1 Mar 2016-1 Mar 2017
211thepharmacistdesk.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Mar 201630 Mar 20176 Mar 2018
212thepharmaknight.comFastDomain Inc.6 Mar 20166 Mar 20176 Mar 2018
213thepharmacygrp.comGo Canada Domains, LLC8 Mar 20168 Mar 20168 Mar 2017
214thepharmassists.comNameCheap, Inc.14 Mar 201612 Feb 202514 Mar 2026
215thepharmacyseattle.comFastDomain Inc.27 May 20144 Jun 202527 May 2026
216thepharmacysonomaco.infoGoDaddy.com, LLC17 Mar 20161 May 202517 Mar 2026
217thepharmacysonomaco.orgGoDaddy.com, LLC17 Mar 20161 May 202517 Mar 2026
218thepharmacysonomaco.netGoDaddy.com, LLC17 Mar 201618 Mar 202517 Mar 2026
219thepharmacysonomaco.comGoDaddy.com, LLC17 Mar 201618 Mar 202517 Mar 2026
220thepharmacompoundia.comDropCatch.com 398 LLC18 Mar 201619 Mar 201718 Mar 2018
221thepharmacylawblog.comDomain.com, LLC25 Mar 201625 Mar 201625 Mar 2019
222thepharmacycorner.comFastDomain Inc.5 Apr 20165 Apr 20175 Apr 2018
223thepharmajobboard.comDNC Holdings, Inc.10 Nov 202026 Sep 202510 Nov 2026
224thepharmacyrx.orgWild West Domains, LLC14 Apr 201629 May 202514 Apr 2026
225thepharmacyrx.netWild West Domains, LLC14 Apr 201615 Apr 202514 Apr 2026
226thepharmacyrx.comWild West Domains, LLC14 Apr 201615 Apr 202514 Apr 2026
227thepharmacypros.comGoDaddy.com, LLC26 Jan 202526 Jan 202526 Jan 2027
228thepharmacistisin.comTucows Domains Inc.22 Aug 20187 Aug 202522 Aug 2026
229thepharmacie.netGoDaddy.com, LLC4 May 20164 May 20164 May 2017
230thepharmadeal.com-15 May 201615 May 201615 May 2017
231thepharmastudio.comFree Spirit Domains, LLC5 Aug 202218 Sep 20235 Aug 2023
232thepharmasalesapp.comGoDaddy.com, LLC20 May 201620 May 201620 May 2017
233thepharmac.istGoDaddy.com, LLC10 May 201610 May 201610 May 2017
234thepharmacistjobs.comGoDaddy.com, LLC15 Jan 202216 Jan 202615 Jan 2027
235thepharmacynashville.comGoDaddy.com, LLC23 Jun 20119 Sep 202223 Jun 2031
236thepharmacystores.comGoDaddy.com, LLC27 Dec 201110 Apr 20259 Apr 2026
237thepharmacysupplier.com1&1 Internet AG6 Jun 20167 Jun 20186 Jun 2019
238thepharmacistsclinic.comGoDaddy.com, LLC7 Jun 20167 Jun 20167 Jun 2017
239thepharmacysage.comGoDaddy.com, LLC6 Apr 20206 Apr 20206 Apr 2021
240thepharmacykitsilano.comGMO Internet Inc.14 Sep 2021-14 Sep 2022
241thepharmacyexpress.bizDynadot, LLC3 Feb 20233 Feb 20243 Feb 2024
242thepharmacy-media.comGoDaddy.com, LLC20 May 20221 Jul 202320 May 2023
243thepharmacy.org-3 Dec 201831 Dec 20253 Dec 2026
244thepharmacy.storeGoDaddy.com, LLC9 May 202524 Jun 20259 May 2026
245thepharmacistguide.comTucows Domains Inc.11 Jul 201615 Jul 201811 Jul 2018
246thepharmaseeds.comGoDaddy.com, LLC12 Jul 201612 Jul 201612 Jul 2017
247thepharmacy.guruEasyspace LTD6 Feb 201412 Jan 20206 Feb 2021
248thepharmacytree.comTucows Domains Inc.15 Jul 201625 Aug 202415 Jul 2024
249thepharmacy.linkUniregistrar Corp12 Jun 201412 Jul 201612 Jun 2017
250thepharmatrain.bizMesh Digital Limited25 Nov 20097 Jan 202424 Nov 2023
251thepharmacist.biz1&1 Internet AG21 Sep 20105 Nov 202520 Sep 2026
252thepharmacyamericatrusts.bizCSC Corporate Domains, Inc.4 Oct 20017 Nov 20256 Nov 2026
253thepharmacologist.comGoDaddy.com, LLC5 Mar 20145 Mar 20265 Mar 2027
254thepharmaxpress.comGood Domain Registry Pvt Ltd.23 Jul 20167 Aug 201723 Jul 2018
255thepharmacyband.comNameKing.com Inc.28 Dec 202010 Feb 202528 Dec 2024
256thepharmacyphiladelphia.neteNom, Inc.25 Jul 201611 Jul 201725 Jul 2018
257thepharmacyatl.com-27 Jul 201627 Jul 201627 Jul 2017
258thepharmastore.comDropCatch.com 1317 LLC2 Jan 20227 Sep 20252 Jan 2027
259thepharmacytop.comEuroDNS S.A.5 Aug 201620 Dec 20164 Aug 2017
260thepharmacistalabama.comInterweb Advertising D.B.A. Profile Builder20 Jun 201720 Jun 201720 Jun 2018
261thepharmacist.spaceHostinger, UAB27 Aug 20251 Sep 202527 Aug 2026
262thepharmajourney.comAscio Technologies, Inc. Danmark - Filial af Ascio…17 Jul 201216 Sep 202317 Jul 2023
263thepharmacycafedelivered.comeNom, Inc.8 Sep 201621 Oct 20178 Sep 2017
264thepharmacylawexpert.comGoDaddy.com, LLC8 Sep 201629 Sep 20228 Sep 2026
265thepharmacygirl.comFastDomain Inc.13 Sep 201613 Sep 201713 Sep 2018
266thepharmacycentre.comWebfusion Ltd.1 Jul 20083 Jul 20231 Jul 2033
267thepharmamag.comNameCheap, Inc.29 Sep 201630 Sep 202529 Sep 2026
268thepharmacypr.com-1 Oct 20161 Oct 20161 Oct 2017
269thepharmacyshow.com1&1 Internet AG20 Jan 200610 Oct 202520 Jan 2027
270thepharmacompany.comDropCatch.com 928 LLC31 Dec 20256 Mar 202631 Dec 2026
271thepharmacistguy.comGoDaddy.com, LLC14 Dec 201014 Dec 202514 Dec 2026
272thepharmacistadvisor.comCSC Corporate Domains, Inc.3 Dec 200829 Nov 20253 Dec 2026
273thepharmajobsite.com1&1 Internet AG7 Jul 20088 Jul 20167 Jul 2017
274thepharmacistsletter.comWild West Domains, LLC7 Apr 20078 Apr 20247 Apr 2026
275thepharmacom.comTucows Domains Inc.18 Jan 202417 Jan 202618 Jan 2027
276thepharmacystudio.comDeluxe Small Business Sales, Inc. d/b/a Aplus.net22 Feb 200722 Feb 202622 Feb 2027
277thepharmafrontier.comKey-Systems GmbH10 Nov 200428 Nov 202510 Nov 2026
278thepharmaceuticaltriallawyersassociation.comeNom, Inc.7 Oct 200912 Sep 20177 Oct 2018
279thepharmacyclinic.comGoDaddy.com, LLC22 May 202023 May 202522 May 2026
280thepharmacypc.com1&1 Internet AG30 Jun 20111 Jul 201630 Jun 2017
281thepharmafactsblog.comGoDaddy.com, LLC27 Aug 201028 Aug 201627 Aug 2017
282thepharmacistswife.comGoDaddy.com, LLC1 Oct 20131 Oct 20131 Oct 2018
283thepharmadoctor.comGoDaddy.com, LLC25 Feb 201426 Feb 201625 Feb 2017
284thepharmacistlawyer.comGoDaddy.com, LLC4 Mar 20146 Mar 20264 Mar 2027
285thepharmacyatlbh.comNetwork Solutions, LLC14 Jul 201015 May 202414 Jul 2026
286thepharmacologyweekly.comWild West Domains, LLC7 Feb 200822 Feb 20257 Feb 2026
287thepharmacystore.comGoDaddy.com, LLC21 Jun 200418 Jun 202521 Jun 2026
288thepharmacyline.comFastDomain Inc.4 Apr 20134 Apr 20174 Apr 2018
289thepharmatrain.comMesh Digital Limited25 Nov 200923 Nov 201525 Nov 2017
290thepharmacycongress.comWild West Domains, LLC20 Jun 201119 Jun 202520 Jun 2027
291thepharmapartners.comGoDaddy.com, LLC15 Jan 201427 Jan 202615 Jan 2027
292thepharmacybydre.comGoDaddy.com, LLC5 Jun 20146 Jun 20165 Jun 2018
293thepharma360.comSafeNames Ltd.9 Mar 20111 Apr 20249 Mar 2026
294thepharmacynavigator.comNameCheap, Inc.20 Aug 20255 Sep 202520 Aug 2026
295thepharmacynetwork.comGoDaddy.com, LLC5 Jan 20056 Jan 20255 Jan 2027
296thepharmacie.comGoDaddy.com, LLC19 Aug 202519 Aug 202519 Aug 2026
297thepharmaceuticals.comTurnCommerce, Inc. DBA NameBright.com9 Jun 200310 Jun 20259 Jun 2026
298thepharmaservices.comGoDaddy.com, LLC10 Jan 201412 Jan 202610 Jan 2027
299thepharmacytechnician.comGoDaddy.com, LLC31 Oct 200728 Jan 202631 Oct 2026
300thepharmareport.comGoDaddy.com, LLC26 Aug 201327 Aug 202526 Aug 2026
301thepharmasalesnetwork.comGoDaddy.com, LLC30 Sep 20081 Oct 202430 Sep 2026
302thepharmacy-doctor.comWebfusion Ltd.7 Aug 200931 Jul 20167 Aug 2017
303thepharmacyadvisor.comCSC Corporate Domains, Inc.6 Jan 20092 Jan 20266 Jan 2027
304thepharmacistadviser.comCSC Corporate Domains, Inc.3 Dec 200829 Nov 20253 Dec 2026
305thepharmacyjc.comNameKing.com Inc.29 Mar 202212 May 202529 Mar 2025
306thepharmacyplacerx.comDreamHost, LLC16 Apr 201315 Apr 201816 Apr 2020
307thepharmacists.comGoDaddy.com, LLC6 Jul 200316 Jun 20256 Jul 2026
308thepharmacistandyou.comLaunchpad, Inc.3 Apr 201419 Mar 20173 Apr 2018
309thepharmaceuticalillusion.com1&1 Internet AG23 Jun 201224 Jun 201623 Jun 2018
