With support for 
Keyword: TEKSTI
Reverse Whois » KEYWORD [teksti ] { 2,113 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | teksti.work | GoDaddy.com, LLC | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 2 | teksti.com | GoDaddy.com, LLC | 2 May 1999 | 3 May 2024 | 2 May 2025 |
| 3 | teksti.net | GoDaddy.com, LLC | 2 May 1999 | 3 May 2024 | 2 May 2025 |
| 4 | teksti.xyz | Hostinger, UAB | 11 Dec 2016 | 10 Feb 2017 | 11 Dec 2018 |
| 5 | teksti.site | Limited Liability Company "Registrar of domain nam… | 21 Feb 2022 | 1 May 2023 | 21 Feb 2023 |
| 6 | teksti.pl | - | 16 Nov 2016 | 7 Aug 2023 | 16 Nov 2024 |
| 7 | teksti.ai | - | - | - | - |
| 8 | teksti.ru | - | 7 May 2005 | - | 7 May 2024 |
| 9 | tekstils.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Jul 2018 | 5 Jul 2023 | 20 Jul 2024 |
| 10 | tekstilportal.com | OnlineNIC, Inc. | 18 Apr 2002 | 17 Mar 2024 | 18 Apr 2026 |
| 11 | tekstilladen.dk | - | 23 Nov 2008 | - | 31 May 2024 |
| 12 | tekstilkentbilgisayar.net | Realtime Register B.V. | 9 Aug 2009 | 9 Aug 2017 | 9 Aug 2018 |
| 13 | tekstiller.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 24 Feb 2024 | 24 Feb 2024 | 24 Feb 2025 |
| 14 | tekstildokuma.com | FBS Inc. | 26 Jan 2016 | 19 May 2017 | 26 Jan 2018 |
| 15 | tekstil-kiev.com.ua | - | - | - | - |
| 16 | tekstilbank.com.tr | - | 2 Oct 1996 | - | 1 Oct 2017 |
| 17 | tekstilbayi.com | IHS Telekom, Inc. | 13 Nov 2019 | 27 Jul 2023 | 13 Nov 2024 |
| 18 | tekstilevim.com | Reg2C.com Inc. | 26 Mar 2010 | 25 Mar 2024 | 26 Mar 2025 |
| 19 | tekstilforum.no | - | 1 Oct 2010 | 1 Oct 2010 | - |
| 20 | tekstilkent.com.tr | - | 22 May 2003 | - | 21 May 2018 |
| 21 | tekstilnastampa.com | Name.com, Inc. | 13 Jan 2015 | 22 Dec 2023 | 13 Jan 2025 |
| 22 | tekstilsa.com | Hostinger, UAB | 8 Jul 2023 | 7 Sep 2023 | 8 Jul 2024 |
| 23 | tekstiltekstil.com | IHS Telekom, Inc. | 21 Jun 2014 | 18 Oct 2023 | 21 Jun 2024 |
| 24 | tekstilworld.com | Tucows Domains Inc. | 24 Feb 2016 | 28 Feb 2017 | 24 Feb 2017 |
| 25 | tekstile.ru | - | 18 Jun 2003 | - | 18 Jun 2024 |
| 26 | tekstil-grad.ru | - | 25 May 2021 | - | 25 May 2025 |
| 27 | tekstil-vsem.ru | - | 28 Oct 2013 | - | 28 Oct 2024 |
| 28 | tekstilnyj-dizajn.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2010 | 16 Apr 2024 | 20 Apr 2025 |
| 29 | tekstildershanesi.com.tr | - | 26 Mar 2012 | - | 25 Mar 2016 |
| 30 | tekstil-house.ru | - | 26 Apr 2007 | - | 26 Apr 2025 |
| 31 | tekstilka5.ru | - | - | - | - |
| 32 | tekstildunyasi.com | GoDaddy.com, LLC | 19 Oct 2023 | 20 Dec 2023 | 19 Oct 2024 |
| 33 | tekstilcaddesi.biz | GoDaddy.com, LLC | 1 May 2014 | 13 Jun 2019 | 30 Apr 2020 |
| 34 | tekstilx.com | Reg2C.com Inc. | 25 Oct 2023 | 25 Dec 2023 | 25 Oct 2024 |
| 35 | tekstilbul.com | Ä°simtescil BiliÅŸim A.Åž. | 10 Jan 2021 | 21 Dec 2022 | 10 Jan 2025 |
| 36 | tekstila.com | eNom, Inc. | 1 Jun 2009 | 5 Jul 2023 | 1 Jun 2024 |
| 37 | tekstiles.com | eNom, Inc. | 18 Apr 2012 | 17 Apr 2024 | 18 Apr 2025 |
| 38 | tekstis.com | eNom, Inc. | 25 Apr 2010 | 11 May 2017 | 25 Apr 2018 |
| 39 | tekstili.com | eNom, Inc. | 13 Jul 2009 | 5 Aug 2023 | 13 Jul 2024 |
| 40 | tekstilmarketim.com | Web Commerce Communications Limited dba WebNic.cc | 14 Nov 2022 | 24 Dec 2023 | 14 Nov 2024 |
| 41 | tekstilmodeltoptan.com | - | 21 Apr 2023 | 22 Apr 2024 | 21 Apr 2025 |
| 42 | tekstilinfo.com | GoDaddy.com, LLC | 2 Aug 2010 | 16 Sep 2022 | 2 Aug 2024 |
| 43 | tekstille.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Oct 2014 | 1 Dec 2017 | 30 Oct 2018 |
| 44 | tekstilbox.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Oct 2014 | 2 Oct 2020 | 11 Oct 2025 |
| 45 | tekstilbox.net | Key-Systems GmbH | 11 Oct 2014 | 12 Oct 2016 | 11 Oct 2017 |
| 46 | tekstilmakinesi.com | GoDaddy.com, LLC | 4 Jul 2009 | 18 Jul 2023 | 4 Jul 2024 |
| 47 | tekstilpromosyon.com | GoDaddy.com, LLC | 5 Jul 2009 | 18 Jul 2023 | 5 Jul 2024 |
| 48 | tekstilspot.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Apr 2023 | 10 Apr 2024 | 9 Apr 2025 |
| 49 | tekstiviesti.net | Domain.com, LLC | 10 Jun 2001 | 13 Jun 2015 | 10 Jun 2016 |
| 50 | tekstiviestit.net | - | - | - | - |
| 51 | tekstilmerkezdeposu.com | Wild West Domains, LLC | 8 Jun 2012 | 9 Jun 2015 | 8 Jun 2016 |
| 52 | tekstilmerkezdeposu.net | Wild West Domains, LLC | 8 Jun 2012 | 9 Jun 2015 | 8 Jun 2016 |
| 53 | tekstilmalzemem.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 54 | tekstil-deri-urunleri.info | GoDaddy.com, LLC | 12 Jun 2013 | 12 Jun 2015 | 12 Jun 2016 |
| 55 | tekstilesmykker.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 17 Aug 2014 | 12 Jan 2018 | 17 Aug 2018 |
| 56 | tekstilhavlubornozstok.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 57 | tekstilnetbeta.net | FBS Inc. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 58 | tekstilmalzemem.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 59 | tekstilan.net | FBS Inc. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 60 | tekstilmakinam.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 4 Jun 2020 | 5 Jun 2023 | 4 Jun 2024 |
| 61 | tekstilemagaza.com | Namesilo, LLC | 17 Oct 2018 | 18 Oct 2018 | 17 Oct 2019 |
| 62 | tekstilemarket.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 63 | tekstilexpressen.com | Key-Systems GmbH | 20 Aug 2014 | 21 Aug 2016 | 20 Aug 2017 |
| 64 | tekstilkentonline.com | IHS Telekom, Inc. | 12 Feb 2021 | 12 Feb 2021 | 12 Feb 2022 |
| 65 | tekstilderidanismanlik.com | Wild West Domains, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 66 | tekstilhavakanali.com | FBS Inc. | 22 Aug 2014 | 5 Aug 2017 | 22 Aug 2018 |
| 67 | tekstilhavakanallari.com | FBS Inc. | 22 Aug 2014 | 5 Aug 2017 | 22 Aug 2018 |
| 68 | tekstilpromosyonu.net | eNom, Inc. | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 69 | tekstilyazilimlari.com | Reg2C.com Inc. | 13 Aug 2014 | 21 Aug 2023 | 13 Aug 2024 |
| 70 | tekstilyedekparca.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 14 Aug 2014 | 8 Aug 2023 | 14 Aug 2024 |
| 71 | tekstilkatalogu.com | FBS Inc. | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2016 |
| 72 | tekstilkobi.com | Reg2C.com Inc. | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 73 | tekstilmakinaci.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 74 | tekstilsepeti.net | IHS Telekom, Inc. | 27 Apr 2023 | 27 Apr 2024 | 27 Apr 2024 |
| 75 | tekstilodasi.com | FBS Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 76 | tekstilcanta.com | Network Solutions, LLC | 4 Oct 2023 | 8 Jan 2024 | 4 Oct 2024 |
| 77 | tekstilrota.com | IHS Telekom, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 78 | tekstilistan.com | FBS Inc. | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 79 | tekstilnerede.com | FBS Inc. | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 80 | tekstiltransferkagidi.com | Tucows Domains Inc. | 14 Nov 2014 | 18 Nov 2015 | 14 Nov 2016 |
| 81 | tekstilkonfeksiyon.com | Ä°simtescil BiliÅŸim A.Åž. | 14 Nov 2014 | 13 Nov 2023 | 14 Nov 2024 |
| 82 | tekstilall.com | Google, Inc. | 7 Dec 2021 | 7 Dec 2021 | 7 Dec 2022 |
| 83 | tekstilgeridonusum.com | - | 6 Aug 2017 | 14 Jun 2023 | 6 Aug 2024 |
| 84 | tekstilatolyesi.biz | NameKing.com Inc. | 22 Jul 2021 | 22 Jul 2021 | 22 Jul 2022 |
| 85 | tekstilistanbul.com | FBS Inc. | 15 Sep 2014 | 30 Dec 2021 | 15 Sep 2025 |
| 86 | tekstilkonfeksiyon.net | Ä°simtescil BiliÅŸim A.Åž. | 14 Nov 2014 | 13 Nov 2023 | 14 Nov 2024 |
| 87 | tekstilbilet.com | Tucows Domains Inc. | 14 Nov 2012 | 18 Nov 2017 | 14 Nov 2017 |
| 88 | tekstilnet.com | TurnCommerce, Inc. DBA NameBright.com | 21 Nov 2015 | 15 Nov 2020 | 21 Nov 2024 |
| 89 | tekstitys.com | NameCheap, Inc. | 20 Mar 2023 | 11 Mar 2024 | 20 Mar 2025 |
| 90 | tekstilmembran.net | IHS Telekom, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 91 | tekstil-makina.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 21 Mar 2022 | 7 Nov 2023 | 21 Mar 2025 |
| 92 | tekstilpiyasasi.com | Reg2C.com Inc. | 18 Oct 2023 | 18 Dec 2023 | 18 Oct 2024 |
| 93 | tekstipaja.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 19 Sep 2014 | 17 Aug 2017 | 19 Sep 2020 |
| 94 | tekstiko.com | Hosting Concepts B.V. dba Openprovider | 29 Dec 1998 | 29 Dec 2023 | 29 Dec 2024 |
| 95 | tekstilkentcilingir.com | Hosting Concepts B.V. dba Openprovider | 20 Sep 2014 | 22 Aug 2023 | 20 Sep 2024 |
| 96 | tekstilbilet.org | Tucows Domains Inc. | 14 Nov 2012 | 18 Nov 2017 | 14 Nov 2018 |
| 97 | tekstilkentte.com | Web Commerce Communications Limited dba WebNic.cc | 18 Nov 2014 | 9 Nov 2018 | 18 Nov 2024 |
