Our database now contains whois records of 660 Million (660,556,621) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [660 Million Domains] $10,000 Details

Keyword: THEDIVINEFEM

Reverse Whois » KEYWORD [thedivinefem ]  { 159 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1thedivinefem.comBeijing Lanhai Jiye Technology Co., Ltd18 Oct 202320 Dec 202518 Oct 2025
2thedivinefem.usGoDaddy.com, LLC29 Jul 20214 Aug 202529 Jul 2026
3thedivinefem.loveGoDaddy.com, LLC8 Aug 202220 Aug 20238 Aug 2024
4thedivinefeminineflow.comGoDaddy.com, LLC20 Sep 202421 Sep 202520 Sep 2026
5thedivinefeminineproject.com1&1 Internet AG23 Mar 20202 Apr 202323 Mar 2024
6thedivinefemale.orgregister.com, Inc.24 Nov 201424 Nov 201424 Nov 2015
7thedivinefeminist.comTurnCommerce, Inc. DBA NameBright.com22 Apr 201816 Apr 202122 Apr 2026
8thedivinefemininecreativityexperience.comDreamHost, LLC4 Jun 20154 Jun 20154 Jun 2016
9thedivinefemme.comGoogle, Inc.13 Jun 202513 Jun 202513 Jun 2026
10thedivinefemininewithin.comGoDaddy.com, LLC10 Apr 202510 Apr 202510 Apr 2026
11thedivinefeminineisrising.comGoDaddy.com, LLC8 Feb 20258 Feb 20258 Feb 2028
12thedivinefeminineisrising.orgWild West Domains, LLC24 Apr 201624 Jun 201624 Apr 2018
13thedivinefemininesociety.comGoDaddy.com, LLC22 Jun 201622 Jun 201622 Jun 2017
14thedivinefemininespeak.comGoDaddy.com, LLC17 Jul 201617 Jul 202517 Jul 2027
15thedivinefemininespeaks.comGoDaddy.com, LLC16 Jul 201617 Jul 202516 Jul 2027
16thedivinefeminineacademy.comGoDaddy.com, LLC3 Dec 201314 Jan 20253 Dec 2024
17thedivinefemininehealer.comGoDaddy.com, LLC3 Oct 20111 Oct 20163 Oct 2017
18thedivinefeminineleadership.comKey-Systems GmbH10 Oct 201225 Sep 201710 Oct 2018
19thedivinefeminine.comGoDaddy.com, LLC4 Feb 20092 Jan 20254 Feb 2026
20thedivinefeminine.netNameCheap, Inc.21 Oct 20242 Dec 202521 Oct 2025
21thedivinefeminine.orgTucows Domains Inc.13 Nov 202217 Nov 202513 Nov 2026
22thedivinefeminineway.comGoDaddy.com, LLC23 Aug 202324 Aug 202523 Aug 2026
23thedivinefemininecenter.comGoDaddy.com, LLC29 Jan 201721 Dec 202529 Jan 2026
24thedivinefemininerise.comGoDaddy.com, LLC17 May 201717 May 201717 May 2018
25thedivinefemale.comGoDaddy.com, LLC13 Oct 202225 Dec 202313 Oct 2023
26thedivinefeminineapp.comGoDaddy.com, LLC18 Jun 201719 Jun 202318 Jun 2026
27thedivinefeminist.org1&1 Internet AG29 Jun 201713 Aug 202529 Jun 2026
28thedivinefemininetarot.netGoDaddy.com, LLC6 Jun 20246 Jun 20246 Jun 2027
29thedivinefeminine.co.uk-20 Mar 201720 Mar 201720 Mar 2018
30thedivinefeminine.designGoDaddy.com, LLC24 May 201824 May 201824 May 2019
31thedivinefeminine.infoGoDaddy.com, LLC23 Jun 201823 Jun 202023 Jun 2021
32thedivinefeminine.lifeGoDaddy.com, LLC28 May 202128 May 202328 May 2024
33thedivinefeminineboudoir.comGoDaddy.com, LLC3 Jul 20183 Jul 20183 Jul 2019
34thedivinefeminineyogaworkshop.comNameCheap, Inc.14 Aug 201814 Aug 201814 Aug 2019
35thedivinefemininedance.comTucows Domains Inc.13 Sep 201817 Sep 201913 Sep 2019
36thedivinefemininecollective.comFastDomain Inc.26 Jan 202111 Jan 202526 Jan 2026
37thedivinefeminineawakening.comGoDaddy.com, LLC29 Sep 201811 Dec 202429 Sep 2024
38thedivinefeminineexperiment.comGoDaddy.com, LLC30 Sep 201830 Sep 201830 Sep 2019