310thepharmadvertising.comGoDaddy.com, LLC15 Jul 201416 Jul 201615 Jul 2017
311thepharmacyloan.comGoDaddy.com, LLC4 Apr 20035 Apr 20154 Apr 2017
312thepharmacy4urewards.comHiChina Zhicheng Technology Limited14 Nov 201814 Nov 201814 Nov 2019
313thepharmacyfair.comGoDaddy.com, LLC12 Nov 200523 Nov 201512 Nov 2016
314thepharmacybrand.comIHS Telekom, Inc.13 May 202413 Jul 202413 May 2029
315thepharmacyexpo.comWebfusion Ltd.23 May 201417 May 201623 May 2017
316thepharmacyoutlet.comNamesilo, LLC29 Jul 20049 Aug 202516 Sep 2026
317thepharmacyofthefuture.comNameCheap, Inc.29 Aug 20126 Jan 202629 Aug 2027
318thepharmachannel.comGoDaddy.com, LLC7 Sep 200318 Aug 20257 Sep 2026
319thepharmaceutical.comTurnCommerce, Inc. DBA NameBright.com28 Oct 200915 Jan 202028 Oct 2026
320thepharmainsider.comGoDaddy.com, LLC19 Jul 200420 Jul 201619 Jul 2019
321thepharmacynet.comRebel.com Corp.17 Jun 201026 Sep 201717 Jun 2018
322thepharmacyrecruiter.comGoDaddy.com, LLC16 Oct 200317 Oct 202516 Oct 2026
323thepharmacistletter.comWild West Domains, LLC7 Jul 20148 Jul 20257 Jul 2027
324thepharmacyonlineshop.comregister.com, Inc.13 May 201228 Nov 201213 May 2013
325thepharmacycanadian.comRebel.com Corp.6 May 200826 Sep 20176 May 2018
326thepharmacistschoice.comGoDaddy.com, LLC20 Jan 200721 Jan 202620 Jan 2028
327thepharmacyyellowpages.comGoDaddy.com, LLC30 Apr 200313 Apr 201520 Dec 2016
328thepharmacysaver.comGoDaddy.com, LLC30 Apr 20141 May 202530 Apr 2026
329thepharmacycollection.comGoDaddy.com, LLC11 Aug 202411 Aug 202411 Aug 2027
330thepharmacy4u.comGoDaddy.com, LLC19 Feb 200716 Feb 202619 Feb 2027
331thepharmacieshoppe.comGoDaddy.com, LLC28 Dec 20122 Dec 202528 Dec 2028
332thepharmacydesigner.comGoDaddy.com, LLC12 Aug 201313 Aug 201612 Aug 2017
333thepharmaceuticalworld.com1&1 Internet AG9 Jan 200510 Jan 20179 Jan 2018
334thepharmaboutique.comGoDaddy.com, LLC2 Mar 201129 Nov 201215 Jan 2018
335thepharmawatchdog.com1&1 Internet AG13 Apr 201112 Apr 201813 Apr 2026
336thepharmacyconsultancy.comRegister.it SPA18 Mar 201019 Mar 202218 Mar 2032
337thepharmacybrokerage.comGoDaddy.com, LLC4 Mar 20055 Mar 20254 Mar 2027
338thepharmacyhut.comAnnulet LLC12 Feb 201725 Dec 201712 Feb 2019
339thepharmacygroup.comGoDaddy.com, LLC25 May 20119 Sep 202217 Apr 2026
340thepharmacyguide.comTurnCommerce, Inc. DBA NameBright.com7 Jan 201212 Feb 20257 Jan 2027
341thepharmacyblog.comHostinger, UAB31 May 202531 May 202531 May 2026
342thepharmacist.comGoDaddy.com, LLC1 Jul 200122 Mar 20251 Jul 2026
343thepharmacydoc.com1&1 Internet AG18 Feb 202618 Feb 202618 Feb 2027
344thepharmacistblog.comFastDomain Inc.28 Jan 20144 Jan 202428 Jan 2027
345thepharmacygiftshop.comGoDaddy.com, LLC27 Nov 200625 Nov 201427 Nov 2016
346thepharmasummit.comNom-iq Ltd. dba COM LAUDE26 Nov 200822 Nov 202526 Nov 2026
347thepharmapreneur.comRealtime Register B.V.1 Dec 20235 Nov 20251 Dec 2027
348thepharmacistdigital.comGoDaddy.com, LLC18 Oct 200719 Oct 201518 Oct 2016
349thepharmacistnetwork.comregister.com, Inc.30 Jul 200831 Jul 202530 Jul 2026
350thepharmafinder.comGoDaddy.com, LLC12 Jan 201113 Jan 202612 Jan 2027
351thepharmaco.comGoDaddy.com, LLC27 Oct 202427 Oct 202527 Oct 2026
352thepharmanetwork.comGoDaddy.com, LLC28 Feb 20001 Mar 202628 Feb 2027
353thepharmalistos.comGoDaddy.com, LLC18 Aug 201118 Aug 201618 Aug 2017
354thepharmacistsbridge.comGoDaddy.com, LLC30 Jan 200715 Apr 201530 Jan 2017
355thepharmacybottlestore.comWild West Domains, LLC15 Sep 200916 Sep 202515 Sep 2026
356thepharmaspace.comFastDomain Inc.27 Jun 202127 Jul 202527 Jun 2026
357thepharmacistwillseeyounow.comNameCheap, Inc.12 Nov 202113 Oct 202512 Nov 2026
358thepharmacypractice.comGoDaddy.com, LLC1 Oct 202112 Nov 20241 Oct 2024
359thepharmawall.comGoDaddy.com, LLC18 Mar 20119 Dec 20154 Nov 2017
360thepharmatherapist.comGoDaddy.com, LLC16 Jan 200916 Jan 202616 Jan 2027
361thepharmapulse.comEnom World, Inc.5 May 20259 May 20255 May 2026
362thepharmafactor.comRealtime Register B.V.6 Nov 200818 Jan 20266 Nov 2025
363thepharmamarketing.comChengdu West Dimension Digital Technology Co., Ltd…30 Dec 201930 Dec 201930 Dec 2020
364thepharmamonthly.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Oct 20134 Oct 20164 Oct 2016
365thepharmacopeia.com-27 Jul 202516 Feb 202627 Jul 2026
366thepharmacypeople.comNetwork Solutions, LLC16 Apr 20083 Apr 202516 Apr 2026
367thepharmaceuticalrecruiter.comGoDaddy.com, LLC2 Mar 200514 Mar 20162 Mar 2017
368thepharmagroup.comGoDaddy.com, LLC11 May 200218 Dec 202511 May 2027
369thepharmacistrecruiter.comLaunchpad, Inc.14 Feb 201829 Apr 202514 Feb 2025
370thepharmacybgm.comTucows Domains Inc.1 Jul 20145 Jul 20171 Jul 2017
371thepharmacyletter.comWild West Domains, LLC16 May 200217 May 202416 May 2026
372thepharmassistant.comGoDaddy.com, LLC28 Apr 20219 Jun 202528 Apr 2025
373thepharmaguide.comRealtime Register B.V.9 Jan 20269 Jan 20269 Jan 2027
374thepharmacyowner.comGoDaddy.com, LLC4 Jan 20144 Jan 20164 Jan 2017
375thepharmacistslink.comGoDaddy.com, LLC30 Jan 200715 Apr 201530 Jan 2017
376thepharmacyretailclinicnews.comGoDaddy.com, LLC23 Jul 20146 Aug 202523 Jul 2026
377thepharmacydesigngroup.comGoDaddy.com, LLC21 Jan 200530 Jan 202621 Jan 2028
378thepharmacyworks.com1&1 Internet AG7 Jun 20128 Jun 20167 Jun 2018
379thepharmacia.comGoDaddy.com, LLC21 Jul 20128 Aug 202321 Jul 2026
380thepharmacycenter.comDropCatch.com 705 LLC1 Jan 20264 Jan 20261 Jan 2027
381thepharmajournal.comGoDaddy.com, LLC10 Jun 20111 Jul 202310 Jun 2029
382thepharmagateway.comBeijing Lanhai Jiye Technology Co., Ltd11 Mar 202313 May 202511 Mar 2025
383thepharmagrad.comGoDaddy.com, LLC1 Nov 201225 Oct 20151 Nov 2016
384thepharmapacker.comOnlineNIC, Inc.10 Jan 201910 Jan 201910 Jan 2020
385thepharmacymedia.comKey-Systems GmbH17 Oct 200628 Nov 202517 Oct 2026
386thepharmacyschool.comGoDaddy.com, LLC9 May 20139 May 20259 May 2027
387thepharmagrid.comGoDaddy.com, LLC10 Apr 201210 Apr 201210 Apr 2022
388thepharmacyprophets.comNetwork Solutions, LLC14 Jan 20135 Mar 201714 Jan 2018
389thepharmacistconnection.comGoDaddy.com, LLC25 Apr 200910 May 202525 Apr 2026
390thepharmacyltd.comGoDaddy.com, LLC12 May 201413 May 201612 May 2017
391thepharmaceuticalinvestor.comWebfusion Ltd.21 Apr 200914 Apr 201721 Apr 2019
392thepharmacygallery.comSquarespace Domains LLC2 Aug 201118 Jul 20252 Aug 2026
393thepharmaceuticalmyth.com1&1 Internet AG19 Jun 20126 Apr 202319 Jun 2026
394thepharmaceuticaljournal.comAmazon Registrar, Inc.24 Oct 201319 Sep 202524 Oct 2026
395thepharmacistdrugstore.com1&1 Internet AG7 Aug 20078 Aug 20167 Aug 2017
396thepharmaceuticalfactline.comGoDaddy.com, LLC14 May 200915 May 201614 May 2017
397thepharmacyorlando.comGoDaddy.com, LLC20 Jan 201321 Jan 202620 Jan 2027
398thepharmacyaffiliates.comeNom, Inc.1 Apr 200611 Jul 20161 Apr 2017
399thepharmacyalliance.comeNom, Inc.11 Sep 20071 Sep 201411 Sep 2020
400thepharmacistchoice.comGoDaddy.com, LLC17 Jun 202118 Jun 202517 Jun 2026
401thepharmacycanada.comRebel.com Corp.5 Sep 200826 Sep 20175 Sep 2018
402thepharmacydirectory.comeNom, Inc.1 Jan 20113 Dec 20171 Jan 2019
403thepharmassistonline.comWild West Domains, LLC16 Jun 201417 Jun 201616 Jun 2017
404thepharmassist.comTurnCommerce, Inc. DBA NameBright.com9 Dec 201011 Nov 20259 Dec 2026
405thepharmacistshub.comWild West Domains, LLC17 Oct 201118 Oct 201517 Oct 2017
406thepharmacistslife.comNetwork Solutions, LLC26 Apr 201226 Feb 202426 Apr 2027