| 98 | tekstilexport.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2016 |
| 99 | tekstilexpo.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2016 |
| 100 | tekstilsoft.com | - | 5 Oct 2022 | 6 Oct 2023 | 5 Oct 2024 |
| 101 | tekstillaleli.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 19 Sep 2023 | 19 Sep 2023 | 19 Sep 2024 |
| 102 | tekstilsemp2015.com | OnlineNIC, Inc. | 3 Oct 2014 | 5 Oct 2016 | 3 Oct 2017 |
| 103 | tekstilexport.net | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 104 | tekstilexpo.net | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 105 | tekstiltasarimkursu.com | Name.com, Inc. | 21 Sep 2014 | 17 Sep 2017 | 21 Sep 2018 |
| 106 | tekstilrulmanlari.com | FastDomain Inc. | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 107 | tekstilaksesuar.net | Dynadot, LLC | 4 Apr 2022 | 4 Apr 2023 | 4 Apr 2024 |
| 108 | tekstilsilikonlari.com | IHS Telekom, Inc. | 21 Nov 2014 | 9 Nov 2016 | 21 Nov 2017 |
| 109 | tekstilhaber.com | IHS Telekom, Inc. | 6 Feb 2020 | 1 Feb 2024 | 6 Feb 2025 |
| 110 | tekstildeisvar.com | IHS Telekom, Inc. | 21 Nov 2014 | 17 Apr 2017 | 21 Nov 2021 |
| 111 | tekstilcarsi.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Sep 2022 | 11 Sep 2023 | 11 Sep 2024 |
| 112 | tekstilinnsamling.org | Realtime Register B.V. | 25 Sep 2014 | 31 Aug 2023 | 25 Sep 2024 |
| 113 | tekstilendustrigazetesi.com | Tucows Domains Inc. | 5 Oct 2012 | 8 Feb 2024 | 5 Oct 2024 |
| 114 | tekstil-doma.com | Regional Network Information Center, JSC dba RU-CE… | 27 Sep 2013 | 29 Sep 2014 | 27 Sep 2015 |
| 115 | tekstilmagazalari.net | IHS Telekom, Inc. | 21 Nov 2014 | 23 Dec 2016 | 21 Nov 2017 |
| 116 | tekstildeisvar.net | IHS Telekom, Inc. | 21 Nov 2014 | 17 Apr 2017 | 21 Nov 2021 |
| 117 | tekstilglobal.com | BigRock Solutions Ltd. | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 118 | tekstilgerme.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 119 | tekstillaserkesim.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 25 Sep 2014 | 27 Sep 2014 | 25 Sep 2015 |
| 120 | tekstilinnsamling.com | Realtime Register B.V. | 25 Sep 2014 | 26 Aug 2023 | 25 Sep 2024 |
| 121 | tekstil-sonya.com | Regional Network Information Center, JSC dba RU-CE… | 29 Jun 2014 | 12 Oct 2014 | 28 Jun 2024 |
| 122 | tekstilniydom.com | Regional Network Information Center, JSC dba RU-CE… | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 123 | tekstihait.net | Wild West Domains, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 124 | tekstilmeslek.com | FBS Inc. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 125 | tekstimuzika.com | Instra Corporation Pty Ltd. | 25 Nov 2014 | 8 Nov 2023 | 25 Nov 2024 |
| 126 | tekstilwebsitesi.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 127 | tekstilgiyimtoptan.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 128 | tekstilisadamlari.com | FBS Inc. | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 129 | tekstilfuarstandlari.com | IHS Telekom, Inc. | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 130 | tekstilkenttesatilik.com | IHS Telekom, Inc. | 27 Feb 2017 | 29 Apr 2017 | 27 Feb 2018 |
| 131 | tekstilkenttekiralik.com | IHS Telekom, Inc. | 27 Feb 2017 | 29 Apr 2017 | 27 Feb 2018 |
| 132 | tekstilkenttedekorasyon.com | IHS Telekom, Inc. | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 133 | tekstilshopping.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 134 | tekstilbayim.com | IHS Telekom, Inc. | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 135 | tekstilimiz.com | FBS Inc. | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 136 | tekstilticareti.com | Tucows Domains Inc. | 16 Dec 2014 | 20 Dec 2016 | 16 Dec 2016 |
| 137 | tekstilbk.com | Marcaria.com International, Inc. | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 138 | tekstilimiz.org | FBS Inc. | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 139 | tekstilimiz.net | FBS Inc. | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 140 | tekstilbebe.com | GoDaddy.com, LLC | 26 May 2016 | 26 May 2016 | 26 May 2017 |
| 141 | tekstilticareti.net | Tucows Domains Inc. | 16 Dec 2014 | 20 Dec 2016 | 16 Dec 2016 |
| 142 | tekstilmagazalari.com | IHS Telekom, Inc. | 24 Apr 2024 | 24 Apr 2024 | 24 Apr 2025 |
| 143 | tekstilborsasi.com | GoDaddy.com, LLC | 10 Sep 2021 | 21 Dec 2023 | 10 Sep 2025 |
| 144 | tekstilbebe.org | FBS Inc. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 145 | tekstilbebe.net | FBS Inc. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 146 | tekstiltemizuretim.com | Bizcn.com, Inc. | 15 Dec 2011 | 22 Dec 2014 | 15 Dec 2015 |
| 147 | tekstilkalip.com | Alantron BiliÅŸim Ltd Åžti. | 22 Dec 2014 | 22 Jan 2024 | 22 Dec 2024 |
| 148 | tekstilcizade.com | FBS Inc. | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 149 | tekstilbulvari.com | GoDaddy.com, LLC | 1 Jun 2018 | 1 Jun 2018 | 1 Jun 2019 |
| 150 | tekstilaksesuarlar.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 3 Jul 2017 | 1 Nov 2020 | 3 Jul 2026 |
| 151 | tekstilcarsim.com | IHS Telekom, Inc. | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 152 | tekstilbursada.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 153 | tekstilkolik.com | Tucows Domains Inc. | 25 Dec 2013 | 29 Dec 2014 | 25 Dec 2015 |
| 154 | tekstilkentemlakofisi.com | FBS Inc. | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 155 | tekstilligi.com | Reg2C.com Inc. | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 156 | tekstilcup.com | Reg2C.com Inc. | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 157 | tekstil.moda | united-domains AG | 16 Jul 2014 | 10 Jan 2017 | 16 Jul 2017 |
| 158 | tekstil.company | Tucows Domains Inc. | 13 Jun 2014 | 17 Jun 2015 | 13 Jun 2016 |
| 159 | tekstil.guru | Name.com, Inc. | 19 Sep 2017 | 30 Aug 2023 | 19 Sep 2024 |
| 160 | tekstilyikama.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 14 Nov 2023 | 14 Nov 2023 | 14 Nov 2024 |
| 161 | tekstil.website | Limited Liability Company "Registrar of domain nam… | 9 Jul 2019 | 9 Jul 2020 | 9 Jul 2021 |
| 162 | tekstil.market | Automattic Inc. | 5 Mar 2023 | 8 Sep 2023 | 5 Mar 2025 |
| 163 | tekstilci.kim | FBS Inc. | 30 Nov 2014 | - | 30 Nov 2015 |
| 164 | tekstil.moscow | Regional Network Information Center, JSC dba RU-CE… | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 165 | tekstil.xyz | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 12 Sep 2022 | 31 Aug 2023 | 12 Sep 2024 |
| 166 | tekstil.kim | Nics Telekomünikasyon Ticaret Ltd. Şti. | 25 Oct 2017 | - | 25 Oct 2018 |
| 167 | tekstilrehberi.xyz | FBS Inc. | 8 Feb 2015 | 8 Feb 2015 | 8 Feb 2016 |
| 168 | tekstilkent.work | FBS Inc. | 18 Feb 2015 | - | 18 Feb 2016 |
| 169 | tekstil.nyc | CCI REG S.A. | 4 Mar 2015 | - | 3 Mar 2016 |
| 170 | tekstilkurslari.com | - | 25 Mar 2018 | 18 Mar 2024 | 25 Mar 2025 |
| 171 | tekstilsektor.com | Reg2C.com Inc. | 5 Jan 2011 | 6 Jan 2015 | 5 Jan 2016 |
| 172 | tekstilbazaar.com | Realtime Register B.V. | 12 Jul 2023 | 12 Jul 2023 | 12 Jul 2024 |
| 173 | tekstilstandlari.com | Network Solutions, LLC | 14 Aug 2015 | 12 Aug 2016 | 14 Aug 2017 |
| 174 | tekstilstok.com | IHS Telekom, Inc. | 21 Oct 2016 | 13 Mar 2024 | 21 Oct 2024 |
| 175 | tekstilbutik.com | Ä°simtescil BiliÅŸim A.Åž. | 29 Dec 2016 | 16 Dec 2023 | 29 Dec 2024 |
| 176 | tekstilurunleri.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 29 Dec 2016 | 8 Jan 2018 |
| 177 | tekstilya.com | GMO Internet Inc. | 28 Mar 2023 | 9 May 2024 | 28 Mar 2024 |
| 178 | tekstilmarkalari.com | Google, Inc. | 1 Dec 2022 | 2 Dec 2023 | 1 Dec 2024 |
| 179 | tekstiluzb.biz | NameKing.com Inc. | 19 Jul 2021 | 22 Jul 2021 | 19 Jul 2022 |
| 180 | tekstilprinting.com | register.com, Inc. | 15 Aug 2015 | 10 Jul 2016 | 15 Aug 2017 |
| 181 | tekstilshchikihotels.review | Alpnames Limited | 2 Jul 2015 | - | 1 Jul 2016 |
| 182 | tekstilbank.xyz | FBS Inc. | 1 Aug 2015 | 2 Aug 2015 | 1 Aug 2016 |
| 183 | tekstilshchiki.accountant | Alpnames Limited | 7 Aug 2015 | - | 6 Aug 2016 |
| 184 | tekstilantalya.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2017 |
| 185 | tekstiletiketcisi.com | FBS Inc. | 17 Aug 2015 | 26 May 2017 | 17 Aug 2017 |
| 186 | tekstilimalatim.com | FBS Inc. | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2016 |
| 187 | tekstil-holl.com | DNSPod, Inc. | 12 Nov 2020 | 12 Nov 2020 | 12 Nov 2021 |
| 188 | tekstilaksesuarlari.net | Reg2C.com Inc. | 21 Jan 2015 | 7 Jan 2020 | 21 Jan 2025 |
| 189 | tekstilbahcesi.com | GoDaddy.com, LLC | 20 Mar 2021 | 22 Mar 2021 | 20 Mar 2022 |