39thedivinefeminineempowermentcoach.com1&1 Internet AG19 Oct 201819 Oct 201819 Oct 2019
40thedivinefemininelife.com1&1 Internet AG23 Oct 201823 Oct 201823 Oct 2019
41thedivinefemininemother.comGoDaddy.com, LLC29 Oct 201829 Oct 201829 Oct 2019
42thedivinefeminineexperience.comGoDaddy.com, LLC28 May 20219 Aug 202428 May 2024
43thedivinefeminin3.comTucows Domains Inc.6 Nov 201810 Nov 20206 Nov 2020
44thedivinefeminineawakeningcircle.comGoDaddy.com, LLC16 Dec 201816 Dec 201816 Dec 2020
45thedivinefeminine1212.comAutomattic Inc.26 Jan 201926 Jan 201926 Jan 2020
46thedivinefemininewithinyou.comTucows Domains Inc.13 Mar 201917 Mar 202013 Mar 2020
47thedivinefemininebox.comRegister.it SPA12 Apr 201912 Apr 201911 Apr 2020
48thedivinefeminineuk.comregister.com, Inc.14 Apr 201914 Apr 201914 Apr 2020
49thedivinefeminist.lifeGoDaddy.com, LLC12 Jun 201912 Jun 201912 Jun 2020
50thedivinefeminine22.comGoDaddy.com, LLC12 Jul 201912 Jul 201912 Jul 2020
51thedivinefeminineinvitation.comGoDaddy.com, LLC15 Nov 201915 Nov 201915 Nov 2020
52thedivinefeminine.energyGoDaddy.com, LLC28 Apr 20239 Jun 202428 Apr 2024
53thedivinefeminineclub.comNameCheap, Inc.7 May 20257 May 20257 May 2026
54thedivinefemininepowercircle.comAscio Technologies, Inc. Danmark - Filial af Ascio…1 Mar 20201 Mar 20201 Mar 2021
55thedivinefemininity.comGoDaddy.com, LLC18 Oct 202518 Oct 202518 Oct 2028
56thedivinefeminine1.comGoogle, Inc.20 Mar 20201 May 202520 Mar 2025
57thedivinefeminineco.comTucows Domains Inc.20 Mar 202024 Mar 202120 Mar 2021
58thedivinefeminine.clubGoDaddy.com, LLC8 Apr 20208 May 20248 Apr 2024
59thedivinefeminineshop.comTucows Domains Inc.23 Apr 201927 Apr 202023 Apr 2020
60thedivinefemininexoxo.comGoogle, Inc.2 May 20202 May 20202 May 2021
61thedivinefemininejewelryline.comGoDaddy.com, LLC18 May 202018 May 202018 May 2021
62thedivinefemininefrequency.comTucows Domains Inc.4 Aug 20254 Aug 20254 Aug 2026
63thedivinefemininecode.comGoDaddy.com, LLC30 Mar 202530 Mar 202530 Mar 2027
64thedivinefemininecodex.comGoDaddy.com, LLC5 May 20246 May 20255 May 2026
65thedivinefeminineschool.comGoDaddy.com, LLC24 Jul 202025 Jul 202524 Jul 2026
66thedivinefemininecorecode.comGoDaddy.com, LLC2 Sep 20202 Sep 20202 Sep 2021
67thedivinefemininecodes.comSynergy Wholesale Pty Ltd16 Nov 20202 Nov 202516 Nov 2026
68thedivinefeminine.loveGoDaddy.com, LLC8 Dec 202029 Dec 20238 Dec 2023
69thedivinefemininenetwork.comGoDaddy.com, LLC5 Jan 20215 Jan 20215 Jan 2022
70thedivinefemininedances.comGoDaddy.com, LLC21 Jan 20218 May 202321 Jan 2024
71thedivinefempire.comGoogle, Inc.1 Mar 202114 Feb 20251 Mar 2026
72thedivinefeminineboutique.comTucows Domains Inc.6 Mar 202116 Apr 20256 Mar 2025
73thedivinefeminine.storeDOTSERVE INC.19 Jun 20251 Jul 202519 Jun 2026
74thedivinefeminineceo.comGoDaddy.com, LLC14 Mar 202114 Mar 202114 Mar 2022
75thedivinefemininewarrior.comGoogle, Inc.8 May 20219 May 20238 May 2024
76thedivinefemininewarrior.netGoogle, Inc.8 May 20219 May 20238 May 2024
77thedivinefeminineisntmale.comGoogle, Inc.5 Jul 20215 Jul 20215 Jul 2022
78thedivinefemininerising.comGoDaddy.com, LLC7 Jul 20257 Jul 20257 Jul 2026
79thedivinefemininetribe.comGoDaddy.com, LLC21 Aug 20214 Sep 202521 Aug 2026