407thepharmacistlink.comGoDaddy.com, LLC30 Jan 200715 Apr 201530 Jan 2017
408thepharmaceuticaldiversityinstitute.comGoDaddy.com, LLC6 Feb 200710 Feb 20256 Feb 2027
409thepharmacyconsultant.comGoDaddy.com, LLC3 Jun 20193 Jun 20253 Jun 2026
410thepharmacist-film.comDreamHost, LLC10 Sep 200910 Aug 202510 Sep 2026
411thepharmaacademy.comDynadot, LLC16 Jun 202524 Aug 202516 Jun 2026
412thepharmasutra.comNameCheap, Inc.5 Dec 20085 Nov 20255 Dec 2026
413thepharmacyfruit.comGoDaddy.com, LLC16 Sep 201117 Sep 201616 Sep 2017
414thepharmaceuticalwhistleblowers.comGoDaddy.com, LLC20 Sep 200921 Sep 202520 Sep 2026
415thepharmacistschannel.comGoDaddy.com, LLC20 Nov 200921 Nov 201520 Nov 2017
416thepharmaceuticalsalesnetwork.comGoDaddy.com, LLC30 Sep 20081 Oct 202430 Sep 2026
417thepharmacyauthority.comWild West Domains, LLC18 Oct 20241 Nov 202418 Oct 2027
418thepharmacistrecruiters.comGoDaddy.com, LLC30 Dec 202110 Feb 202530 Dec 2024
419thepharmacisttodayuk.comGoDaddy.com, LLC28 Jan 201429 Jan 201628 Jan 2018
420thepharmacistrx.comLaunchpad, Inc.17 Apr 20142 Apr 202517 Apr 2026
421thepharmacythatcares.comGoDaddy.com, LLC28 Nov 201228 Nov 201228 Nov 2017
422thepharmacyguy.comGoDaddy.com, LLC17 May 201218 May 202517 May 2026
423thepharmawire.comNetwork Solutions, LLC18 Jul 20079 Feb 201618 Jul 2017
424thepharmaceuticalmedicalprogramme.comPSI-USA, Inc. dba Domain Robot1 Apr 201116 Dec 202521 Nov 2026
425thepharmaceuticalsource.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Feb 202425 Feb 202525 Feb 2026
426thepharmacydigest.comGoDaddy.com, LLC23 Jul 200729 Nov 202528 Nov 2026
427thepharmacistattorney.comGoDaddy.com, LLC4 Mar 20146 Mar 20264 Mar 2027
428thepharmablog.comMarkMonitor Inc.10 Mar 20066 Feb 202510 Mar 2026
429thepharmacydiscount.comTurnCommerce, Inc. DBA NameBright.com13 Oct 202022 Nov 202413 Oct 2024
430thepharmacistshow.comGoDaddy.com, LLC16 Feb 202217 Feb 202616 Feb 2027
431thepharmacistbridge.comGoDaddy.com, LLC30 Jan 200715 Apr 201530 Jan 2017
432thepharmacy.comTierraNet Inc. d/b/a DomainDiscover1 Dec 20036 Apr 20251 Dec 2027
433thepharmacies.comTurnCommerce, Inc. DBA NameBright.com30 May 201115 Jan 202030 May 2026
434thepharmacy-northshire.comGoDaddy.com, LLC31 Dec 20071 Jan 201531 Dec 2016
435thepharmacopedia.comBeijing Lanhai Jiye Technology Co., Ltd13 Feb 202414 Feb 202613 Feb 2027
436thepharmacyco.comGoDaddy.com, LLC5 Jun 202017 Aug 20245 Jun 2024
437thepharmatrust.comGoDaddy.com, LLC9 Nov 200916 Sep 20259 Nov 2026
438thepharmacylawfirm.comNetEarth One Inc. d/b/a NetEarth13 Mar 201320 Oct 201713 Mar 2018
439thepharmacylink.comKey-Systems GmbH14 Nov 202428 Nov 202514 Nov 2026
440thepharmaindustry.comGoDaddy.com, LLC25 Aug 202026 Aug 202425 Aug 2026
441thepharmacyexpert.comNetwork Solutions, LLC21 Mar 20073 Apr 202421 Mar 2027
442thepharmaceuticalmyths.com1&1 Internet AG2 Jul 201212 Apr 20182 Jul 2026
443thepharmalawyer.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Jan 200913 Apr 202530 Jan 2025
444thepharmacyconnection.com-12 Jul 202413 Jul 202512 Jul 2026
445thepharmacogenomicsjournal.comCSC Corporate Domains, Inc.29 Nov 200025 Nov 202429 Nov 2026
446thepharmaseed.comGoDaddy.com, LLC11 Jan 201111 Jan 201611 Jan 2018
447thepharmaratings.comeNom, Inc.11 Jan 200813 Dec 201611 Jan 2018
448thepharmacybrands.comNetestate, LLC21 Jan 201122 Jan 201621 Jan 2017
449thepharmacyharlem.com1&1 Internet AG17 Oct 201717 Oct 201717 Oct 2018
450thepharmacyamericatrusts.comCSC Corporate Domains, Inc.13 Jul 20049 Jul 202513 Jul 2026
451thepharmacystation.comeNom, Inc.30 Jan 20096 Mar 201730 Jan 2018
452thepharmadepot.comFastDomain Inc.27 Jul 200824 Jul 202327 Jul 2026
453thepharmacystop.comGoDaddy.com, LLC22 Mar 201023 Mar 202522 Mar 2027
454thepharmacyprofessionals.comGoDaddy.com, LLC21 Nov 201026 Jan 202621 Nov 2026
455thepharmacysite.comTierraNet Inc. d/b/a DomainDiscover6 May 20104 May 20166 May 2017
456thepharmadoc.comGoDaddy.com, LLC31 Aug 202531 Aug 202531 Aug 2026
457thepharmasmarket.comFastDomain Inc.24 Aug 20128 Aug 201724 Aug 2018
458thepharmatree.comGoDaddy.com, LLC16 Dec 202116 Dec 202116 Dec 2022
459thepharmakon.comGoDaddy.com, LLC22 May 200623 May 202522 May 2027
460thepharmacyadviser.comCSC Corporate Domains, Inc.6 Jan 20092 Jan 20266 Jan 2027
461thepharmadvisor.comGoDaddy.com, LLC18 Apr 201218 Apr 201218 Apr 2017
462thepharmacyshop.comGoDaddy.com, LLC4 Jun 200729 May 20254 Jun 2026
463thepharmacistfilm.comTurnCommerce, Inc. DBA NameBright.com21 Apr 201715 Apr 202121 Apr 2026
464thepharmacistcorner.comGoDaddy.com, LLC31 May 200612 Jul 202431 May 2024
465thepharmacycard.comGoDaddy.com, LLC27 Nov 201313 Jan 202627 Nov 2026
466thepharmapatch.com-4 Oct 20164 Oct 20164 Oct 2017
467thepharmacywebsitecompany.comWebfusion Ltd.26 Jul 201319 Jul 201726 Jul 2018
468thepharmacy-one.com101domain, Inc.17 Mar 201421 Aug 201717 Mar 2018
469thepharmaguru.comGoDaddy.com, LLC9 Jul 202131 Jul 20259 Jul 2026
470thepharmaceuticalsalesnetwork.infoGoDaddy.com, LLC30 Sep 200814 Nov 202430 Sep 2026
471thepharmaresearch.info-5 Oct 20255 Oct 2025-
472thepharmasalesnetwork.infoGoDaddy.com, LLC30 Sep 200814 Nov 202430 Sep 2026
473thepharmacyexpert.infoNetwork Solutions, LLC8 Apr 201420 Jun 20258 Apr 2025
474thepharmatrust.infoGoDaddy.com, LLC11 Sep 201323 Sep 201611 Sep 2017
475thepharmacy-northshire.infoGoDaddy.com, LLC31 Dec 200715 Dec 201631 Dec 2017
476thepharmacist.infoGoDaddy.com, LLC23 Dec 201224 Dec 201623 Dec 2018
477thepharmacyretailclinicnews.infoGoDaddy.com, LLC23 Jul 20146 Aug 202523 Jul 2026
478thepharmacy-northshire.mobiGoDaddy.com, LLC31 Dec 20071 Jan 201531 Dec 2016
479thepharmacia.mobiGoDaddy.com, LLC21 Jul 20121 Oct 202421 Jul 2024
480thepharmacynetwork.netGoDaddy.com, LLC29 Aug 201929 Aug 201929 Aug 2020
481thepharmachemmonthly.comSnapsource LLC28 Jun 202128 Jun 202128 Jun 2022
482thepharmacycenter.netGoDaddy.com, LLC14 Oct 201025 Nov 202514 Oct 2025
483thepharmacistcorner.netGoDaddy.com, LLC31 May 200612 Jul 202431 May 2024
484thepharmacistattorney.netGoDaddy.com, LLC4 Mar 20146 Mar 20264 Mar 2027
485thepharmawall.netGoDaddy.com, LLC18 Mar 20119 Dec 20154 Nov 2017
486thepharmacyretailclinicnews.netGoDaddy.com, LLC23 Jul 20143 Sep 202423 Jul 2024
487thepharmacistlawyer.netGoDaddy.com, LLC4 Mar 20146 Mar 20264 Mar 2027
488thepharmacyamericatrusts.netCSC Corporate Domains, Inc.25 Dec 201121 Dec 202525 Dec 2026
489thepharmacysaver.netGoDaddy.com, LLC8 May 20148 May 20168 May 2017
490thepharmacyexpert.netNetwork Solutions, LLC8 Apr 201021 Jun 20258 Apr 2025
491thepharmatrust.netGoDaddy.com, LLC9 Nov 200910 Nov 20249 Nov 2026
492thepharmacia.netGoDaddy.com, LLC21 Jul 20122 Oct 202421 Jul 2024
493thepharmacyoutlet.netCrazy Domains FZ-LLC20 Feb 20133 Mar 201720 Feb 2017
494thepharmacylink.netTucows Domains Inc.1 Mar 201222 Feb 20241 Mar 2026
495thepharmaceuticaldiversityinstitute.netGoDaddy.com, LLC6 Feb 200717 Feb 20266 Feb 2027
496thepharmacy-northshire.netGoDaddy.com, LLC31 Dec 20071 Jan 201531 Dec 2016
497thepharmacyatlbh.netNetwork Solutions, LLC14 Jul 201015 May 202414 Jul 2026
498thepharmablog.netCenter of Ukrainian Internet Names dba UKRNAMES7 Nov 20082 Apr 20127 Nov 2016
499thepharmacy.netGoDaddy.com, LLC17 Apr 200218 Apr 202517 Apr 2026
500thepharmacopeia.netNetwork Solutions, LLC8 May 200120 Jun 20258 May 2025
501thepharmacydoctor.orgMesh Digital Limited4 Aug 200928 Jul 20164 Aug 2017