| 190 | tekstilpenceresi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Jan 2015 | 30 Jan 2017 | 30 Jan 2018 |
| 191 | tekstilshop.net | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 28 Jan 2013 | 17 Feb 2024 | 28 Jan 2025 |
| 192 | tekstilnet.net | Namesilo, LLC | 4 Apr 2024 | 4 Apr 2024 | 4 Apr 2025 |
| 193 | tekstilsax.com | GoDaddy.com, LLC | 31 Jan 2015 | 27 Jan 2024 | 31 Jan 2025 |
| 194 | tekstilciyiz.net | FBS Inc. | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 195 | tekstilatiklarigeridonusum.com | FBS Inc. | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 196 | tekstiltavan.com | FBS Inc. | 23 Jun 2017 | 23 Jun 2017 | 23 Jun 2018 |
| 197 | tekstilkentperde.com | FBS Inc. | 5 Feb 2015 | 21 Oct 2019 | 5 Feb 2025 |
| 198 | tekstilimalati.com | GMO Internet Inc. | 20 Aug 2015 | 23 Jul 2017 | 20 Aug 2018 |
| 199 | tekstil37opt.com | Network Solutions, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 200 | tekstil-sarteks.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 11 Feb 2015 | 16 Jan 2024 | 11 Feb 2025 |
| 201 | tekstilyazilim.com | FBS Inc. | 14 Sep 2016 | 24 Oct 2017 | 14 Sep 2017 |
| 202 | tekstiluretim.com | GoDaddy.com, LLC | 14 Sep 2023 | 14 Sep 2023 | 14 Sep 2024 |
| 203 | tekstilcinburada.com | FBS Inc. | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2016 |
| 204 | tekstiliz.com | TLDs LLC dba SRSplus | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 205 | tekstils.net | Dynadot, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 206 | tekstil16.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 207 | tekstillab.com | Tucows Domains Inc. | 15 Feb 2013 | 23 Feb 2024 | 15 Feb 2025 |
| 208 | tekstiluretimprogrami.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 19 Feb 2015 | 19 Feb 2024 | 19 Feb 2025 |
| 209 | tekstilotomasyonprogram.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 19 Feb 2015 | 19 Feb 2024 | 19 Feb 2025 |
| 210 | tekstildemoda.com | Everyones Internet, Ltd. dba SoftLayer | 12 Feb 2013 | 19 Feb 2016 | 12 Feb 2017 |
| 211 | tekstilbutik.net | FBS Inc. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2017 |
| 212 | tekstilsarisayfalar.com | GoDaddy.com, LLC | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2016 |
| 213 | tekstilcim.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 5 Jul 2018 | 9 Jul 2023 | 5 Jul 2024 |
| 214 | tekstilvitrini.com | Tucows Domains Inc. | 23 Feb 2015 | 2 Feb 2017 | 23 Feb 2018 |
| 215 | tekstilvadisi.com | Ä°simtescil BiliÅŸim A.Åž. | 16 Jan 2021 | 17 Nov 2022 | 16 Jan 2025 |
| 216 | tekstilvitrini.net | IHS Telekom, Inc. | 20 May 2016 | 23 May 2017 | 20 May 2018 |
| 217 | tekstilok.com | OnlineNIC, Inc. | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 218 | tekstildenizliden.com | FBS Inc. | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 219 | tekstildenizli.com | Hosting Concepts B.V. dba Openprovider | 28 Feb 2021 | 1 Feb 2024 | 28 Feb 2025 |
| 220 | tekstilatiklarigeridonusum.net | FBS Inc. | 26 Feb 2015 | 19 May 2017 | 26 Feb 2018 |
| 221 | tekstilciyim.com | Ä°simtescil BiliÅŸim A.Åž. | 18 Jul 2022 | 23 Jul 2023 | 18 Jul 2024 |
| 222 | tekstilnetcreative.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 223 | tekstilmurekkebi.com | Tucows Domains Inc. | 6 Mar 2015 | 10 Mar 2016 | 6 Mar 2017 |
| 224 | tekstil-dunyasi.com | FBS Inc. | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 225 | tekstilvemakine.com | IHS Telekom, Inc. | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 226 | tekstilvemakina.com | IHS Telekom, Inc. | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 227 | tekstilvspb.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Mar 2015 | 9 Mar 2015 | 8 Mar 2016 |
| 228 | tekstilskolen.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 229 | tekstilno.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Mar 2015 | 10 Mar 2017 | 10 Mar 2018 |
| 230 | tekstilmatik.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 16 Sep 2021 | 6 Jan 2024 | 16 Sep 2024 |
| 231 | tekstilskolen.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Mar 2015 | 14 Feb 2017 | 10 Mar 2018 |
| 232 | tekstilskolen.net | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 233 | tekstiltoptancisi.com | IHS Telekom, Inc. | 12 Mar 2015 | 15 Mar 2017 | 12 Mar 2018 |
| 234 | tekstilhavuzu.com | Tucows Domains Inc. | 16 Apr 2020 | 20 Apr 2022 | 16 Apr 2022 |
| 235 | tekstil3f.com | IHS Telekom, Inc. | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 236 | tekstikauppa.com | Wild West Domains, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 237 | tekstilramme.com | Realtime Register B.V. | 17 Mar 2015 | 11 Jul 2017 | 17 Mar 2019 |
| 238 | tekstilfilozofu.com | FBS Inc. | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 239 | tekstilfirma.com | FBS Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 240 | tekstilcaddesi.com | enom403, Incorporated | 9 Feb 2023 | 24 Apr 2024 | 9 Feb 2024 |
| 241 | tekstil.online | GoDaddy.com, LLC | 27 Jun 2023 | 31 Aug 2023 | 27 Jun 2024 |
| 242 | tekstilnetshop.com | FBS Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 243 | tekstil94.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 244 | tekstil13.com | eNom, Inc. | 27 Mar 2015 | 31 Mar 2016 | 27 Mar 2018 |
| 245 | tekstilnetshop.net | FBS Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 246 | tekstilnetwork.com | FBS Inc. | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 247 | tekstilnetwork.net | FBS Inc. | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 248 | tekstilce.com | OnlineNIC, Inc. | 30 Mar 2015 | 4 Apr 2017 | 30 Mar 2018 |
| 249 | tekstilorder.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 250 | tekstilguler.com | IHS Telekom, Inc. | 6 Apr 2015 | 4 Apr 2017 | 6 Apr 2018 |
| 251 | tekstilcenter.com | GoDaddy.com, LLC | 21 Nov 2020 | 31 Oct 2022 | 21 Nov 2025 |
| 252 | tekstilkentbilgisayar.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 7 Apr 2015 | 5 Apr 2024 | 7 Apr 2025 |
| 253 | tekstilalisverisi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 254 | tekstilbank.online | FBS Inc. | 31 Aug 2015 | - | 31 Aug 2016 |
| 255 | tekstilal.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 Nov 2022 | 19 Nov 2023 | 13 Nov 2024 |
| 256 | tekstiltoptancilari.com | GoDaddy.com, LLC | 4 Oct 2022 | 15 Nov 2023 | 4 Oct 2023 |
| 257 | tekstilfirmarehberi.com | GoDaddy.com, LLC | 10 Apr 2015 | 11 Apr 2015 | 10 Apr 2016 |
| 258 | tekstilkumeleri.com | IHS Telekom, Inc. | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 259 | tekstilkumeleri.net | IHS Telekom, Inc. | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 260 | tekstilkorumasistemleri.com | IHS Telekom, Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 261 | tekstilkorumasistemi.com | IHS Telekom, Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 262 | tekstilkentgazetesi.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 22 Apr 2019 | 22 Apr 2019 | 22 Apr 2020 |
| 263 | tekstilnyy.com | Regional Network Information Center, JSC dba RU-CE… | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 264 | tekstilcilerbirligi.com | OnlineNIC, Inc. | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 265 | tekstilsallantikartlari.com | FBS Inc. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 266 | tekstilcember.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 20 Apr 2015 | 22 Apr 2024 | 20 Apr 2025 |
| 267 | tekstilfasonkesim.com | Ä°simtescil BiliÅŸim A.Åž. | 18 May 2020 | 16 Oct 2023 | 18 May 2025 |
| 268 | tekstildeposu.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 19 Apr 2012 | 3 May 2023 | 19 Apr 2024 |
| 269 | tekstilsozlugu.com | GoDaddy.com, LLC | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 270 | tekstildjebel.info | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 271 | tekstilotomasyonu.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 22 Aug 2022 | 1 Nov 2023 | 22 Aug 2023 |
| 272 | tekstilkentforklift.com | Key-Systems GmbH | 25 Apr 2015 | 25 Apr 2015 | 25 Apr 2016 |
| 273 | tekstilvegiyim.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 274 | tekstilindonesia.com | Namesilo, LLC | 5 Jul 2018 | 5 Jul 2018 | 5 Jul 2019 |
| 275 | tekstill.com | URL Solutions, Inc. | 29 Apr 2015 | 6 Mar 2024 | 29 Apr 2025 |
| 276 | tekstilindonesia.org | CV. Jogjacamp | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 277 | tekstilrafsistemleri.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 30 Apr 2015 | 28 Apr 2017 | 30 Apr 2018 |
| 278 | tekstildeporafsistemleri.net | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 30 Apr 2015 | 29 Apr 2017 | 30 Apr 2018 |