80thedivinefemininevibe.comGoDaddy.com, LLC21 Aug 20214 Sep 202521 Aug 2026
81thedivinefemininegoddess.comGoDaddy.com, LLC9 Sep 202121 Oct 20249 Sep 2024
82thedivinefemininehealing.comGoDaddy.com, LLC28 Sep 202129 Sep 202128 Sep 2022
83thedivinefemininetarot.onlineGoDaddy.com, LLC10 Oct 202110 Oct 202110 Oct 2022
84thedivinefemmetribe.comGoDaddy.com, LLC23 Oct 202123 Oct 202123 Oct 2022
85thedivinefemininebrow.comGoDaddy.com, LLC10 Nov 202122 Dec 202310 Nov 2023
86thedivinefeminineart.comTucows Domains Inc.9 Apr 202220 Jun 20239 Apr 2023
87thedivinefemininenft.netGoDaddy.com, LLC17 Apr 202228 Jun 202417 Apr 2024
88thedivinefemininenft.artNameKing.com Inc.10 Jul 202324 Aug 202410 Jul 2024
89thedivinefeminineagenda.com1&1 Internet AG25 May 20227 Jul 202425 May 2024
90thedivinefeminineembodiment.comNameCheap, Inc.29 Jun 202230 May 202329 Jun 2024
91thedivinefemininemastermind.comGoDaddy.com, LLC16 Jul 202227 Aug 202416 Jul 2024
92thedivinefemininetarot.comGoDaddy.com, LLC6 Jun 20246 Jun 20246 Jun 2027
93thedivinefemininetemple.comDomain.com, LLC8 Nov 202221 Jan 20258 Nov 2024
94thedivinefemininerealm.comGoDaddy.com, LLC15 Nov 202227 Jan 202415 Nov 2023
95thedivinefeminineradiance.comGoogle, Inc.7 Dec 20227 Dec 20237 Dec 2024
96thedivinefemin.istGoDaddy.com, LLC15 Dec 202127 Dec 202315 Dec 2024
97thedivinefeminine.onlineCrazy Domains FZ-LLC4 Jan 20235 Jan 20244 Jan 2025
98thedivinefeminin.comGoDaddy.com, LLC13 Jan 202323 Feb 202513 Jan 2025
99thedivinefemininee.comTucows Domains Inc.13 Jan 202317 Jan 202413 Jan 2025
100thedivinefemininejourney.comGoogle, Inc.1 Feb 202317 Jan 20251 Feb 2026
101thedivinefemininemovement.comGoDaddy.com, LLC15 Jul 201715 Jul 202515 Jul 2026
102thedivinefemininestudio.comGoDaddy.com, LLC12 Feb 202326 Mar 202512 Feb 2025
103thedivinefemmepodcast.comWix.com Ltd.28 Sep 20208 Dec 202328 Sep 2023
104thedivinefemmeinstitute.comNameCheap, Inc.1 Jan 20215 Dec 20241 Jan 2026
105thedivinefeministshaman.comGoogle, Inc.22 Mar 202322 Mar 202322 Mar 2024
106thedivinefeminineshaman.comGoogle, Inc.22 Mar 20233 May 202522 Mar 2025
107thedivinefeminine.com.au--24 Apr 2025-
108thedivinefemininealliance.comGoDaddy.com, LLC20 Jun 202131 Jul 202320 Jun 2023
109thedivinefemininecandles.com1&1 Internet AG31 Mar 202313 May 202531 Mar 2025
110thedivinefemininellc.comGoDaddy.com, LLC16 Nov 202128 Jan 202516 Nov 2024
111thedivinefeminine222.comWix.com Ltd.2 Feb 202215 Mar 20232 Feb 2023
112thedivinefemininereset.comGoDaddy.com, LLC15 Feb 202228 Apr 202415 Feb 2024
113thedivinefeminines.comWild West Domains, LLC9 Mar 202221 May 20249 Mar 2024
114thedivinefeminineenergy.comWix.com Ltd.24 Mar 20223 Jun 202424 Mar 2024
115thedivinefeminineandmasculineawakening.comGoDaddy.com, LLC30 Mar 202230 Mar 202530 Mar 2026
116thedivinefemininenft.comGoDaddy.com, LLC17 Apr 202217 Apr 202517 Apr 2026
117thedivinefeminineaesthetics.comGoDaddy.com, LLC1 Jun 202218 Jun 20251 Jun 2026
118thedivinefemininebalance.comGoDaddy.com, LLC16 Apr 202328 Jun 202416 Apr 2024
119thedivinefeminineworkbalance.comGoDaddy.com, LLC16 Apr 202328 Jun 202416 Apr 2024
120thedivinefemininechannel.comTucows Domains Inc.24 Apr 20234 Jun 202424 Apr 2024