502thepharmacyadviser.orgCSC Corporate Domains, Inc.6 Jan 20097 Jan 20266 Jan 2027
503thepharmanetwork.orgHosting Concepts B.V. dba Openprovider29 Nov 20116 Dec 202529 Nov 2026
504thepharmacist.org1&1 Internet AG9 Feb 20009 Feb 20269 Feb 2027
505thepharmakon.orgDreamHost, LLC29 Jun 20002 Jun 202529 Jun 2026
506thepharmacistadvisor.orgCSC Corporate Domains, Inc.3 Dec 20084 Dec 20253 Dec 2026
507thepharmacyretailclinicnews.orgGoDaddy.com, LLC23 Jul 20146 Aug 202523 Jul 2026
508thepharmacyatlbh.orgNetwork Solutions, LLC14 Jul 201020 May 202414 Jul 2026
509thepharmacyexchange.orgFastDomain Inc.9 Sep 20129 Sep 20179 Sep 2018
510thepharmaceuticalsalesnetwork.orgGoDaddy.com, LLC30 Sep 200814 Nov 202430 Sep 2026
511thepharmacycard.orgGoDaddy.com, LLC23 Mar 20127 May 202523 Mar 2026
512thepharmacyconnection.orgeNom, Inc.16 Sep 200331 Aug 202516 Sep 2027
513thepharmacopeia.orgNetwork Solutions, LLC8 May 200120 Jun 20258 May 2025
514thepharmatrust.orgGoDaddy.com, LLC9 Nov 200924 Dec 20249 Nov 2026
515thepharmaceuticaldiversityinstitute.orgGoDaddy.com, LLC6 Feb 200717 Feb 20266 Feb 2027
516thepharmacistadviser.orgCSC Corporate Domains, Inc.3 Dec 20084 Dec 20253 Dec 2026
517thepharmacyadvisor.orgCSC Corporate Domains, Inc.6 Jan 20097 Jan 20266 Jan 2027
518thepharmacy-northshire.orgGoDaddy.com, LLC31 Dec 200715 Dec 201631 Dec 2017
519thepharmacyexpress.meEuroDNS S.A.8 Oct 201517 Nov 20178 Oct 2018
520thepharmacy.wikiNetwork Solutions, LLC31 Oct 201613 Dec 201731 Oct 2017
521thepharmakorea.comGabia, Inc.4 Nov 201623 Oct 20244 Nov 2026
522thepharmacygroup.net-6 Nov 20166 Nov 20166 Nov 2017
523thepharmacyoflove.comNetwork Solutions, LLC6 Nov 201618 Nov 20176 Nov 2018
524thepharmacyconsultants.neteNom, Inc.14 Nov 20164 Nov 201714 Nov 2018
525thepharmacyagency.comBeijing Lanhai Jiye Technology Co., Ltd2 Apr 20234 Jun 20252 Apr 2025
526thepharmacyphilly.comGransy s.r.o. d/b/a subreg.cz24 Nov 201624 Nov 201624 Nov 2017
527thepharmacywatch.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Nov 201630 Jan 201730 Nov 2019
528thepharmabook.comGoDaddy.com, LLC11 Jun 202412 Jun 202511 Jun 2026
529thepharmacistlive.comCloudFlare, Inc.6 Dec 201623 Oct 20256 Dec 2026
530thepharmacycounter.comGoDaddy.com, LLC6 Dec 20167 Dec 20246 Dec 2026
531thepharmaforce.comGoDaddy.com, LLC9 Dec 201614 Oct 20239 Dec 2026
532thepharmacymom.comGoDaddy.com, LLC17 May 202128 Jul 202417 May 2024
533thepharmacoach.comGoDaddy.com, LLC18 May 202118 May 202518 May 2027
534thepharmacyone24.comGoDaddy.com, LLC27 May 201927 May 201927 May 2020
535thepharmacistsbible.comLaunchpad, Inc.23 Dec 20168 Dec 201723 Dec 2018
536thepharmaleaders.comGoDaddy.com, LLC22 Sep 202030 Aug 202522 Sep 2026
537thepharmacieparkcity.comGoDaddy.com, LLC27 Dec 201627 Dec 201627 Dec 2017
538thepharmacyatbrookland.comGoogle, Inc.28 Dec 201613 Dec 202528 Dec 2026
539thepharmaacademy.netGoDaddy.com, LLC1 Jan 20171 Jan 20171 Jan 2018
540thepharmasummit.netGoDaddy.com, LLC1 Jan 20171 Jan 20171 Jan 2018
541thepharmacons.comTucows Domains Inc.5 Jan 20179 Jan 20185 Jan 2018
542thepharmacytechnicianonline.comFastDomain Inc.12 Jan 201714 Feb 201812 Jan 2018
543thepharmacyone-24rx.comCJSC Registrar R0112 Jan 201716 Jan 201812 Jan 2018
544thepharmacysage.orgGoDaddy.com, LLC13 Jan 201717 Mar 201713 Jan 2019
545thepharmari.comGoDaddy.com, LLC19 Jan 20171 Apr 202519 Jan 2025
546thepharmaguy.comInstra Corporation Pty Ltd.26 Apr 202423 Nov 202526 Apr 2028
547thepharmacistnextdoor.comFastDomain Inc.19 Jan 20174 Jan 201819 Jan 2019
548thepharmari.orgGoDaddy.com, LLC24 Jan 201725 Mar 201724 Jan 2018
549thepharmari.netGoDaddy.com, LLC24 Jan 201724 Jan 201724 Jan 2018
550thepharmacistisin.netFastDomain Inc.23 Jan 201723 Jan 201723 Jan 2018
551thepharmari.bizGoDaddy.com, LLC24 Jan 201717 Mar 201723 Jan 2018
552thepharmaexpress.comGoDaddy.com, LLC25 Nov 202525 Nov 202525 Nov 2026
553thepharmacylab.comGoDaddy.com, LLC19 Jan 20225 Oct 202219 Jan 2027
554thepharmacloud.comGoDaddy.com, LLC1 Feb 20172 Feb 20261 Feb 2027
555thepharmacycode.comGoDaddy.com, LLC11 Feb 201711 Feb 201711 Feb 2019
556thepharmaworld.co.uk-19 May 201620 Apr 202519 May 2027
557thepharmacysell.comGoDaddy.com, LLC27 Feb 201727 Feb 201727 Feb 2018
558thepharmasmarketing.com1&1 Internet AG28 Feb 201714 May 202528 Feb 2025
559thepharmasmarket.linkTucows Domains Inc.28 Feb 201710 Apr 201828 Feb 2018
560thepharmacyexchange.comGoDaddy.com, LLC16 Aug 201816 Aug 201816 Aug 2019
561thepharmanet.comGoDaddy.com, LLC2 Mar 20173 Mar 20252 Mar 2027
562thepharmahub.comGoDaddy.com, LLC2 Mar 20173 Mar 20252 Mar 2027
563thepharmacistdiaries.comAutomattic Inc.18 Aug 202525 Nov 202518 Aug 2026
564thepharmacytechnicians.comDropCatch.com 372 LLC24 May 201824 May 201824 May 2019
565thepharmaceuticalindustry.comGoDaddy.com, LLC8 Feb 202515 Feb 20268 Feb 2027
566thepharmaboss.comFastDomain Inc.22 Mar 201722 Mar 201722 Mar 2018
567thepharmausa.comGoDaddy.com, LLC31 Mar 201731 Mar 201731 Mar 2018
568thepharmacistcollective.comKey-Systems GmbH2 Apr 201728 Apr 20212 Apr 2022
569thepharmacyconcept.comGoDaddy.com, LLC3 Apr 20173 Apr 20173 Apr 2018
570thepharmacykitchen.comLCN.COM Ltd.5 Apr 20177 Jan 20185 Apr 2018
571thepharmaapp.comGoDaddy.com, LLC8 Apr 20178 Apr 20178 Apr 2018
572thepharmacyofnature.comDomain.com, LLC11 Apr 201725 May 202411 Apr 2024
573thepharmacyofnature.onlinePDR Ltd. d/b/a PublicDomainRegistry.com11 Apr 201717 Jun 202411 Apr 2024
574thepharmacyofnature.netDomain.com, LLC11 Apr 201725 May 202411 Apr 2024
575thepharmacom.infoBizcn.com, Inc.12 Apr 201717 Jun 201712 Apr 2018
576thepharmacom.orgBizcn.com, Inc.12 Apr 201712 Jun 201712 Apr 2018
577thepharmacom.netCNOBIN INFORMATION TECHNOLOGY LIMITED12 Apr 201712 May 202112 Apr 2022
578thepharmanode.comName.com, Inc.15 Apr 201715 Apr 201715 Apr 2019
579thepharmacynetwork.co.uk-17 Oct 201316 Oct 202517 Oct 2027
580thepharmanthropist.comNameCheap, Inc.1 May 20171 May 20171 May 2020
581thepharmanthropists.comNameCheap, Inc.1 May 20171 May 20171 May 2020
582thepharmacyatrameys.comGoDaddy.com, LLC2 May 201714 Jul 20252 May 2025
583thepharmajobs.comHostinger, UAB10 May 20258 Jan 202610 May 2026
584thepharmacyhut.co.uk-25 Nov 201117 Nov 201725 Nov 2018
585thepharmacistsinnercircle.comGoDaddy.com, LLC24 May 201724 May 201724 May 2018
586thepharmarealtor.comeNom, Inc.24 May 20179 Jun 201724 May 2018
587thepharmacistapp.comRealtime Register B.V.24 May 20176 Jul 201724 May 2018
588thepharmacistschoices.comGoDaddy.com, LLC8 Jun 201720 Jul 20248 Jun 2024
589thepharmaexpo.comGoDaddy.com, LLC8 Jun 201729 Apr 20258 Jun 2026
590thepharmacologyclinic.comTucows Domains Inc.12 Jun 201716 Jun 202012 Jun 2020
591thepharmacologyclinic.netTucows Domains Inc.12 Jun 201712 Jun 201712 Jun 2018
592thepharmacyatmidtown.comTucows Domains Inc.15 Jun 201719 Jun 201915 Jun 2019
593thepharmacyvr.comGoDaddy.com, LLC17 Jun 201717 Jun 201717 Jun 2018
594thepharmacyrestaurant.comGoDaddy.com, LLC4 Apr 20221 Oct 20224 Apr 2027
595thepharmasafenetwork.comGoDaddy.com, LLC27 Jun 201727 Jun 201727 Jun 2018
596thepharmacist.co.uk-22 Nov 200223 Oct 202522 Nov 2026
597thepharmacistcoach.comGoDaddy.com, LLC21 Nov 202221 Nov 202221 Nov 2027
598thepharmacytech.comCloudFlare, Inc.12 Nov 202413 Nov 202512 Nov 2026
599thepharmacy.mediaGoDaddy.com, LLC8 Aug 20178 Aug 20178 Aug 2020
600thepharmacy.careGoDaddy.com, LLC3 Nov 20205 Nov 20253 Nov 2026
601thepharmajobsite.co.ukReserved7 Jul 20089 Jan 20177 Jul 2018