| 279 | tekstilset.com | FBS Inc. | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 280 | tekstilpromosyon.org | Bizcn.com, Inc. | 27 Apr 2007 | 4 May 2015 | 27 Apr 2016 |
| 281 | tekstilsanati.com | 1API GmbH | 23 Mar 2018 | 23 Mar 2018 | 23 Mar 2019 |
| 282 | tekstilcrm.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 16 May 2022 | 17 May 2023 | 16 May 2024 |
| 283 | tekstilkentdekorasyon.com | FBS Inc. | 8 May 2015 | 18 Jun 2017 | 8 May 2017 |
| 284 | tekstilturkey.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2016 |
| 285 | tekstilalimsatim.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 May 2015 | 1 May 2017 | 11 May 2018 |
| 286 | tekstilmy.com | OnlineNIC, Inc. | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 287 | tekstilkenttv.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 288 | tekstilfuryasi.com | RegistryGate GmbH | 10 Aug 2015 | 11 Sep 2015 | 10 Aug 2016 |
| 289 | tekstilium.net | FBS Inc. | 12 May 2015 | 22 Jun 2017 | 12 May 2017 |
| 290 | tekstilcin.com | Reg2C.com Inc. | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 291 | tekstilkentradyo.com | FBS Inc. | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 292 | tekstilkenthaberleri.com | FBS Inc. | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 293 | tekstilkentgundem.com | FBS Inc. | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 294 | tekstilkentgercekleri.com | FBS Inc. | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 295 | tekstilcadiri.com | Realtime Register B.V. | 19 Jul 2019 | 19 Jul 2019 | 19 Jul 2020 |
| 296 | tekstitaivas.com | Wild West Domains, LLC | 12 Sep 2015 | 12 Sep 2015 | 12 Sep 2016 |
| 297 | tekstilmakineparcasi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 May 2015 | 2 May 2017 | 19 May 2018 |
| 298 | tekstilelektronik.com | Ä°simtescil BiliÅŸim A.Åž. | 21 Jul 2021 | 5 Apr 2022 | 21 Jul 2024 |
| 299 | tekstilevi.com | IHS Telekom, Inc. | 20 May 2015 | 2 Jul 2023 | 20 May 2024 |
| 300 | tekstilcinincilesi.com | FBS Inc. | 21 May 2015 | 21 May 2015 | 21 May 2016 |
| 301 | tekstilduragi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Oct 2021 | 13 Oct 2021 | 13 Oct 2022 |
| 302 | tekstilcv.com | Tucows Domains Inc. | 10 Sep 2012 | 14 Sep 2015 | 10 Sep 2016 |
| 303 | tekstilstroj.com | Beijing Lanhai Jiye Technology Co., Ltd | 6 Apr 2022 | 7 Apr 2024 | 6 Apr 2025 |
| 304 | tekstiliniz.com | IHS Telekom, Inc. | 14 Sep 2015 | 14 Sep 2015 | 14 Sep 2016 |
| 305 | tekstilimalathane.com | eNom, Inc. | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 306 | tekstile-optom.com | Tucows Domains Inc. | 29 May 2014 | 2 Jun 2015 | 29 May 2016 |
| 307 | tekstilgida.com | FBS Inc. | 17 Nov 2017 | 17 Nov 2017 | 17 Nov 2019 |
| 308 | tekstildepom.com | GoDaddy.com, LLC | 24 Dec 2019 | 24 Dec 2019 | 24 Dec 2020 |
| 309 | tekstiltokalari.com | Tucows Domains Inc. | 31 May 2013 | 4 Jun 2020 | 31 May 2020 |
| 310 | tekstil-plus.com | Instra Corporation Pty Ltd. | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 311 | tekstilcim.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 10 Jul 2023 | 10 Jul 2023 | 10 Jul 2024 |
| 312 | tekstilx.net | Tucows Domains Inc. | 2 Jun 2014 | 6 Jun 2015 | 2 Jun 2016 |
| 313 | tekstilstore.com | Hostinger, UAB | 16 May 2022 | 16 Apr 2023 | 16 May 2024 |
| 314 | tekstilkentnakliye.com | FBS Inc. | 12 Jun 2015 | 4 Jul 2017 | 12 Jun 2020 |
| 315 | tekstilatmarketim.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 316 | tekstilturkiye.net | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 31 Aug 2016 | 13 Sep 2023 | 31 Aug 2024 |
| 317 | tekstilo.com | Namesilo, LLC | 17 Dec 2023 | 22 Feb 2024 | 17 Dec 2025 |
| 318 | tekstilfabrikasi.com | Hosting Concepts B.V. dba Openprovider | 21 Dec 2020 | 24 Nov 2023 | 21 Dec 2024 |
| 319 | tekstilstempel.com | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 320 | tekstildijitalbaskimakinesi.com | IHS Telekom, Inc. | 16 Jun 2015 | 12 Jun 2017 | 16 Jun 2018 |
| 321 | tekstilschiki.info | Epik Inc. | 27 Sep 2020 | 27 Sep 2020 | 27 Sep 2021 |
| 322 | tekstilizmir.com | GoDaddy.com, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 323 | tekstilprtal.com | GoDaddy.com, LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 324 | tekstilesmenas.com | GoDaddy.com, LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 325 | tekstilmarka.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2020 |
| 326 | tekstilfirsat.com | IHS Telekom, Inc. | 11 Aug 2017 | 11 Aug 2017 | 11 Aug 2018 |
| 327 | tekstile.net | Moniker Online Services LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 328 | tekstilcisepeti.com | GoDaddy.com, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 329 | tekstilsletak.com | GoDaddy.com, LLC | 1 Jul 2015 | 1 Jul 2015 | 1 Jul 2016 |
| 330 | tekstilfazlasi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jul 2015 | 2 Jul 2015 | 1 Jul 2016 |
| 331 | tekstilburada.net | GoDaddy.com, LLC | 4 Mar 2017 | 4 Mar 2017 | 4 Mar 2018 |
| 332 | tekstiltoptanmerter.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Nov 2016 | 18 Dec 2017 | 6 Nov 2017 |
| 333 | tekstiltoptanmereter.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 334 | tekstilpiyasa.com | Wide Left Domains LLC | 5 May 2022 | 18 Jun 2023 | 5 May 2023 |
| 335 | tekstilendustri.com | Tucows Domains Inc. | 9 Oct 2018 | 11 Oct 2022 | 9 Oct 2024 |
| 336 | tekstiilipidu.com | eNom, Inc. | 8 Jul 2015 | 12 Jul 2017 | 8 Jul 2017 |
| 337 | tekstina-fashion.com | Xin Net Technology Corporation | 7 Apr 2021 | 29 May 2021 | 7 Apr 2022 |
| 338 | tekstilkitap.com | GoDaddy.com, LLC | 26 Sep 2015 | 26 Sep 2015 | 26 Sep 2016 |
| 339 | tekstilmarketi.com | Google, Inc. | 17 May 2022 | 18 May 2023 | 17 May 2024 |
| 340 | tekstilraflari.com | Domain.com, LLC | 28 Sep 2015 | 27 Oct 2016 | 28 Sep 2017 |
| 341 | tekstiliya.com | GoDaddy.com, LLC | 29 Apr 2024 | 29 Apr 2024 | 29 Apr 2025 |
| 342 | tekstilcilik.com | Google, Inc. | 17 Jun 2022 | 10 Sep 2023 | 17 Jun 2025 |
| 343 | tekstilan.com | FBS Inc. | 18 Nov 2017 | 18 Nov 2017 | 18 Nov 2018 |
| 344 | tekstilya.net | GoDaddy.com, LLC | 20 Dec 2018 | 20 Dec 2018 | 20 Dec 2019 |
| 345 | tekstilciyiz.biz | RegistryGate GmbH | 6 Dec 2018 | 6 Apr 2020 | 6 Dec 2020 |
| 346 | tekstilmagazasi.com | FBS Inc. | 30 Jul 2015 | 12 Oct 2016 | 30 Jul 2017 |
| 347 | tekstiltedarik.net | Ä°simtescil BiliÅŸim A.Åž. | 15 Jan 2019 | 8 Jan 2024 | 15 Jan 2025 |
| 348 | tekstilmerter.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 19 Sep 2023 | 11 Mar 2024 | 19 Sep 2024 |
| 349 | tekstilcocuk.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2016 |
| 350 | tekstilsezonu.com | FBS Inc. | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 351 | tekstilmakinalariservisi.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 352 | tekstilciyiz.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 13 Aug 2021 | 10 Aug 2023 | 13 Aug 2024 |
| 353 | tekstilfirmalarirehberi.com | FBS Inc. | 1 Aug 2015 | 4 Jun 2017 | 1 Aug 2017 |
| 354 | tekstilyeri.com | Webfusion Ltd. | 3 Aug 2019 | 3 Aug 2019 | 3 Aug 2020 |
| 355 | tekstilelemani.com | - | 22 Sep 2023 | 22 Sep 2023 | 22 Sep 2024 |
| 356 | tekstilteknik.net | eNom, Inc. | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 357 | tekstilmakineleri.net | Realtime Register B.V. | 12 Mar 2019 | 2 Mar 2024 | 12 Mar 2025 |
| 358 | tekstilmarketmakine.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2016 |
| 359 | tekstilderyasi.com | GoDaddy.com, LLC | 16 Apr 2020 | 16 Apr 2020 | 16 Apr 2021 |
| 360 | tekstilmakinayedekparcaureticileri.com | IHS Telekom, Inc. | 5 Aug 2015 | 27 Aug 2016 | 5 Aug 2017 |
| 361 | tekstilmakinayedekparcalari.com | IHS Telekom, Inc. | 5 Aug 2015 | 19 Sep 2016 | 5 Aug 2017 |
| 362 | tekstilmakinaparcalari.com | IHS Telekom, Inc. | 5 Aug 2015 | 19 Sep 2016 | 5 Aug 2017 |
| 363 | tekstilmakinalariyedekparcafiyatlari.com | IHS Telekom, Inc. | 5 Aug 2015 | 19 Sep 2016 | 5 Aug 2017 |
| 364 | tekstilmakinalariyedekparca.com | IHS Telekom, Inc. | 5 Aug 2015 | 19 Sep 2016 | 5 Aug 2017 |
| 365 | tekstilcenneti.com | GoDaddy.com, LLC | 1 Mar 2022 | 1 Mar 2022 | 1 Mar 2023 |
| 366 | tekstilkentkayseri.com | FBS Inc. | 15 Nov 2018 | 15 Nov 2018 | 15 Nov 2019 |
| 367 | tekstildizini.com | OnlineNIC, Inc. | 8 Aug 2015 | 8 Aug 2015 | 8 Aug 2016 |
| 368 | tekstilkentkayseri.net | FBS Inc. | 8 Aug 2015 | 8 Aug 2015 | 8 Aug 2016 |
| 369 | tekstilsepetim.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Apr 2023 | 9 Apr 2024 | 9 Apr 2025 |