121thedivinefemi9.comSquarespace Domains LLC2 Oct 202413 Nov 20252 Oct 2025
122thedivinefemenine.comSoluciones Corporativas IP, SLU26 Apr 202328 Apr 202426 Apr 2025
123thedivinefeminineproject.org1&1 Internet AG23 Mar 202022 Apr 202323 Mar 2024
124thedivinefeminineacademy.orgWild West Domains, LLC21 Dec 202021 Dec 202521 Dec 2026
125thedivinefemininewarrior.orgGoogle, Inc.8 May 20218 May 20238 May 2024
126thedivinefemininecircle.comGoDaddy.com, LLC28 Apr 202310 May 202428 Apr 2025
127thedivinefeminineglow.comGoDaddy.com, LLC30 Apr 202311 Jun 202530 Apr 2025
128thedivinefemininesenergy.comregister.com, Inc.12 Jul 202324 Aug 202412 Jul 2024
129thedivinefeminine-cyclesyncing.com1API GmbH14 Jul 202327 Aug 202414 Jul 2024
130thedivinefemalerevolution.comSibername Internet and Software Technologies Inc.15 Jul 202310 Jul 202515 Jul 2026
131thedivinefemininemystique.comCloudFlare, Inc.6 Nov 20237 Oct 20256 Nov 2026
132thedivinefeminineblog.co.ukYour Domain LLC25 Dec 202325 Dec 202325 Dec 2024
133thedivinefemininepower.comGoDaddy.com, LLC19 Mar 202419 Mar 202419 Mar 2027
134thedivinefemme.storeTucows Domains Inc.1 Apr 202412 May 20251 Apr 2025
135thedivinefemininepodcast.comGoDaddy.com, LLC7 Apr 20247 Apr 20247 Apr 2027
136thedivinefemininepreloved.boutiqueGoDaddy.com, LLC8 May 202419 Jul 20258 May 2025
137thedivinefeminineprelovedboutique.comGoDaddy.com, LLC8 May 202420 Jul 20258 May 2025
138thedivinefemininetarot.orgGoDaddy.com, LLC6 Jun 202411 Jun 20246 Jun 2027
139thedivinefeminists.comGoDaddy.com, LLC9 Jun 202421 Jul 20259 Jun 2025
140thedivinefeminine.shopGoDaddy.com, LLC14 Jun 202411 Jul 202414 Jun 2025
141thedivinefeminineastrology.comGoDaddy.com, LLC18 Jun 202430 Aug 202518 Jun 2025
142thedivinefemininerevolution.comWix.com Ltd.4 Aug 20245 Jul 20254 Aug 2026
143thedivinefemininesoul.com1&1 Internet AG23 Aug 202423 Aug 202423 Aug 2026
144thedivinefeminineblueprint.comGoDaddy.com, LLC14 Dec 202514 Dec 202514 Dec 2026
145thedivinefeminineleader.comGoDaddy.com, LLC26 Sep 202427 Sep 202526 Sep 2026
146thedivinefemmes.comGoDaddy.com, LLC7 Oct 20248 Oct 20257 Oct 2026
147thedivinefemininecollective.com.au--24 Jul 2025-
148thedivinefemininefestival.comSquarespace Domains LLC1 Nov 202417 Oct 20251 Nov 2026
149thedivinefeminineshamanacademy.comGoDaddy.com, LLC7 Nov 20248 Nov 20257 Nov 2026
150thedivinefeminine.blogTucows Domains Inc.12 Nov 202416 Nov 202512 Nov 2026
151thedivinefeminineapothecary.comTucows Domains Inc.23 Nov 202424 Nov 202523 Nov 2026
152thedivinefemme.shopTucows Domains Inc.6 Jan 202510 Mar 20256 Jan 2026
153thedivinefemmecode.com1&1 Internet AG12 Mar 202524 May 202512 Mar 2027
154thedivinefemininebirthingcare.comGoogle, Inc.27 Mar 202527 Mar 202527 Mar 2026
155thedivinefemmespodcast.comSquarespace Domains LLC22 Apr 20251 Jul 202522 Apr 2031
156thedivinefemininerescue.comGoDaddy.com, LLC26 May 202526 May 202526 May 2026
157thedivinefemininealchemist.comGoDaddy.com, LLC26 Jun 202526 Jun 202526 Jun 2026
158thedivinefeminine.uk-25 Jun 202525 Jun 202525 Jun 2026
159thedivinefeminine.meNameCheap, Inc.29 Jul 20253 Aug 202529 Jul 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=thedivinefem

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now