602thepharmacyatwellington.infoGoDaddy.com, LLC4 Sep 20178 Sep 20254 Sep 2026
603thepharmapost.comCronon AG11 Mar 202411 May 202511 Mar 2025
604thepharmacycompany.co.uk-5 Jun 20111 Dec 20235 Jun 2024
605thepharmacylawyers.comGoDaddy.com, LLC15 Oct 202515 Oct 202515 Oct 2028
606thepharmacistcompounder.comNameCheap, Inc.3 Oct 20173 Oct 20173 Oct 2018
607thepharmacypro.comGoDaddy.com, LLC13 Jan 202513 Jan 202513 Jan 2027
608thepharmacyfarm.infoGoDaddy.com, LLC5 Oct 20175 Oct 20175 Oct 2018
609thepharmacyfarm.orgGoDaddy.com, LLC5 Oct 20175 Dec 20175 Oct 2018
610thepharmablockchain.comNamesilo, LLC15 Oct 201716 Oct 201715 Oct 2018
611thepharmablockchain.netNamesilo, LLC15 Oct 201716 Oct 201715 Oct 2018
612thepharmacywebsiteco.co.uk-3 Sep 20154 Sep 20243 Sep 2025
613thepharmacywebsiteco.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…3 Sep 201530 Aug 20173 Sep 2019
614thepharmacytech.instituteNamesilo, LLC22 Oct 201722 Oct 201722 Oct 2018
615thepharmanetworks.com1API GmbH31 Oct 201731 Oct 201731 Oct 2018
616thepharmacr.comNameCheap, Inc.7 Nov 20177 Nov 20177 Nov 2018
617thepharmaspot.comeNom, Inc.6 Nov 20176 Nov 20176 Nov 2018
618thepharmarketeer.comGoogle, Inc.17 Nov 201717 Nov 201717 Nov 2018
619thepharmacistsvoice.infoGoogle, Inc.28 Nov 20179 Jan 202528 Nov 2024
620thepharmacystudentblog.comFastDomain Inc.28 Nov 201728 Nov 201728 Nov 2018
621thepharmanotebook.com1&1 Internet AG4 Dec 20174 Dec 20174 Dec 2018
622thepharmalogistic.comHostinger, UAB11 Dec 201711 Dec 201711 Dec 2018
623thepharmacytechprogramattheroc.comTucows Domains Inc.16 Dec 201720 Dec 201916 Dec 2019
624thepharmacybank.comFastDomain Inc.25 Dec 201725 Dec 201725 Dec 2018
625thepharmalogistics.comHostinger, UAB31 Dec 201731 Dec 201731 Dec 2018
626thepharmacy.softwareDomain.com, LLC31 Dec 201731 Dec 201731 Dec 2018
627thepharmajourney.co.uk-17 Jul 20127 Jun 201717 Jul 2019
628thepharmacylongmelford.co.uk-2 Jun 20116 Nov 20242 Jun 2025
629thepharmacyportsmouth.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…1 Mar 201022 Feb 20171 Mar 2018
630thepharmacists.co.uk-13 Jun 200627 Sep 201713 Jun 2018
631thepharmacy-hub.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…20 Sep 201720 Sep 201720 Sep 2019
632thepharmacycoedpoeth.co.uk-4 Feb 20095 Feb 20264 Feb 2027
633thepharmacyworks.co.uk-6 Jun 20125 Jun 20246 Jun 2026
634thepharmasea.co.uk-21 Jun 20177 Sep 201721 Jun 2018
635thepharmacy.co.uk-14 Jul 200424 Jul 202414 Jul 2026
636thepharmacyclinic.co.uk-14 Aug 201513 Aug 202514 Aug 2027
637thepharmaceuticallist.co.ukReserved10 Apr 20159 Apr 201610 Apr 2018
638thepharmacyworld.co.uk-6 Nov 201420 Jun 20246 Nov 2026
639thepharmacyonline.co.uk-14 Jan 201013 Jan 202414 Jan 2026
640thepharmacyexpress.co.uk-14 Mar 202115 Mar 202514 Mar 2027
641thepharmacisttodayuk.co.uk-28 Jan 201414 Jan 201628 Jan 2018
642thepharmatrain.co.ukHello Internet Corp.25 Nov 200925 Nov 201725 Nov 2019
643thepharmacyinsider.co.ukAcens Technologies, S.L.U.24 Jun 201023 Jun 201624 Jun 2018
644thepharmacybebington.co.uk-11 May 201717 Sep 202411 May 2027
645thepharmacysupplier.co.ukReserved6 Jun 20166 Jun 20166 Jun 2018
646thepharmacybillingham.co.uk-27 May 20243 Jun 202527 May 2025
647thepharmaceuticalnetworkingshowcase.co.ukAcens Technologies, S.L.U.26 Nov 20083 Feb 201726 Nov 2018
648thepharmacytoday.co.ukAcens Technologies, S.L.U.24 Jun 201023 Jun 201624 Jun 2018
649thepharmacycoach.co.uk-6 Mar 20237 Mar 20256 Mar 2027
650thepharmacysuperstore.co.uk-4 Mar 200022 Feb 20164 Mar 2018
651thepharmacistcompany.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…12 Feb 20145 Feb 201612 Feb 2018
652thepharmacymonthly.co.ukAcens Technologies, S.L.U.24 Jun 201023 Jun 201624 Jun 2018
653thepharmacycentre.co.uk-30 Nov 202020 Aug 202430 Nov 2033
654thepharmacyshop.uk-22 Jul 20151 Jul 202422 Jul 2026
655thepharmacyshop.co.uk-16 Jan 20136 Jan 202516 Jan 2027
656thepharmacyconsultancy.co.uk-18 Mar 201018 Mar 202318 Mar 2026
657thepharmacytrainingcompany.co.uk-7 Oct 201122 Sep 20177 Oct 2019
658thepharmacypractice.co.ukLCN.COM Ltd.23 Jul 200910 Aug 201723 Jul 2019
659thepharmaletter.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…23 Jun 201416 Jun 201723 Jun 2018
660thepharmacyhub.co.uk-8 Sep 20209 Aug 20258 Sep 2026
661thepharmacyacademy.co.uk-7 Dec 20173 Dec 20257 Dec 2026
662thepharmacywebshop.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…28 May 201521 May 201728 May 2018
663thepharmacycongress.co.uk-20 Jun 201119 Jun 202520 Jun 2027
664thepharmacydirectory.co.ukReserved14 Nov 201413 Nov 201614 Nov 2018
665thepharmacyco.co.uk-6 Mar 201520 Feb 20176 Mar 2019
666thepharmaletter.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…6 Aug 200930 Jul 20176 Aug 2019
667thepharmaportal.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…20 Jan 20155 Oct 201720 Jan 2019
668thepharmacykingston.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…3 Sep 201530 Aug 20173 Sep 2019
669thepharmacyconference.co.uk-28 Feb 200814 Nov 201728 Feb 2018
670thepharmacymagazine.co.ukAcens Technologies, S.L.U.21 Jun 201020 Jun 201621 Jun 2018
671thepharmacycounter.co.ukLCN.COM Ltd.19 Jun 201316 Aug 202519 Jun 2027
672thepharmacyshow.co.uk-20 Jan 200621 Dec 201720 Jan 2019
673thepharmacywebsitecompany.co.uk-26 Jul 201326 Jul 202526 Jul 2026
674thepharmacyapp.co.uk-4 Jul 202212 Aug 20244 Jul 2026
675thepharmacycafe.co.ukReserved6 Jan 20135 Jan 20176 Jan 2019
676thepharmacy.org.ukCronon AG30 Sep 201129 Sep 201730 Sep 2019
677thepharmarketeer.co.uk-17 Nov 201717 Nov 201717 Nov 2018
678thepharmacylawyer.co.uk-11 Feb 201017 Jan 201711 Feb 2019
679thepharmacyrx1.comNameCheap, Inc.16 Jan 201816 Jan 201816 Jan 2019
680thepharmachain.infoGoDaddy.com, LLC26 Jan 201827 Jan 202626 Jan 2027
681thepharmalist.co.uk-5 Feb 20185 Feb 20265 Feb 2031
682thepharmacycentre.supportMesh Digital Limited7 Feb 20188 Feb 20267 Feb 2027
683thepharmanews24.comOnlineNIC, Inc.13 Mar 201813 Mar 201813 Mar 2019
684thepharmatimesbd.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Mar 201818 Mar 201818 Mar 2019
685thepharmachef.comGoDaddy.com, LLC27 Feb 202427 Feb 202427 Feb 2027
686thepharmabulletin.comMarcaria.com International, Inc.29 Mar 201829 Mar 201829 Mar 2019
687thepharmarep.comGoDaddy.com, LLC1 Aug 20241 Aug 20241 Aug 2026
688thepharmaceuticalrep.comNameCheap, Inc.1 Apr 201813 Jun 20241 Apr 2024
689thepharmacysale.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…20 Oct 201729 Mar 201820 Oct 2018
690thepharmacistwhodoesntlikemedicine.infoGoDaddy.com, LLC14 Apr 201814 Apr 201814 Apr 2020
691thepharmacistwhodoesntlikemeds.info-14 Jan 202514 Jan 2025-
692thepharmacistwhohatesdrugs.info-14 Jan 202514 Jan 2025-
693thepharmacistwhohatesmeds.info-14 Jan 202514 Jan 2025-
694thepharmacistadvice.comRegister.it SPA15 Apr 201815 Apr 201814 Apr 2019
695thepharmacistwhodoesntlikedrugs.infoGoDaddy.com, LLC14 Apr 20181 Aug 202414 Apr 2028
696thepharmacistwhohatesmedicine.info-14 Jan 202514 Jan 2025-
697thepharmanut.comAutomattic Inc.16 Apr 201816 Apr 201816 Apr 2019
698thepharmarep.netNameCheap, Inc.1 Apr 201813 Jun 20241 Apr 2024
699thepharmaceuticalrep.netNameCheap, Inc.1 Apr 201813 Jun 20241 Apr 2024
700thepharmaciststore.comTucows Domains Inc.8 May 201812 May 20198 May 2019
701thepharmaagilist.comTucows Domains Inc.10 May 201814 May 201910 May 2019
702thepharmacyprofessor.comNameCheap, Inc.15 May 201815 May 201815 May 2019
703thepharmacistsdaughter.comFastDomain Inc.4 Jun 201819 May 20254 Jun 2026