| 370 | tekstiltabanlivinilduvarkagidi.com | - | 5 Oct 2015 | 5 Oct 2015 | 5 Oct 2017 |
| 371 | tekstiltaban.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Jun 2021 | 23 May 2023 | 22 Jun 2026 |
| 372 | tekstilduvarkagidi.com | DropCatch.com 998 LLC | 9 Mar 2018 | 9 Mar 2018 | 9 Mar 2019 |
| 373 | tekstilbicaklari.com | Ä°simtescil BiliÅŸim A.Åž. | 9 Oct 2015 | 3 Oct 2023 | 9 Oct 2024 |
| 374 | tekstil.club | FBS Inc. | 11 May 2017 | 18 May 2017 | 11 May 2018 |
| 375 | tekstilim.net | FBS Inc. | 5 Sep 2017 | 5 Sep 2017 | 5 Sep 2018 |
| 376 | tekstilno.club | Regtime Ltd. | 16 Oct 2015 | 16 Oct 2015 | 15 Oct 2016 |
| 377 | tekstilutumakinalari.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 18 Oct 2015 | 24 Oct 2023 | 18 Oct 2024 |
| 378 | tekstiiliporssi.com | 1API GmbH | 24 Oct 2015 | 24 Oct 2015 | 24 Oct 2017 |
| 379 | tekstilgerikazanim.com | FBS Inc. | 31 Oct 2015 | 31 Oct 2015 | 31 Oct 2016 |
| 380 | tekstilciali.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 4 Nov 2015 | 21 Oct 2016 | 4 Nov 2017 |
| 381 | tekstil-sib.com | Tucows Domains Inc. | 25 Dec 2023 | 25 Dec 2023 | 25 Dec 2024 |
| 382 | tekstilyedek.com | IHS Telekom, Inc. | 6 Nov 2015 | 20 Sep 2016 | 6 Nov 2017 |
| 383 | tekstilvip.com | FBS Inc. | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 384 | tekstil4hotel.com | GoDaddy.com, LLC | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 385 | tekstilbankadvantage.com | GoDaddy.com, LLC | 11 Nov 2015 | 4 Nov 2023 | 11 Nov 2024 |
| 386 | tekstilkentaykutemlak.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Jul 2021 | 2 Jul 2023 | 2 Jul 2024 |
| 387 | tekstilperformans.com | Alantron BiliÅŸim Ltd Åžti. | 15 Nov 2015 | 8 Nov 2023 | 15 Nov 2024 |
| 388 | tekstilmerkezi.net | Ä°simtescil BiliÅŸim A.Åž. | 18 Nov 2022 | 16 Nov 2023 | 18 Nov 2024 |
| 389 | tekstilalsat.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2016 |
| 390 | tekstilkentturyap.com | Name.com, Inc. | 23 Nov 2015 | 21 Nov 2016 | 23 Nov 2017 |
| 391 | tekstiltasimatorbasi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jul 2023 | 14 Sep 2023 | 15 Jul 2024 |
| 392 | tekstildetemizuretimcalistayi.org | IHS Telekom, Inc. | 27 Nov 2015 | 27 Nov 2015 | 27 Nov 2016 |
| 393 | tekstilhaber.net | GoDaddy.com, LLC | 11 Feb 2017 | 11 Feb 2017 | 11 Feb 2018 |
| 394 | tekstil-market39.com | Network Solutions, LLC | 26 Nov 2015 | 27 Oct 2023 | 26 Nov 2024 |
| 395 | tekstilderyasi.net | FBS Inc. | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 396 | tekstil.info | Nics Telekomünikasyon Ticaret Ltd. Şti. | 27 Jul 2018 | 29 Jul 2023 | 27 Jul 2024 |
| 397 | tekstillojistigi.com | Tucows Domains Inc. | 2 Dec 2015 | 6 Dec 2017 | 2 Dec 2017 |
| 398 | tekstildesigners.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2017 |
| 399 | tekstil-print.com | Web Commerce Communications Limited dba WebNic.cc | 22 Sep 2017 | 22 Sep 2017 | 22 Sep 2018 |
| 400 | tekstilcini.com | IHS Telekom, Inc. | 6 Feb 2024 | 6 Feb 2024 | 6 Feb 2025 |
| 401 | tekstilshiki.moscow | Limited Liability Company "Registrar of domain nam… | 6 Dec 2014 | 7 Dec 2015 | 6 Dec 2016 |
| 402 | tekstillojistik.com | Tucows Domains Inc. | 8 Dec 2015 | 12 Dec 2016 | 8 Dec 2016 |
| 403 | tekstilkimyasallari.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Dec 2019 | 12 Dec 2019 | 12 Dec 2020 |
| 404 | tekstilfuari.com | Ä°simtescil BiliÅŸim A.Åž. | 5 Mar 2024 | 8 Apr 2024 | 5 Mar 2025 |
| 405 | tekstilyedekparca.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 17 Dec 2015 | 24 Mar 2023 | 17 Dec 2024 |
| 406 | tekstilisilanlari.net | IHS Telekom, Inc. | 19 Dec 2015 | 6 Dec 2016 | 19 Dec 2017 |
| 407 | tekstilteknolojileri.com | Reg2C.com Inc. | 22 Dec 2015 | 19 Dec 2016 | 22 Dec 2017 |
| 408 | tekstima.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Dec 2015 | 17 Dec 2016 | 23 Dec 2017 |
| 409 | tekstil-ltd.com | Network Solutions, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 410 | tekstilarabul.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2015 | 28 Dec 2015 | 28 Dec 2016 |
| 411 | tekstilorgufuari.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 28 Dec 2006 | 7 Jan 2019 | 28 Dec 2019 |
| 412 | tekstilorgu.com | Everyones Internet, Ltd. dba SoftLayer | 28 Dec 2006 | 27 Feb 2017 | 28 Dec 2017 |
| 413 | tekstilparca.com | Google, Inc. | 25 Jul 2022 | 26 Jul 2023 | 25 Jul 2024 |
| 414 | tekstiilipuputti.fi | - | 11 Dec 2014 | 30 Dec 2015 | 11 Dec 2016 |
| 415 | tekstiilipesurit.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 8 Jan 2016 | 11 Dec 2016 | 8 Jan 2018 |
| 416 | tekstiilipesuri.com | DreamHost, LLC | 25 Sep 2023 | 25 Sep 2023 | 25 Sep 2024 |
| 417 | tekstildoseme.com | TLDs LLC dba SRSplus | 8 Jul 2023 | 14 Jul 2023 | 8 Jul 2024 |
| 418 | tekstiel.com | Annulet LLC | 11 Jan 2016 | 28 Feb 2024 | 11 Jan 2025 |
| 419 | tekstilmafyasi.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 420 | tekstilteklif.com | Tucows Domains Inc. | 15 Jan 2016 | 19 Jan 2020 | 15 Jan 2020 |
| 421 | tekstiilitalo.fi | - | 20 Dec 2009 | 7 Dec 2015 | 20 Dec 2016 |
| 422 | tekstiletiketi.net | IHS Telekom, Inc. | 17 Jan 2016 | 13 Feb 2024 | 17 Jan 2025 |
| 423 | tekstilbaskisi.com | IHS Telekom, Inc. | 17 Jan 2016 | 13 Feb 2024 | 17 Jan 2025 |
| 424 | tekstilkoy.com | Reg2C.com Inc. | 20 Jan 2016 | 20 Jan 2016 | 20 Jan 2017 |
| 425 | tekstilmakineservis.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Jan 2016 | 22 Jan 2016 | 22 Jan 2017 |
| 426 | tekstilkentnakliyat.com | FBS Inc. | 13 Apr 2017 | 13 Jun 2017 | 13 Apr 2019 |
| 427 | tekstilmusteri.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 25 Jan 2016 | 25 Jan 2016 | 25 Jan 2017 |
| 428 | tekstiljournal.com | Network Solutions, LLC | 25 Jan 2016 | 25 Jan 2016 | 25 Jan 2017 |
| 429 | tekstilcrave.com | Tucows Domains Inc. | 18 Feb 2017 | 3 Feb 2024 | 18 Feb 2025 |
| 430 | tekstilnumune.com | Moniker Online Services LLC | 27 Jan 2016 | 27 Jan 2016 | 27 Jan 2017 |
| 431 | tekstilosmanbey.com | IHS Telekom, Inc. | 25 Apr 2019 | 4 May 2024 | 25 Apr 2025 |
| 432 | tekstilprime.com | GoDaddy.com, LLC | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 433 | tekstilkentdestek.com | FBS Inc. | 5 Feb 2016 | 6 Feb 2024 | 5 Feb 2025 |
| 434 | tekstilaksesuarcisi.com | IHS Telekom, Inc. | 8 Feb 2016 | 8 Feb 2016 | 8 Feb 2017 |
| 435 | tekstilavm.net | FBS Inc. | 11 Feb 2016 | 12 Feb 2016 | 11 Feb 2017 |
| 436 | tekstilfirmarehberi.net | IHS Telekom, Inc. | 14 Feb 2016 | 9 Mar 2017 | 14 Feb 2018 |
| 437 | tekstilbaski.net | IHS Telekom, Inc. | 22 Dec 2016 | 13 Feb 2024 | 22 Dec 2025 |
| 438 | tekstilcepheler.com | Tucows Domains Inc. | 16 Feb 2016 | 20 Feb 2022 | 16 Feb 2022 |
| 439 | tekstil-program.info | GoDaddy.com, LLC | 16 Feb 2016 | 17 Feb 2017 | 16 Feb 2018 |
| 440 | tekstilmedikal.com | FBS Inc. | 17 Feb 2016 | 18 May 2017 | 17 Feb 2018 |
| 441 | tekstilbilgi.net | Ä°simtescil BiliÅŸim A.Åž. | 18 Feb 2016 | 20 Nov 2023 | 18 Feb 2026 |
| 442 | tekstilgazetesi.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 8 May 2024 | 8 May 2024 | 8 May 2025 |
| 443 | tekstil1.com | Domain.com, LLC | 20 Feb 2016 | 20 Feb 2016 | 20 Feb 2017 |
| 444 | tekstiloutlet.com | GoDaddy.com, LLC | 4 Nov 2018 | 4 Nov 2018 | 4 Nov 2019 |
| 445 | tekstilcarsisi.com | Google, Inc. | 16 Apr 2023 | 17 Apr 2024 | 16 Apr 2025 |
| 446 | tekstilbuch.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2018 |
| 447 | tekstilfabrikalari.com | GMO Internet Inc. | 16 May 2017 | 16 May 2017 | 16 May 2018 |
| 448 | tekstilhan.com | West263 International Limited | 14 Oct 2020 | 14 Oct 2020 | 14 Oct 2021 |
| 449 | tekstilrehberim.com | HiChina Zhicheng Technology Limited | 29 May 2020 | 31 May 2020 | 29 May 2021 |
| 450 | tekstilcilersitesi.com | IHS Telekom, Inc. | 10 Feb 2018 | 10 Feb 2018 | 10 Feb 2019 |
| 451 | tekstil-ekipman.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 6 Mar 2016 | 7 Nov 2023 | 6 Mar 2025 |
| 452 | tekstilprint.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Aug 2019 | 20 Jun 2023 | 2 Aug 2024 |
| 453 | tekstilcluster.xyz | Hostinger, UAB | 9 Mar 2016 | 11 Dec 2016 | 9 Mar 2017 |
| 454 | tekstilarabasi.net | FBS Inc. | 11 Mar 2016 | 20 May 2017 | 11 Mar 2018 |
| 455 | tekstilarabasi.com | FBS Inc. | 11 Mar 2016 | 20 May 2017 | 11 Mar 2018 |
| 456 | tekstilcibiziz.com | Tucows Domains Inc. | 10 Mar 2016 | 10 Mar 2016 | 10 Mar 2017 |
| 457 | tekstildoseme.net | GoDaddy.com, LLC | 14 Mar 2016 | 14 Mar 2016 | 14 Mar 2017 |
| 458 | tekstil54.com | Hongkong Domain Name Information Management Co., L… | 7 Nov 2021 | 10 Nov 2022 | 7 Nov 2022 |