704thepharmacybeatz.comGoDaddy.com, LLC9 Jun 201821 Jul 20249 Jun 2024
705thepharmamarketinggroup.com1&1 Internet AG14 Jun 201814 Jun 201814 Jun 2019
706thepharmamarketingroup.com1&1 Internet AG14 Jun 201814 Jun 201814 Jun 2019
707thepharmarecruiter.comGoDaddy.com, LLC1 Apr 20251 Apr 20251 Apr 2026
708thepharmacien.comGoDaddy.com, LLC20 Jun 201820 Jun 201820 Jun 2020
709thepharmacyoncall.comGoDaddy.com, LLC21 Jun 201821 Jun 201821 Jun 2019
710thepharmacyteam.comCrazy Domains FZ-LLC25 Jun 201826 Jun 202025 Jun 2020
711thepharmacystrategist.comNameCheap, Inc.2 Jul 20182 Jun 20252 Jul 2026
712thepharmacystrategist.onlineNameCheap, Inc.2 Jul 20182 Jul 20182 Jul 2019
713thepharmacyherbal.comGoDaddy.com, LLC3 Jul 20183 Jul 20183 Jul 2019
714thepharmaceutical.directoryGoDaddy.com, LLC5 Jul 20185 Jul 20185 Jul 2019
715thepharmacycollective.co.nzKey-Systems GmbH26 Jun 20237 Aug 2024-
716thepharmacista.comGoDaddy.com, LLC11 Jul 201811 Jul 201811 Jul 2019
717thepharmacychicago.comGoDaddy.com, LLC18 Oct 202219 Oct 202418 Oct 2026
718thepharmacy-chicago.comGoDaddy.com, LLC26 Jul 201826 Jul 201826 Jul 2020
719thepharmacologicalkillingofourveterans.comGoDaddy.com, LLC2 Aug 20182 Aug 20182 Aug 2019
720thepharmacy.cloudGoDaddy.com, LLC23 Feb 20246 Apr 202523 Feb 2025
721thepharmawatch.comGoDaddy.com, LLC10 Aug 201810 Aug 201810 Aug 2019
722thepharmacyxchange.comGoDaddy.com, LLC16 Aug 201816 Aug 201816 Aug 2019
723thepharmacysurvey.comGoDaddy.com, LLC17 Aug 201817 Aug 201817 Aug 2019
724thepharmacysurvey.infoGoDaddy.com, LLC17 Aug 201817 Aug 202017 Aug 2021
725thepharmacysurvey.netGoDaddy.com, LLC17 Aug 201817 Aug 201817 Aug 2019
726thepharmacyatbergheim.comGoDaddy.com, LLC21 Aug 20182 Oct 202421 Aug 2024
727thepharmacian.comNameCheap, Inc.30 Aug 201830 Aug 201830 Aug 2019
728thepharmacistreview.comGoDaddy.com, LLC4 Sep 201816 Nov 20234 Sep 2023
729thepharmacistwholifts.comCrazy Domains FZ-LLC10 Sep 201810 Sep 201810 Sep 2020
730thepharmawiki.comGoDaddy.com, LLC10 Sep 201810 Sep 201810 Sep 2019
731thepharmacychat.clubGoDaddy.com, LLC19 Sep 201819 Sep 201819 Sep 2019
732thepharmacistscoach.comGoDaddy.com, LLC24 Sep 201824 Sep 201824 Sep 2019
733thepharmashoppe.comGoDaddy.com, LLC27 Sep 201827 Sep 202427 Sep 2026
734thepharmasite.comGoDaddy.com, LLC28 Sep 201829 Sep 202528 Sep 2026
735thepharmasite.netGoDaddy.com, LLC28 Sep 201829 Sep 202528 Sep 2026
736thepharmaeducation.comGoDaddy.com, LLC1 Oct 20181 Oct 20251 Oct 2026
737thepharmapanel.comBigRock Solutions Ltd.2 Oct 20182 Oct 20182 Oct 2020
738thepharmacyevents.comMetaregistrar BV Applications7 Apr 20248 Apr 20257 Apr 2026
739thepharmacbd.comGoDaddy.com, LLC7 Oct 20188 Oct 20257 Oct 2026
740thepharmamagazine.com1&1 Internet AG26 Feb 202126 Feb 202126 Feb 2022
741thepharmaengagement.comGoDaddy.com, LLC17 Oct 201817 Oct 201817 Oct 2020
742thepharmaroom.comBeijing Lanhai Jiye Technology Co., Ltd5 Jan 20249 Mar 20255 Jan 2025
743thepharmacyexpress.siteRegional Network Information Center, JSC dba RU-CE…21 Oct 201821 Oct 201821 Oct 2019
744thepharmasalescoach.comGoDaddy.com, LLC27 Oct 201827 Oct 201827 Oct 2019
745thepharmacist.fyiGoDaddy.com, LLC29 Oct 201829 Oct 201829 Oct 2019
746thepharmacyami.comGoDaddy.com, LLC1 Nov 20181 Nov 20181 Nov 2019
747thepharmacyannamaria.comGoDaddy.com, LLC1 Nov 20181 Nov 20181 Nov 2019
748thepharmacyburger.comGoDaddy.com, LLC2 Nov 201815 Oct 20222 Nov 2026
749thepharmaport.comGoDaddy.com, LLC2 Nov 20182 Nov 20182 Nov 2019
750thepharmasharing.infoGoDaddy.com, LLC9 Nov 201824 Dec 20259 Nov 2026
751thepharmashare.comGoDaddy.com, LLC9 Nov 201810 Nov 20259 Nov 2026
752thepharmashare.infoGoDaddy.com, LLC9 Nov 201824 Dec 20259 Nov 2026
753thepharmasharing.comGoDaddy.com, LLC9 Nov 201810 Nov 20259 Nov 2026
754thepharmatimes.infoNameCheap, Inc.9 Nov 20189 Nov 20189 Nov 2019
755thepharmacypost.comGoDaddy.com, LLC9 Nov 201821 Dec 20249 Nov 2024
756thepharmashare.netGoDaddy.com, LLC9 Nov 201810 Nov 20259 Nov 2026
757thepharmasharing.netGoDaddy.com, LLC9 Nov 201810 Nov 20259 Nov 2026
758thepharmatech.comGoDaddy.com, LLC27 Jun 202212 Jul 202527 Jun 2026
759thepharmamarketer.comGoDaddy.com, LLC21 Nov 201822 Nov 202521 Nov 2027
760thepharmasage.comGoDaddy.com, LLC23 Sep 202324 Sep 202523 Sep 2026
761thepharmainfo.comAutomattic Inc.7 Nov 20207 Nov 20207 Nov 2021
762thepharmaspective.comGoogle, Inc.7 Dec 20187 Dec 20187 Dec 2019
763thepharmassociates.comGoDaddy.com, LLC13 Dec 201813 Dec 201813 Dec 2020
764thepharmaceuticalcbd.comGoDaddy.com, LLC14 Dec 201814 Dec 201814 Dec 2019
765thepharma360bd.comNameCheap, Inc.18 Dec 201815 Nov 202518 Dec 2026
766thepharmacy.clubGoDaddy.com, LLC21 Mar 20232 May 202421 Mar 2024
767thepharmacognosy.com-29 Mar 20252 Apr 202529 Mar 2026
768thepharmacyinthesquare.comGoDaddy.com, LLC18 Jan 201918 Jan 202618 Jan 2027
769thepharmacistgirl.comGoDaddy.com, LLC21 Jan 201921 Jan 201921 Jan 2021
770thepharmacyprime.comGoDaddy.com, LLC22 Jan 201922 Jan 201922 Jan 2020
771thepharmacyzone.com1API GmbH23 Jan 201923 Jan 202623 Jan 2027
772thepharmacistsarein.com1API GmbH23 Jan 201923 Jan 202623 Jan 2027
773thepharmaedge.comAscio Technologies, Inc. Danmark - Filial af Ascio…3 Feb 20255 Mar 20263 Feb 2026
774thepharmacynook.comTucows Domains Inc.5 Feb 201918 Mar 20255 Feb 2025
775thepharmacistsclub.comNameCheap, Inc.14 Feb 201914 Feb 201914 Feb 2020
776thepharmacyhistorian.comDomain.com, LLC15 Feb 201915 Feb 201915 Feb 2021
777thepharmacycollective.com-4 Feb 20265 Feb 20264 Feb 2027
778thepharmacyboard.comGoDaddy.com, LLC12 Mar 201912 Mar 201912 Mar 2021
779thepharmacycbd.comDropCatch.com 1349 LLC19 Oct 202520 Oct 202519 Oct 2026
780thepharmacys.comGoDaddy.com, LLC26 Mar 201921 Aug 202426 Mar 2025
781thepharmagorilla.comGoDaddy.com, LLC30 Mar 201929 Mar 202530 Mar 2028
782thepharmaverse.comMarkMonitor Inc.2 Apr 201916 Aug 20242 Apr 2026
783thepharmacybusiness.comGoDaddy.com, LLC1 May 20234 May 20251 May 2026
784thepharmaconsultans.comKey-Systems GmbH3 Apr 20193 Apr 20193 Apr 2020
785thepharmasseuse.comNameCheap, Inc.5 Apr 20196 Mar 20255 Apr 2026
786thepharmakit.comGoDaddy.com, LLC5 Apr 20196 Apr 20255 Apr 2026
787thepharmacistscorner.comGoDaddy.com, LLC8 Apr 20199 Apr 20258 Apr 2026
788thepharmartist.comGoogle, Inc.10 Apr 201926 Mar 202510 Apr 2026
789thepharmanotes.comGoDaddy.com, LLC11 Apr 201911 Apr 201911 Apr 2020
790thepharmacysantabarbara.comGoDaddy.com, LLC12 Apr 201912 Apr 202512 Apr 2026
791thepharmacysb.comGoDaddy.com, LLC12 Apr 201912 Apr 202512 Apr 2026
792thepharmaex.comNamePal.com #80233 Jul 20203 Jul 20203 Jul 2021
793thepharmacynorthshire.comGoDaddy.com, LLC17 Apr 201918 Apr 202517 Apr 2026
794thepharmacyroom.comWebfusion Ltd.17 Apr 201910 Aug 202317 Apr 2029
795thepharmacampus.comBigRock Solutions Ltd.17 Apr 201917 Apr 202517 Apr 2026
796thepharmacore.comGMO Internet Inc.9 Feb 202610 Feb 20269 Feb 2027
797thepharmaherald.comNameCheap, Inc.8 Jul 202319 Sep 20248 Jul 2024
798thepharmabiotic.netGoDaddy.com, LLC23 Apr 201923 Apr 201923 Apr 2021
799thepharmabiotic.comGoDaddy.com, LLC23 Apr 201923 Apr 201923 Apr 2021
800thepharmacyvalet.comGoDaddy.com, LLC2 May 20192 May 20192 May 2021
801thepharmameds.comHostinger, UAB23 Jul 20245 Sep 202523 Jul 2025
802thepharmacistsformula.comAutomattic Inc.10 May 201910 May 201910 May 2020
803thepharmazone.comHostinger, UAB9 Apr 202320 May 20249 Apr 2024
804thepharmacare.comBigRock Solutions Ltd.6 Jan 202517 Feb 20266 Jan 2026