| 459 | tekstilkentsiteemlak.com | Reg2C.com Inc. | 17 Mar 2016 | 9 Mar 2017 | 17 Mar 2018 |
| 460 | tekstilkent.xyz | FBS Inc. | 20 Mar 2016 | 25 Mar 2016 | 20 Mar 2017 |
| 461 | tekstillizing.com | GoDaddy.com, LLC | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 462 | tekstilkenttaksi.com | IHS Telekom, Inc. | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 463 | tekstilmakinayedekparca.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 21 Mar 2016 | 3 Mar 2017 | 21 Mar 2018 |
| 464 | tekstilfirmasi.com | DROPCATCH.COM 760 LLC | 7 Jun 2017 | 16 Jul 2017 | 7 Jun 2018 |
| 465 | tekstil-kharkov.net | Internet Invest, Ltd. dba Imena.ua | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 466 | tekstilas.com | GoDaddy.com, LLC | 31 Mar 2016 | 31 Mar 2016 | 31 Mar 2017 |
| 467 | tekstilbarkod.com | Reg2C.com Inc. | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 468 | tekstilkentemlak.net | Name.com, Inc. | 28 Mar 2024 | 28 Mar 2024 | 28 Mar 2025 |
| 469 | tekstilegel.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 5 Apr 2016 | 5 Apr 2016 | 5 Apr 2017 |
| 470 | tekstiler.com | TurnCommerce, Inc. DBA NameBright.com | 26 Jun 2019 | 20 Jun 2020 | 26 Jun 2025 |
| 471 | tekstilkentelektrikci.com | - | 3 Sep 2022 | 11 Sep 2023 | 3 Sep 2024 |
| 472 | tekstil-giyim.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 15 Apr 2016 | 7 Nov 2023 | 15 Apr 2025 |
| 473 | tekstilbilgi.org | FBS Inc. | 18 Apr 2016 | 9 Jun 2017 | 18 Apr 2018 |
| 474 | tekstilkentyonetim.com | Key-Systems GmbH | 19 Apr 2016 | 12 Apr 2017 | 19 Apr 2018 |
| 475 | tekstiilitar.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 19 Apr 2016 | 3 Apr 2024 | 19 Apr 2025 |
| 476 | tekstilse.com | OnlineNIC, Inc. | 20 Apr 2016 | 24 Apr 2017 | 20 Apr 2018 |
| 477 | tekstilpazarlari.com | IHS Telekom, Inc. | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 478 | tekstilpazarlari.net | IHS Telekom, Inc. | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 479 | tekstilacentasi.net | IHS Telekom, Inc. | 22 Apr 2016 | 18 Apr 2017 | 22 Apr 2018 |
| 480 | tekstilacentasi.com | IHS Telekom, Inc. | 22 Apr 2016 | 18 Apr 2017 | 22 Apr 2018 |
| 481 | tekstilkentperdecilersitesi.com | Ä°simtescil BiliÅŸim A.Åž. | 25 Apr 2016 | 20 Apr 2024 | 25 Apr 2025 |
| 482 | tekstilinfo.org | Regional Network Information Center, JSC dba RU-CE… | 24 Apr 2014 | 24 Apr 2014 | 24 Apr 2017 |
| 483 | tekstilacentesi.net | IHS Telekom, Inc. | 24 Apr 2016 | 18 Apr 2017 | 24 Apr 2018 |
| 484 | tekstilcio.com | 1&1 Internet AG | 24 Apr 2016 | 4 Jun 2017 | 24 Apr 2018 |
| 485 | tekstilacentesi.com | IHS Telekom, Inc. | 24 Apr 2016 | 18 Apr 2017 | 24 Apr 2018 |
| 486 | tekstilinfo.net | Regional Network Information Center, JSC dba RU-CE… | 24 Apr 2014 | 24 Apr 2014 | 24 Apr 2017 |
| 487 | tekstilmarket.net | HiChina Zhicheng Technology Limited | 16 Dec 2019 | 16 Dec 2019 | 16 Dec 2020 |
| 488 | tekstilshchik.com | - | - | - | - |
| 489 | tekstilji.com | Ä°simtescil BiliÅŸim A.Åž. | 24 Dec 2019 | 23 Dec 2023 | 24 Dec 2024 |
| 490 | tekstilureticileri.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 27 Sep 2022 | 28 Sep 2023 | 27 Sep 2024 |
| 491 | tekstilkent.istanbul | IHS Telekom, Inc. | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 492 | tekstilkent.ist | IHS Telekom, Inc. | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 493 | tekstilkirtasiye.com | - | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 494 | tekstilframe.com | IHS Telekom, Inc. | 18 May 2016 | 22 May 2017 | 18 May 2018 |
| 495 | tekstilcerceve.com | - | 4 Aug 2022 | 5 Aug 2023 | 4 Aug 2024 |
| 496 | tekstilaksesuars.com | OnlineNIC, Inc. | 18 May 2016 | 29 Apr 2017 | 18 May 2018 |
| 497 | tekstilfirmalari.net | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 20 Sep 2019 | 20 Sep 2019 | 20 Sep 2021 |
| 498 | tekstilinfo.info | Regional Network Information Center, JSC dba RU-CE… | 23 May 2014 | 23 May 2014 | 23 May 2017 |
| 499 | tekstilci.istanbul | 101domain, Inc. | 10 May 2016 | 10 May 2016 | 10 May 2017 |
| 500 | tekstilbank.istanbul | GoDaddy.com, LLC | 11 May 2016 | 11 May 2016 | 11 May 2017 |
| 501 | tekstilinfo.club | Regional Network Information Center, JSC dba RU-CE… | 22 May 2014 | 22 May 2014 | 21 May 2016 |
| 502 | tekstilxml.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Feb 2020 | 4 Feb 2020 | 4 Feb 2021 |
| 503 | tekstilopt.com | Limited Liability Company "Registrar of domain nam… | 26 May 2016 | 29 May 2023 | 26 May 2024 |
| 504 | tekstilduvarkagidi.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 27 May 2016 | 5 Jun 2017 | 27 May 2018 |
| 505 | tekstilduvarkagidi.net | - | 27 May 2016 | 27 May 2016 | 27 May 2017 |
| 506 | tekstilmagaza.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 30 Jul 2022 | 30 Jul 2023 | 30 Jul 2024 |
| 507 | tekstilnikanali.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 2 May 2023 | 1 Jun 2024 |
| 508 | tekstildardokuma.com | Tucows Domains Inc. | 1 Jun 2016 | 22 May 2023 | 1 Jun 2024 |
| 509 | tekstig.org | Key-Systems GmbH | 4 Sep 2017 | - | 4 Sep 2018 |
| 510 | tekstilevgeniya.com | Hosting Ukraine LLC | 14 Jun 2016 | 25 Jun 2020 | 14 Jun 2021 |
| 511 | tekstildesenleri.com | FBS Inc. | 14 Jun 2016 | 14 Jun 2016 | 14 Jun 2017 |
| 512 | tekstig.com | TurnCommerce, Inc. DBA NameBright.com | 23 Aug 2019 | 17 Aug 2020 | 23 Aug 2024 |
| 513 | tekstiiliartella.com | Domaininfo AB, aka domaininfo.com | 1 Jul 2016 | 24 Jun 2017 | 1 Jul 2018 |
| 514 | tekstify.com | Automattic Inc. | 1 Jun 2020 | 14 Aug 2023 | 1 Jun 2023 |
| 515 | tekstil-okt.xyz | Limited Liability Company "Registrar of domain nam… | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 516 | tekstil.top | NameCheap, Inc. | 2 Dec 2023 | 2 Dec 2023 | 2 Dec 2024 |
| 517 | tekstil.pro | CommuniGal Communication Ltd. | 19 Apr 2024 | 21 Apr 2024 | 19 Apr 2025 |
| 518 | tekstilpromet.com | GoDaddy.com, LLC | 28 Feb 2024 | 28 Feb 2024 | 28 Feb 2025 |
| 519 | tekstilci.xyz | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Jul 2016 | 14 Jul 2016 | 9 Jul 2017 |
| 520 | tekstildanismanlik.com | GoDaddy.com, LLC | 6 Jun 2019 | 6 Jun 2019 | 6 Jun 2020 |
| 521 | tekstilsatis.com | GKG.NET, INC. | 14 Jul 2016 | 21 May 2017 | 14 Jul 2018 |
| 522 | tekstivippi.biz | eNom, Inc. | 4 Apr 2012 | 24 Feb 2017 | 3 Apr 2017 |
| 523 | tekstil.biz | GMO Internet Inc. | 11 Nov 2021 | 11 Nov 2021 | 11 Nov 2022 |
| 524 | tekstile.biz | Internet Invest, Ltd. dba Imena.ua | 1 Dec 2009 | 5 Dec 2017 | 30 Nov 2018 |
| 525 | tekstilpazari.biz | NameKing.com Inc. | 21 Jul 2021 | 23 Jul 2021 | 21 Jul 2022 |
| 526 | tekstilkolbandi.biz | NameKing.com Inc. | 22 Jul 2021 | 22 Jul 2021 | 22 Jul 2022 |
| 527 | tekstilgo.com | GoDaddy.com, LLC | 21 May 2022 | 25 May 2023 | 21 May 2024 |
| 528 | tekstilkentkurye.com | FBS Inc. | 17 Apr 2019 | 17 Apr 2019 | 17 Apr 2020 |
| 529 | tekstil-optom.net | - | 21 Jul 2016 | 21 Jul 2016 | 21 Jul 2017 |
| 530 | tekstilbaskikimyasanayi.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 25 Jul 2016 | 24 Dec 2022 | 25 Jul 2024 |
| 531 | tekstiltasima-torbasi.com | FBS Inc. | 25 Jul 2016 | 11 Jul 2017 | 25 Jul 2018 |
| 532 | tekstiltasimacuvali.com | Ä°simtescil BiliÅŸim A.Åž. | 25 Jul 2016 | 3 Jul 2023 | 25 Jul 2025 |
| 533 | tekstiller.net | - | 26 Jul 2016 | 26 Jul 2016 | 26 Jul 2017 |
| 534 | tekstilcilik.net | - | 26 Jul 2016 | 26 Jul 2016 | 26 Jul 2017 |
| 535 | tekstim.com | Tucows Domains Inc. | 27 Jul 2016 | 20 Jun 2023 | 27 Jul 2024 |
| 536 | tekstilworks.com | OnlineNIC, Inc. | 6 Apr 2005 | 9 Apr 2024 | 6 Apr 2024 |
| 537 | tekstils.org | CommuniGal Communication Ltd. | 31 Jul 2016 | 30 Sep 2016 | 31 Jul 2017 |
| 538 | tekstiloji.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 3 Aug 2016 | 13 Jun 2022 | 3 Aug 2024 |
| 539 | tekstilde.com | - | 4 Aug 2016 | 4 Aug 2016 | 4 Aug 2017 |
| 540 | tekstilignesi.com | - | 6 Aug 2016 | 6 Aug 2016 | 6 Aug 2017 |
| 541 | tekstilverimlilik.com | - | 9 Aug 2016 | 9 Aug 2016 | 9 Aug 2017 |
| 542 | tekstilverimlilik.net | - | 9 Aug 2016 | 9 Aug 2016 | 9 Aug 2017 |
| 543 | tekstilverimlilik.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Aug 2016 | 19 Sep 2017 | 9 Aug 2018 |
| 544 | tekstilbank.tel | - | 10 Jul 2015 | 10 Jul 2015 | 9 Jul 2016 |
| 545 | tekstil.tel | - | 4 Jul 2015 | 4 Jul 2015 | 3 Jul 2016 |
| 546 | tekstilderietiket.com | - | 10 Aug 2016 | 10 Aug 2016 | 10 Aug 2017 |
| 547 | tekstilplus.com | Eranet International Limited | 14 Jun 2022 | 15 Jun 2023 | 14 Jun 2023 |
| 548 | tekstillerarasiturnuva.com | Realtime Register B.V. | 15 Aug 2016 | 26 Sep 2017 | 15 Aug 2017 |
| 549 | tekstil.site | Limited Liability Company "Registrar of domain nam… | 25 Mar 2023 | 26 Mar 2024 | 25 Mar 2025 |
| 550 | tekstilkenthaber.org | IHS Telekom, Inc. | 20 Aug 2016 | 30 Sep 2017 | 20 Aug 2018 |
| 551 | tekstilparkaydin.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Aug 2016 | 2 Oct 2017 | 21 Aug 2017 |
| 552 | tekstilay.com | Google, Inc. | 19 Dec 2023 | 19 Dec 2023 | 19 Dec 2024 |
| 553 | tekstilay.net | IHS Telekom, Inc. | 23 Aug 2016 | 2 Oct 2017 | 23 Aug 2017 |
| 554 | tekstilmi.com | - | 27 Aug 2016 | 27 Aug 2016 | 27 Aug 2018 |
| 555 | tekstilmakinecileri.com | Tucows Domains Inc. | 22 Jun 2021 | 4 Jul 2023 | 22 Jun 2024 |
| 556 | tekstilci.org | eNom, Inc. | 31 Aug 2016 | 13 Oct 2017 | 31 Aug 2018 |
| 557 | tekstilmakinerehberi.com | Reg2C.com Inc. | 31 Aug 2016 | 12 Oct 2017 | 31 Aug 2017 |
| 558 | tekstilfabrika.com | IHS Telekom, Inc. | 6 Sep 2016 | 30 Aug 2023 | 6 Sep 2024 |
| 559 | tekstilsergileme.com | FBS Inc. | 7 Sep 2016 | 7 Sep 2017 | 7 Sep 2018 |
| 560 | tekstilsergileme.net | FBS Inc. | 7 Sep 2016 | 7 Sep 2017 | 7 Sep 2018 |
| 561 | tekstilyurdu.com | - | 12 Sep 2016 | 12 Sep 2016 | 12 Sep 2017 |
| 562 | tekstiltabanliduvarkagidi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Jun 2021 | 23 May 2023 | 22 Jun 2026 |
| 563 | tekstilpresle.com | - | 26 Sep 2016 | 26 Sep 2016 | 26 Sep 2017 |
| 564 | tekstil.tech | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 Mar 2021 | 23 Mar 2021 | 23 Mar 2022 |
| 565 | tekstilcim.online | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Jul 2023 | 31 Aug 2023 | 9 Jul 2024 |
| 566 | tekstilcim.website | FBS Inc. | 28 Sep 2016 | - | 28 Sep 2017 |
| 567 | tekstilutumakineleri.com | GoDaddy.com, LLC | 28 Sep 2016 | 29 Sep 2022 | 28 Sep 2024 |
| 568 | tekstilfactoring.com | GoDaddy.com, LLC | 21 Nov 2019 | 21 Nov 2019 | 21 Nov 2020 |
| 569 | tekstil.store | Ä°simtescil BiliÅŸim A.Åž. | 11 May 2023 | 31 Aug 2023 | 11 May 2025 |
| 570 | tekstilsena.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Aug 2014 | 22 Sep 2016 | 11 Aug 2016 |
| 571 | teksticles.com | GoDaddy.com, LLC | 19 Jun 2014 | 10 May 2016 | 19 Jun 2017 |
| 572 | tekstilatolye.com | Google, Inc. | 12 Apr 2022 | 13 Apr 2024 | 12 Apr 2025 |
| 573 | tekstilyatekstil.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 2 Sep 2009 | 10 Jun 2023 | 2 Sep 2026 |
| 574 | tekstilyikamamakinesi.com | FBS Inc. | 5 Jan 2012 | 3 Jan 2016 | 5 Jan 2017 |
| 575 | tekstilboyasi.com | Google, Inc. | 7 Jul 2010 | 24 Feb 2024 | 7 Jul 2024 |
| 576 | tekstilyildiz.com | EPAG Domainservices GmbH | 6 Jul 2010 | 7 Jul 2017 | 6 Jul 2018 |
| 577 | tekstilsan.com | Automattic Inc. | 3 Oct 2018 | 19 Sep 2023 | 3 Oct 2024 |
| 578 | tekstilciniz.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 16 Nov 2019 | 25 Sep 2023 | 16 Nov 2024 |
| 579 | tekstilozan.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Dec 2007 | 29 Dec 2022 | 26 Dec 2025 |
| 580 | tekstilist.com | OnlineNIC, Inc. | 11 Nov 2007 | 13 Nov 2023 | 11 Nov 2024 |
| 581 | tekstiltedarik.com | TurnCommerce, Inc. DBA NameBright.com | 22 Dec 2020 | 26 Aug 2021 | 22 Dec 2025 |
| 582 | tekstihuoltamo.com | Dynadot, LLC | 8 Apr 2012 | 23 Feb 2024 | 8 Apr 2025 |
| 583 | tekstilcorp.com | eNom, Inc. | 4 Sep 2010 | 11 Aug 2017 | 4 Sep 2018 |
| 584 | tekstilyatirim.com | GMO Internet Inc. | 26 Feb 2022 | 8 Apr 2023 | 26 Feb 2023 |
| 585 | tekstilisialver.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jan 2013 | 28 Jan 2016 | 29 Jan 2017 |
| 586 | tekstilci.com | TurnCommerce, Inc. DBA NameBright.com | 12 Aug 2006 | 20 Jul 2022 | 12 Aug 2025 |
| 587 | tekstilmega.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Jun 2014 | 14 Nov 2015 | 22 Jun 2017 |
| 588 | tekstilkentsatilik.com | Realtime Register B.V. | 19 Jan 2010 | 20 Dec 2015 | 19 Jan 2017 |
| 589 | tekstilmakineborsasi.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 1 Oct 2009 | 5 Jun 2023 | 1 Oct 2026 |
| 590 | tekstililan.com | Automattic Inc. | 20 Sep 2013 | 12 Aug 2023 | 20 Sep 2025 |
| 591 | tekstilium.com | Ä°simtescil BiliÅŸim A.Åž. | 1 Jan 2008 | 2 Jan 2024 | 1 Jan 2025 |
| 592 | tekstillife.com | eNom, Inc. | 8 Feb 2010 | 11 Feb 2017 | 8 Feb 2018 |
| 593 | tekstiltestcihazlari.com | Key-Systems GmbH | 31 Aug 2007 | 31 Aug 2023 | 31 Aug 2024 |
| 594 | tekstilatolyeleri.com | IHS Telekom, Inc. | 8 Jun 2014 | 27 Jun 2016 | 8 Jun 2017 |
| 595 | tekstiltakip.com | GoDaddy.com, LLC | 30 Sep 2022 | 12 Dec 2023 | 30 Sep 2023 |
| 596 | tekstilerp.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 17 Jan 2021 | 22 Dec 2023 | 17 Jan 2025 |
| 597 | teksticks.com | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Jul 2019 | 5 Jul 2019 | 5 Jul 2020 |
| 598 | tekstilinmerkezi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Nov 2010 | 26 Oct 2017 | 24 Nov 2018 |
| 599 | tekstilyikamamakinalari.com | FBS Inc. | 5 Jan 2012 | 3 Jan 2016 | 5 Jan 2017 |
| 600 | tekstilkv.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jan 2011 | 9 Jan 2024 | 20 Jan 2025 |
| 601 | tekstilmimarisi.com | NameCheap, Inc. | 9 Sep 2008 | 10 Aug 2019 | 9 Sep 2020 |
| 602 | tekstilraf.com | GoDaddy.com, LLC | 23 Mar 2020 | 23 Mar 2020 | 23 Mar 2021 |
| 603 | tekstivippi.com | DropCatch.com 1101 LLC | 11 Jul 2018 | 11 Jul 2018 | 11 Jul 2019 |
| 604 | tekstilciler.com | GoDaddy.com, LLC | 20 Nov 2004 | 21 Nov 2023 | 20 Nov 2024 |
| 605 | tekstitv.com | Fabulous.com Pty Ltd. | 14 Jul 2001 | 12 Jul 2023 | 14 Jul 2024 |
| 606 | tekstil-kimyasallari.com | IHS Telekom, Inc. | 11 Jul 2012 | 7 Sep 2016 | 11 Jul 2017 |
| 607 | tekstilgrafigikursu.com | OnlineNIC, Inc. | 15 Dec 2007 | 30 Dec 2015 | 15 Dec 2016 |
| 608 | tekstilkentrehber.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 16 Feb 2011 | 26 Feb 2024 | 16 Feb 2025 |
| 609 | tekstilforum.com | - | 25 Oct 2021 | 9 Oct 2023 | 25 Oct 2024 |
| 610 | tekstilgezgini.com | DNC Holdings, Inc. | 20 Sep 2013 | 21 Sep 2017 | 20 Sep 2018 |
| 611 | tekstiltasiyicilari.com | FBS Inc. | 24 Apr 2013 | 22 Apr 2016 | 24 Apr 2018 |
| 612 | tekstinuitvoering.com | Key-Systems GmbH | 25 Feb 2012 | 25 Feb 2017 | 25 Feb 2018 |
| 613 | tekstilkentkiralik.com | Realtime Register B.V. | 19 Jan 2010 | 20 Dec 2015 | 19 Jan 2017 |
| 614 | tekstilbankasi.com | - | 11 May 2004 | 17 Apr 2024 | 11 May 2025 |
| 615 | tekstilmuhendisi.com | Porkbun, LLC | 24 Jul 2010 | 18 Jul 2023 | 24 Jul 2024 |
| 616 | tekstile.com | GoDaddy.com, LLC | 8 Mar 2005 | 5 Mar 2024 | 8 Mar 2025 |
| 617 | tekstilbaskikimyasallari.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Mar 2014 | 11 Mar 2016 | 5 Mar 2017 |
| 618 | tekstinwerking.com | GoDaddy.com, LLC | 8 Jul 2011 | 1 Jul 2016 | 8 Jul 2017 |
| 619 | tekstiloptom.com | Your Domain Casa, LLC | 16 Mar 2022 | 30 May 2023 | 16 Mar 2023 |
| 620 | tekstil-promosyon.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Jun 2014 | 23 Jul 2023 | 11 Jun 2023 |
| 621 | tekstildunyasidergisi.com | OnlineNIC, Inc. | 15 May 2009 | 9 May 2017 | 15 May 2018 |
| 622 | tekstilmasam.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Mar 2021 | 15 Mar 2021 | 14 Mar 2022 |
| 623 | tekstiltv.com | Dynadot, LLC | 24 Mar 2022 | 25 Mar 2024 | 24 Mar 2025 |
| 624 | tekstilkanali.com | - | 23 Oct 2009 | 2 Aug 2023 | 23 Oct 2026 |
| 625 | tekstick.com | Eranet International Limited | 17 Apr 2023 | 26 Apr 2024 | 17 Apr 2024 |
| 626 | tekstiltelef.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jun 2014 | 7 Jun 2022 | 17 Jun 2024 |
| 627 | tekstijelppi.com | Wild West Domains, LLC | 1 Feb 2014 | 2 Nov 2015 | 1 Feb 2017 |
| 628 | tekstilsatisi.com | FBS Inc. | 15 Jul 2011 | 2 Jul 2016 | 15 Jul 2017 |
| 629 | tekstilbaski.com | GoDaddy.com, LLC | 21 Jan 2024 | 21 Jan 2024 | 21 Jan 2025 |
| 630 | tekstilrehberi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2018 | 3 Nov 2021 | 28 Dec 2026 |
| 631 | tekstiilit.com | West263 International Limited | 17 Apr 2020 | 17 Apr 2020 | 17 Apr 2021 |
| 632 | tekstilkentdekor.com | Reg2C.com Inc. | 3 Sep 2013 | 4 Sep 2016 | 3 Sep 2016 |
| 633 | tekstilmuhendisligi.com | Porkbun, LLC | 14 Sep 2023 | 14 Sep 2023 | 14 Sep 2024 |
| 634 | tekstilbursa.com | Beijing Lanhai Jiye Technology Co., Ltd | 30 Aug 2022 | 11 Sep 2023 | 30 Aug 2024 |
| 635 | tekstilaluminyum.com | - | 19 Sep 2013 | 19 Sep 2023 | 19 Sep 2024 |
| 636 | tekstitaso.com | eNom, Inc. | 28 Dec 2005 | 11 Jul 2016 | 28 Dec 2016 |
| 637 | tekstilaksesuar.com | GoDaddy.com, LLC | 31 May 2021 | 16 Oct 2022 | 31 May 2024 |
| 638 | tekstildijana.com | NameCheap, Inc. | 17 Jun 2012 | 19 Jun 2023 | 17 Jun 2024 |