805thepharmaceuticalpost.comOVH sas19 May 201920 May 202419 May 2025
806thepharmaconference.com1&1 Internet AG21 May 201921 May 201921 May 2026
807thepharmacytechprogram.comGoDaddy.com, LLC24 May 201920 May 202524 May 2026
808thepharmawave.comGoDaddy.com, LLC25 May 201925 May 201925 May 2020
809thepharmatalks.comTurnCommerce, Inc. DBA NameBright.com4 Nov 202214 Jan 20254 Nov 2024
810thepharmatalks.netGoDaddy.com, LLC3 Jun 20193 Jun 20193 Jun 2020
811thepharmasearch.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Jun 20196 Jun 20196 Jun 2020
812thepharmacistcbd.comGoDaddy.com, LLC21 Nov 202222 Nov 202521 Nov 2026
813thepharmacistscabinet.comTucows Domains Inc.6 Jun 201910 Jun 20216 Jun 2021
814thepharmacyawards.com1&1 Internet AG10 Jun 201910 Jun 201910 Jun 2026
815thepharmac.com-11 Jul 202422 Sep 202511 Jul 2025
816thepharmainsights.comGoDaddy.com, LLC19 Jun 201928 Oct 202219 Jun 2029
817thepharmanimals.comGoogle, Inc.23 Jun 201923 Jul 202423 Jun 2024
818thepharmaleader.comBigRock Solutions Ltd.24 Jun 201927 Jun 202424 Jun 2027
819thepharmacogenomicsnafu.comGoogle, Inc.30 Jun 201930 Jul 202030 Jun 2020
820thepharmacogenomicssnafu.comGoogle, Inc.30 Jun 201930 Jul 202030 Jun 2020
821thepharmakarma.comNamesilo, LLC4 Jul 20194 Jul 20204 Jul 2020
822thepharmacistcepodcast.comGoogle, Inc.9 Jul 20199 Jul 20199 Jul 2020
823thepharmapros.comregister.com, Inc.8 Jul 20198 Jul 20198 Jul 2020
824thepharmaexpert.comGoDaddy.com, LLC12 Dec 202223 Jan 202612 Dec 2025
825thepharmacycfo.comGoDaddy.com, LLC9 Jul 20199 Jul 20199 Jul 2020
826thepharmaceuticalinstitute.comGoDaddy.com, LLC11 Jul 201928 Jun 202511 Jul 2027
827thepharmasea.comNameCheap, Inc.11 Jul 201911 Jun 202511 Jul 2026
828thepharmacytoolbox.comGoDaddy.com, LLC18 Jul 201918 Jul 201918 Jul 2020
829thepharmacygames.com1&1 Internet AG21 Jul 201921 Jul 201921 Jul 2020
830thepharmasource.comGoDaddy.com, LLC26 Apr 202327 Apr 202526 Apr 2026
831thepharmacydiscounts.comregister.com, Inc.25 Jul 201925 Jul 201925 Jul 2020
832thepharmadistributors.comGoDaddy.com, LLC25 Jul 201925 Jul 201925 Jul 2020
833thepharmacycoupons.comregister.com, Inc.25 Jul 201925 Jul 201925 Jul 2020
834thepharmaline.comGoDaddy.com, LLC27 Jul 20197 Sep 202427 Jul 2024
835thepharmacylife.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Mar 202310 Mar 20266 Mar 2027
836thepharmaforum.comTurnCommerce, Inc. DBA NameBright.com4 Aug 201911 Nov 20254 Aug 2026
837thepharmacyatinc.comNameCheap, Inc.7 Feb 20267 Feb 20267 Feb 2027
838thepharmary.comNameCheap, Inc.11 Aug 201912 Jul 202511 Aug 2026
839thepharmacyatrush.com-10 Dec 202510 Feb 202610 Dec 2026
840thepharmacann.comGoDaddy.com, LLC30 Aug 201930 Aug 201930 Aug 2020
841thepharmacynearme.comGoDaddy.com, LLC6 Sep 20196 Sep 20256 Sep 2026
842thepharmaleague.comGoogle, Inc.8 Sep 201924 Aug 20258 Sep 2026
843thepharmapack.comGoDaddy.com, LLC12 Sep 20196 Jan 202512 Sep 2025
844thepharmasupply.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Sep 201914 Sep 201914 Sep 2020
845thepharmakonllc.comDynadot, LLC4 Dec 202319 Nov 20254 Dec 2026
846thepharmaxboys.comGoDaddy.com, LLC20 Sep 201914 Jan 202620 Sep 2026
847thepharmagadget.comGoDaddy.com, LLC23 Sep 201923 Sep 201923 Sep 2020
848thepharmaceuticalsnews.comGoDaddy.com, LLC23 Sep 201923 Sep 201923 Sep 2020
849thepharmahealthcare.comGoDaddy.com, LLC27 Sep 201927 Sep 201927 Sep 2020
850thepharmacistsalary.comFastDomain Inc.1 Oct 20193 Oct 20251 Oct 2026
851thepharmacide.comGoDaddy.com, LLC3 Oct 20193 Oct 20193 Oct 2020
852thepharmacyatbrookland.netGoogle, Inc.2 Oct 201917 Sep 20252 Oct 2026
853thepharmacymanager.comGoDaddy.com, LLC8 Oct 20198 Oct 20198 Oct 2021
854thepharmacistboutiqueapothecary.comTucows Domains Inc.10 Oct 201928 Sep 202510 Oct 2026
855thepharmacypdx.com1&1 Internet AG11 Oct 201918 Nov 202211 Oct 2026
856thepharmaceuticaltalks.comGoDaddy.com, LLC18 Oct 201918 Oct 201918 Oct 2020
857thepharmaceuticaltalks.netGoDaddy.com, LLC18 Oct 201918 Oct 201918 Oct 2020
858thepharmagrade.comNameCheap, Inc.23 Oct 2019-23 Oct 2020
859thepharmapen.comTucows Domains Inc.25 Oct 201929 Oct 202025 Oct 2020
860thepharmacistmentor.comGoogle, Inc.30 Oct 201930 Oct 201930 Oct 2020
861thepharmapathway.comNameCheap, Inc.2 Nov 2019-2 Nov 2020
862thepharmaryrx.comNameCheap, Inc.4 Nov 201913 Dec 20254 Nov 2026
863thepharmacistbar.comGoDaddy.com, LLC11 Nov 201911 Nov 201911 Nov 2020
864thepharmacy.agencyGoDaddy.com, LLC14 Nov 20192 Jan 202014 Nov 2020
865thepharmacycrew.comGoDaddy.com, LLC14 Nov 201914 Nov 201914 Nov 2021
866thepharmacistgroup.comGoDaddy.com, LLC28 Mar 202428 Mar 202428 Mar 2027
867thepharmacybunch.comGoDaddy.com, LLC14 Nov 201914 Nov 201914 Nov 2021
868thepharmacii.comTucows Domains Inc.15 Nov 201919 Nov 202015 Nov 2020
869thepharmacy209.comGoDaddy.com, LLC17 Nov 201918 Nov 202517 Nov 2026
870thepharmadataexchange.comGoDaddy.com, LLC18 Nov 201918 Nov 201918 Nov 2021
871thepharmadx.comGoDaddy.com, LLC18 Nov 201918 Nov 201918 Nov 2021
872thepharmaceuticalcodecompany.comTucows Domains Inc.18 Nov 201927 Nov 202518 Nov 2027
873thepharmacontentblog.comGoDaddy.com, LLC28 Nov 201928 Nov 201928 Nov 2020
874thepharmaculture.comGoDaddy.com, LLC29 Nov 201929 Nov 201929 Nov 2020
875thepharmacyhours.comGoDaddy.com, LLC30 Aug 202130 Aug 202130 Aug 2022
876thepharmaforce.netGoDaddy.com, LLC2 Dec 201913 Jan 20262 Dec 2025
877thepharmacistbeauty.comGoogle, Inc.1 Dec 201917 Nov 20251 Dec 2026
878thepharmacrowd.comWebfusion Ltd.3 Dec 20193 Dec 20193 Dec 2020
879thepharmacistgiftstore.comGoDaddy.com, LLC4 Dec 20194 Dec 20194 Dec 2020
880thepharmapodcast.comGoDaddy.com, LLC5 Dec 20196 Dec 20255 Dec 2026
881thepharmaalliance.comGoDaddy.com, LLC11 Dec 201911 Dec 201911 Dec 2020
882thepharmacyking.comWebfusion Ltd.20 Dec 201920 Dec 201920 Dec 2020
883thepharmaalternative.comGoDaddy.com, LLC22 Dec 201922 Dec 201922 Dec 2020
884thepharmaglobal.comGoDaddy.com, LLC31 Dec 20191 Jan 202631 Dec 2026
885thepharmatalk.comWebfusion Ltd.3 Jan 202014 Feb 20253 Jan 2025
886thepharmapro.comGoDaddy.com, LLC5 Jan 202016 Feb 20255 Jan 2025
887thepharmacyservices.comRealtime Register B.V.6 Jan 20202 Jan 20266 Jan 2027
888thepharma100.comGoDaddy.com, LLC10 Jan 202010 Jan 202010 Jan 2021
889thepharmacoaching.comWild West Domains, LLC14 Jan 202014 Jan 202014 Jan 2022
890thepharmacybox.comGoDaddy.com, LLC16 Jan 202016 Jan 202016 Jan 2021
891thepharmacydiscountcard.comEUTurbo.com LLC6 Apr 202212 Apr 20236 Apr 2024
892thepharmacyshopofweimar.comGoDaddy.com, LLC17 Jan 202017 Jan 202017 Jan 2021
893thepharmaplatform.comGoDaddy.com, LLC19 Jan 202020 Jan 202619 Jan 2027
894thepharma7.comGoDaddy.com, LLC20 Jan 202021 Jan 202620 Jan 2027
895thepharmacists.clubGoDaddy.com, LLC21 Jan 202021 Jan 202021 Jan 2021
896thepharmacistway.comAscio Technologies, Inc. Danmark - Filial af Ascio…22 Jan 202023 Jan 202622 Jan 2027
897thepharmazen.comGoDaddy.com, LLC23 Jan 202023 Jan 202023 Jan 2021
898thepharmaprinters.comRegistryGate GmbH28 Jan 202029 Jan 202628 Jan 2027
899thepharmaflower.comGoDaddy.com, LLC29 Jan 202029 Jan 202029 Jan 2021
900thepharmacyhub.comGoDaddy.com, LLC12 Jan 202230 Sep 202212 Jan 2028
901thepharmacistinthekitchen.comGoDaddy.com, LLC3 Feb 20203 Feb 20203 Feb 2021
902thepharmacistinthe.comGoDaddy.com, LLC3 Feb 20203 Feb 20203 Feb 2021
903thepharmasee.comDomain.com, LLC10 Feb 202012 Feb 202610 Feb 2027
904thepharmadigital.comBigRock Solutions Ltd.11 Feb 202011 Feb 202011 Feb 2022
905thepharmabusiness.comGoDaddy.com, LLC12 Feb 202026 Mar 202512 Feb 2025
906thepharmacosmetics.comGoDaddy.com, LLC19 Feb 202019 Feb 202019 Feb 2021
907thepharmacycommon.comKey-Systems GmbH20 Feb 202028 Nov 202520 Feb 2027
908thepharmax.comGoDaddy.com, LLC28 Dec 202428 Dec 202428 Dec 2027
909thepharmacistblogger.comGoogle, Inc.12 Mar 202012 Mar 202012 Mar 2021
910thepharmajob.comBigRock Solutions Ltd.20 Jun 202120 Jun 202120 Jun 2022
911thepharmasary.comWild West Domains, LLC13 Mar 202013 Mar 202013 Mar 2021
912thepharmacist.networkName.com, Inc.16 Mar 202010 Apr 202216 Mar 2023
913thepharmaonline.comGoDaddy.com, LLC17 Mar 202017 Mar 202017 Mar 2021
914thepharmaninja.comTucows Domains Inc.23 Mar 202027 Mar 202223 Mar 2022
915thepharmalife.comGoDaddy.com, LLC24 Mar 202024 Mar 202424 Mar 2026
916thepharmastrip.comGoDaddy.com, LLC27 Mar 20208 May 202527 Mar 2025
917thepharmacistvoice.comNameCheap, Inc.6 Apr 20209 Aug 20246 Apr 2026
918thepharmafixer.comGoDaddy.com, LLC10 Apr 202021 Jun 202310 Apr 2023
919thepharmaconc.comGoDaddy.com, LLC12 Apr 202012 Apr 202012 Apr 2021
920thepharmakon.netCSL Computer Service Langenbach GmbH d/b/a joker.c…15 Apr 202015 May 202315 Apr 2023
921thepharmadistributor.comSquarespace Domains LLC18 Nov 20243 Nov 202518 Nov 2026
922thepharmacytraininghub.comAmazon Registrar, Inc.29 Apr 202020 Jan 202629 Apr 2026
923thepharmasi.comOne.com A/S30 Apr 20201 May 202530 Apr 2026
924thepharmaceuticals.cloudGoDaddy.com, LLC30 Apr 202030 Apr 202030 Apr 2021
925thepharmacentre.comNameCheap, Inc.6 May 202017 Jun 20236 May 2023
926thepharmacist.proEnCirca, Inc.1 Mar 20134 Jun 20191 Mar 2021
927thepharmacentral.comGoDaddy.com, LLC12 May 202012 May 202012 May 2021
928thepharmacydeal.comLimited Liability Company "Registrar of domain nam…18 May 202018 May 202018 May 2021
929thepharmaconcept.comNetwork Solutions, LLC28 Aug 202430 Aug 202528 Aug 2026
930thepharmadocs.comGoDaddy.com, LLC26 May 20207 Aug 202326 May 2023
931thepharmacynu.comAmazon Registrar, Inc.30 May 202030 May 202030 May 2021
932thepharmacycoalition.comGoDaddy.com, LLC2 Jun 20203 Jun 20252 Jun 2026
933thepharmacistsfork.comRegister.it SPA3 Jun 20203 Jun 20253 Jun 2026
934thepharmacologyworkshop.comFastDomain Inc.7 Jun 20207 Jun 20207 Jun 2021
935thepharmakio.comGoDaddy.com, LLC11 Jun 202011 Jun 202011 Jun 2021
936thepharmacistsdaughters.comGoDaddy.com, LLC14 Jun 202026 Aug 202314 Jun 2023
937thepharmacyrevolution.comTucows Domains Inc.16 Jun 202020 Jun 202116 Jun 2021
938thepharmacist.codesGandi SAS28 Jun 202028 Jun 202028 Jun 2021
939thepharmacydoctors.comGoDaddy.com, LLC9 Jul 20209 Jul 20209 Jul 2021
940thepharmadp.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Jul 202018 Jul 202018 Jul 2021
941thepharmacovigilance.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Jul 202019 Jul 202019 Jul 2021
942thepharmakeia.comGoDaddy.com, LLC10 May 202310 May 202310 May 2024
943thepharmakeia.infoGoDaddy.com, LLC19 Jul 202019 Jul 202019 Jul 2021
944thepharmart.comGoDaddy.com, LLC27 Jul 202027 Jul 202027 Jul 2022
945thepharmaceuticaldiagnosticgroup.comGoogle, Inc.27 Jul 202012 Jul 202527 Jul 2026
946thepharmacyrecordings.comDreamHost, LLC25 Mar 20226 May 202325 Mar 2023
947thepharmacisthub.comGoDaddy.com, LLC3 Dec 20243 Dec 20243 Dec 2027
948thepharmacyfactory.comGoogle, Inc.2 Aug 20202 Aug 20202 Aug 2021
949thepharmacybeauty.comGoogle, Inc.31 Jul 202031 Jul 202031 Jul 2021
950thepharmadoc.icuWest263 International Limited19 Jan 202014 Feb 202019 Jan 2021
951thepharmacistscbd.comGoDaddy.com, LLC18 Aug 202018 Aug 202018 Aug 2021
952thepharmacistbot.comGoDaddy.com, LLC23 Feb 202324 Feb 202623 Feb 2027
953thepharmassistscbd.comGoDaddy.com, LLC20 Aug 202020 Aug 202020 Aug 2021
954thepharmastreet.comTucows Domains Inc.23 Aug 202027 Aug 202123 Aug 2021
955thepharmacyboutique.comTucows Domains Inc.25 Aug 202029 Aug 202125 Aug 2021
956thepharmacyresident.comGoDaddy.com, LLC1 Sep 20201 Sep 20241 Sep 2026
957thepharmacyresident.netGoDaddy.com, LLC1 Sep 20201 Sep 20251 Sep 2026
958thepharmalab.comDynadot, LLC3 Sep 202028 Aug 20253 Sep 2026
959thepharmaguys.comGoDaddy.com, LLC4 Sep 20205 Sep 20254 Sep 2030
960thepharmacyguys.comGoDaddy.com, LLC4 Sep 20205 Sep 20254 Sep 2030
961thepharmaguild.comDreamHost, LLC17 Jan 202330 Mar 202417 Jan 2024
962thepharmanimal.comTucows Domains Inc.5 Sep 202030 Jan 20265 Sep 2026
963thepharmacyjobnow.infoGoDaddy.com, LLC21 Feb 202022 Apr 202021 Feb 2021
964thepharmacyjobs.infoGoDaddy.com, LLC21 Feb 202022 Apr 202021 Feb 2021
965thepharmacyjobsnow.infoGoDaddy.com, LLC21 Feb 202022 Apr 202021 Feb 2021
966thepharmaceuticaltalks.infoGoDaddy.com, LLC18 Oct 201917 Dec 201918 Oct 2020
967thepharmacyjobsite.infoGoDaddy.com, LLC7 Feb 202021 Mar 20237 Feb 2023
968thepharmatalks.infoWild West Domains, LLC3 Jun 20199 Dec 20193 Jun 2021
969thepharmabiotic.infoGoDaddy.com, LLC23 Apr 201922 Jun 201923 Apr 2021
970thepharmastery.comGoDaddy.com, LLC10 Sep 202020 Sep 202410 Sep 2026
971thepharmaster.comGoDaddy.com, LLC10 Sep 202010 Sep 202010 Sep 2022
972thepharmacist.digitalName.com, Inc.11 Sep 202011 Sep 202011 Sep 2021
973thepharmanews.comGoDaddy.com, LLC22 Sep 202030 Aug 202522 Sep 2026
974thepharmaassist.comDreamHost, LLC27 Jun 202427 May 202527 Jun 2026
975thepharmacistprescriber.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Sep 202028 Sep 202028 Sep 2021
976thepharmadigest.comGoDaddy.com, LLC1 Oct 202012 Nov 20251 Oct 2026
977thepharmascout.comGoDaddy.com, LLC26 Mar 202420 Aug 202526 Mar 2026
978thepharmacistsfriend.comGoogle, Inc.5 Oct 202020 Sep 20255 Oct 2026
979thepharmacyshoppe.comGoDaddy.com, LLC6 Oct 202017 Dec 20246 Oct 2024
980thepharmafacts.comGoDaddy.com, LLC12 Oct 202012 Oct 202012 Oct 2021
981thepharmakart.comBigRock Solutions Ltd.12 Oct 202012 Oct 202012 Oct 2021
982thepharmacistmed.comGoDaddy.com, LLC14 Oct 202014 Oct 202014 Oct 2022
983thepharmacydisruptor.comGoDaddy.com, LLC14 Oct 202015 Oct 202514 Oct 2026
984thepharmacycreation.comHosting Concepts B.V. dba Openprovider16 Oct 202016 Oct 202016 Oct 2021
985thepharmamd.comGoDaddy.com, LLC20 Oct 202021 Oct 202420 Oct 2026
986thepharmagirl.comFastDomain Inc.20 Oct 202020 Oct 202020 Oct 2022
987thepharmaheroes.comGoDaddy.com, LLC30 Jul 202330 Jul 202330 Jul 2026
988thepharmaka.comGoogle, Inc.27 Oct 202027 Oct 202027 Oct 2021
989thepharmaka.netGoogle, Inc.27 Oct 202027 Oct 202027 Oct 2021
990thepharmacieshub.comTucows Domains Inc.3 Nov 20207 Nov 20223 Nov 2022
991thepharmacybw.comGoDaddy.com, LLC5 Nov 20206 Nov 20245 Nov 2026
992thepharmacy.ltdGoDaddy.com, LLC11 Nov 202011 Nov 202011 Nov 2021
993thepharmacyshowacademy.com1API GmbH12 Nov 202022 Nov 202512 Nov 2026
994thepharmacynow.comGoDaddy.com, LLC19 Nov 202019 Nov 202019 Nov 2022
995thepharmate.comGoDaddy.com, LLC30 May 202530 May 202530 May 2026
996thepharmacyclinics.comGoDaddy.com, LLC30 Nov 202011 Jan 202530 Nov 2024
997thepharmacytechnicianletter.comGoDaddy.com, LLC4 Dec 20204 Dec 20204 Dec 2021
998thepharmacy-dot.comTucows Domains Inc.7 Dec 202011 Dec 20227 Dec 2022
999thepharmacydot.comGoDaddy.com, LLC7 Dec 20208 Dec 20247 Dec 2026
1000thepharmapro.netLaunchpad, Inc.19 Dec 20207 Dec 202519 Dec 2026

Displaying 1,000 out of 1,661 domains starting with the keyword "THEPHARMA". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=thepharma

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now