| 639 | tekstilbanner.com | Realtime Register B.V. | 14 May 2020 | 21 Jun 2023 | 14 May 2024 |
| 640 | tekstildenizi.com | Key-Systems GmbH | 11 Jan 2014 | 11 Jan 2017 | 11 Jan 2018 |
| 641 | tekstilb2b.com | IHS Telekom, Inc. | 26 Apr 2013 | 7 Apr 2017 | 26 Apr 2018 |
| 642 | tekstildershanesi.com | - | 12 Jul 2011 | 18 Jun 2023 | 12 Jul 2024 |
| 643 | tekstilteknik.com | Tucows Domains Inc. | 12 Feb 2004 | 24 Mar 2024 | 12 Feb 2025 |
| 644 | tekstildehersey.com | Reg2C.com Inc. | 5 Apr 2013 | 20 Aug 2016 | 5 Apr 2019 |
| 645 | tekstilmusic.com | Limited Liability Company "Registrar of domain nam… | 23 Apr 2012 | 25 Apr 2024 | 23 Apr 2025 |
| 646 | tekstilterbiye.com | Xiamen ChinaSource Internet Service Co., Ltd. | 24 Aug 2020 | 24 Aug 2020 | 24 Aug 2021 |
| 647 | tekstilsecurities.com | register.com, Inc. | 23 May 2013 | 30 Apr 2015 | 23 May 2017 |
| 648 | tekstilmenkul.com | Internet Domain Services BS Corp | 21 Jan 2018 | 21 Jan 2018 | 21 Jan 2019 |
| 649 | tekstilpazari.com | GoDaddy.com, LLC | 23 Mar 2000 | 23 Mar 2024 | 22 Mar 2025 |
| 650 | tekstilnezapestnice.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2012 | 27 Dec 2016 | 28 Dec 2017 |
| 651 | tekstiiliparoni.com | 1API GmbH | 29 Jan 2014 | 29 Jan 2014 | 29 Jan 2018 |
| 652 | tekstilmakinasi.com | GoDaddy.com, LLC | 18 Dec 2006 | 19 Dec 2023 | 18 Dec 2024 |
| 653 | tekstiltek.com | register.com, Inc. | 8 Jan 2002 | 8 May 2023 | 8 Jan 2025 |
| 654 | tekstilsepeti.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Oct 2007 | 20 Jan 2024 | 19 Oct 2024 |
| 655 | tekstilbulten.com | 1API GmbH | 19 May 2014 | 4 Jun 2016 | 19 May 2017 |
| 656 | tekstilrent.com | GoDaddy.com, LLC | 5 Oct 2012 | 10 Oct 2015 | 5 Oct 2016 |
| 657 | tekstiltestcihazi.com | Ä°simtescil BiliÅŸim A.Åž. | 26 Oct 2020 | 27 Oct 2023 | 26 Oct 2024 |
| 658 | tekstilmoda.com | GoDaddy.com, LLC | 31 Mar 2000 | 31 Mar 2024 | 31 Mar 2025 |
| 659 | tekstilboyalari.com | Google, Inc. | 7 Jul 2010 | 24 Feb 2024 | 7 Jul 2024 |
| 660 | tekstinbeeld.com | Metaregistrar BV Applications | 13 Jul 2009 | 10 Nov 2023 | 13 Jul 2024 |
| 661 | tekstilsanayi.com | IHS Telekom, Inc. | 28 Sep 2011 | 24 Mar 2024 | 28 Sep 2025 |
| 662 | tekstiilipalvelu.com | NameCheap, Inc. | 25 Jan 2001 | 26 Dec 2023 | 25 Jan 2025 |
| 663 | tekstinbeeldmaastricht.com | Hostinger, UAB | 26 Jul 2019 | 26 Jul 2019 | 26 Jul 2020 |
| 664 | tekstilteknoloji.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 23 Oct 2002 | 15 Oct 2023 | 23 Oct 2024 |
| 665 | tekstilaksesuarx.com | Ä°simtescil BiliÅŸim A.Åž. | 18 Feb 2024 | 18 Feb 2024 | 18 Feb 2025 |
| 666 | tekstil.com | Network Solutions, LLC | 17 Nov 1996 | 23 Sep 2019 | 16 Nov 2024 |
| 667 | tekstilleasing.com | register.com, Inc. | 24 Aug 1999 | 29 Sep 2016 | 24 Aug 2017 |
| 668 | tekstilpantone.com | Tucows Domains Inc. | 28 Jul 2012 | 2 Aug 2023 | 28 Jul 2024 |
| 669 | tekstilihracati.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 May 2012 | 12 Apr 2024 | 17 May 2024 |
| 670 | tekstilconcepts.com | Network Solutions, LLC | 10 Apr 1998 | 8 Feb 2021 | 9 Apr 2026 |
| 671 | tekstilisleri.com | IHS Telekom, Inc. | 26 Oct 2010 | 30 Oct 2023 | 26 Oct 2024 |
| 672 | tekstilturkiye.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 22 Aug 2019 | 9 Apr 2022 | 22 Aug 2027 |
| 673 | tekstiltrend.com | GoDaddy.com, LLC | 16 Dec 2002 | 23 Aug 2023 | 16 Dec 2024 |
| 674 | tekstilbilgi.com | Ä°simtescil BiliÅŸim A.Åž. | 10 Feb 2011 | 20 Nov 2023 | 10 Feb 2026 |
| 675 | tekstiviesti.com | eNom, Inc. | 10 Jun 2001 | 9 Jun 2017 | 10 Jun 2018 |
| 676 | tekstilsirketleri.com | GoDaddy.com, LLC | 7 Aug 2009 | 8 Aug 2016 | 7 Aug 2017 |
| 677 | tekstilpazar.com | GoDaddy.com, LLC | 9 Oct 2023 | 9 Oct 2023 | 9 Oct 2024 |
| 678 | tekstilkutuphanesi.com | IHS Telekom, Inc. | 12 Feb 2014 | 13 Feb 2017 | 12 Feb 2018 |
| 679 | tekstilstoklari.com | IHS Telekom, Inc. | 17 Mar 2011 | 8 May 2024 | 17 Mar 2025 |
| 680 | tekstilokulu.com | Tucows Domains Inc. | 4 Mar 2012 | 8 Mar 2023 | 4 Mar 2024 |
| 681 | tekstilbook.com | IHS Telekom, Inc. | 6 Jan 2010 | 16 Feb 2018 | 6 Jan 2018 |
| 682 | tekstil-ticaret.com | Vautron Rechenzentrum AG | 12 Sep 2005 | 14 Sep 2023 | 12 Sep 2024 |
| 683 | tekstir.com | GoDaddy.com, LLC | 16 May 2014 | 17 May 2016 | 16 May 2017 |
| 684 | tekstilnakliyat.com | IHS Telekom, Inc. | 25 Nov 2011 | 4 Jan 2016 | 25 Nov 2016 |
| 685 | tekstilboya.com | NameJolt.com LLC | 8 Dec 2018 | 8 Dec 2018 | 8 Dec 2019 |
| 686 | tekstilrafi.com | Domain.com, LLC | 8 Jul 2014 | 12 Jul 2016 | 8 Jul 2017 |
| 687 | tekstilsertifikasyon.com | GoDaddy.com, LLC | 13 Jul 2011 | 15 Feb 2024 | 13 Jul 2024 |
| 688 | tekstildukkani.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 13 Jan 2021 | 22 Sep 2023 | 13 Jan 2026 |
| 689 | tekstilmagazam.com | GoDaddy.com, LLC | 25 Feb 2010 | 26 Feb 2016 | 25 Feb 2017 |
| 690 | tekstilsozluk.com | Key-Systems GmbH | 16 Dec 2010 | 19 Sep 2012 | 16 Dec 2018 |
| 691 | tekstilbank.com | - | 6 Jan 1999 | 28 Dec 2023 | 6 Jan 2025 |
| 692 | tekstilmagazatasarimi.com | FBS Inc. | 12 May 2014 | 26 Jul 2017 | 12 May 2018 |
| 693 | tekstilburada.com | GoDaddy.com, LLC | 18 Jan 2007 | 19 Jan 2024 | 18 Jan 2025 |
| 694 | tekstilkentemlak.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 19 Sep 2007 | 21 Nov 2023 | 19 Sep 2024 |
| 695 | tekstilreyonu.com | IHS Telekom, Inc. | 12 Oct 2021 | 2 Dec 2023 | 12 Oct 2024 |
| 696 | tekstiililattiat.com | 1API GmbH | 28 Dec 1999 | 10 Jul 2018 | 28 Dec 2024 |
| 697 | tekstilderya.com | Beijing Lanhai Jiye Technology Co., Ltd | 6 Oct 2023 | 18 Oct 2023 | 6 Oct 2024 |
| 698 | tekstilatolyesi.com | FBS Inc. | 7 May 2019 | 8 May 2024 | 7 May 2025 |
| 699 | tekstilgundemi.com | GoDaddy.com, LLC | 10 Apr 2020 | 11 Apr 2024 | 10 Apr 2025 |
| 700 | tekstilemlak.com | Reg2C.com Inc. | 28 Mar 2006 | 25 Mar 2024 | 27 Mar 2025 |
| 701 | tekstilmerkezi.com | Namesnap LLC | 12 Jan 2024 | 2 Feb 2024 | 12 Jan 2025 |
| 702 | tekstilmimarligi.com | eNom, Inc. | 9 Sep 2008 | 2 Feb 2016 | 9 Sep 2018 |
| 703 | tekstilpazarlama.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 2 Jul 2012 | 15 Jun 2021 | 2 Jul 2024 |
| 704 | tekstilisilanlari.com | DropCatch.com 1199 LLC | 30 May 2017 | 30 May 2017 | 30 May 2018 |
| 705 | tekstilvendas.com | eNom, Inc. | 14 Feb 2012 | 4 Feb 2016 | 14 Feb 2017 |
| 706 | tekstilciden.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Sep 2020 | 24 Sep 2020 | 24 Sep 2021 |
| 707 | tekstix.com | EPAG Domainservices GmbH | 13 May 2004 | 14 May 2024 | 13 May 2025 |
| 708 | tekstilvekonfeksiyon.com | Dynadot, LLC | 10 Mar 2022 | 19 Feb 2024 | 10 Mar 2025 |
| 709 | tekstilantrepo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Mar 2011 | 31 Mar 2016 | 5 Mar 2017 |
| 710 | tekstilaksesuari.com | GoDaddy.com, LLC | 9 Jun 2020 | 4 Aug 2023 | 9 Jun 2024 |
| 711 | tekstil-makine.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 6 Jan 2014 | 7 Nov 2023 | 6 Jan 2025 |
| 712 | tekstilmalzemeleri.com | Ä°simtescil BiliÅŸim A.Åž. | 8 May 2023 | 10 Mar 2024 | 8 May 2025 |
| 713 | tekstil-pilovic.com | Name.com, Inc. | 7 Feb 2010 | 8 Feb 2017 | 7 Feb 2018 |
| 714 | tekstilmeydani.com | FBS Inc. | 27 Jan 2012 | 12 Jun 2017 | 27 Jan 2018 |
| 715 | tekstiltest.com | DNC Holdings, Inc. | 1 Dec 2011 | 4 May 2016 | 1 Dec 2021 |
| 716 | tekstilyum.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 18 Nov 2021 | 21 Nov 2021 | 18 Nov 2022 |
| 717 | tekstileff.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Oct 2013 | 12 Nov 2017 | 6 Oct 2017 |
| 718 | tekstilline.com | GoDaddy.com, LLC | 28 Aug 2020 | 28 Aug 2020 | 28 Aug 2022 |
| 719 | tekstiili.com | Dynadot, LLC | 5 Nov 2013 | 11 Dec 2023 | 5 Nov 2024 |
| 720 | tekstilfashionbd.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jun 2009 | 31 May 2023 | 18 Jun 2024 |
| 721 | tekstil24.com | GoDaddy.com, LLC | 18 Apr 2009 | 19 Apr 2016 | 18 Apr 2017 |
| 722 | tekstilhazirgiyim.com | GoDaddy.com, LLC | 25 Jan 2014 | 12 Jan 2024 | 25 Jan 2025 |
| 723 | tekstilkumas.com | Wix.com Ltd. | 20 Apr 2023 | 24 Apr 2024 | 20 Apr 2024 |
| 724 | tekstilmakina.com | - | 30 Sep 2023 | 30 Sep 2023 | 30 Sep 2024 |
| 725 | tekstilnazapestnica.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2012 | 27 Dec 2016 | 28 Dec 2017 |
| 726 | tekstilkentcicekci.com | OnlineNIC, Inc. | 26 Dec 2006 | 20 Dec 2016 | 26 Dec 2017 |
| 727 | tekstildefirsat.com | Ä°simtescil BiliÅŸim A.Åž. | 6 Mar 2012 | 3 Mar 2024 | 6 Mar 2025 |
| 728 | tekstilspray.com | Key-Systems GmbH | 10 Jul 2012 | 11 Jul 2016 | 10 Jul 2017 |
| 729 | tekstilsektoru.com | - | 12 May 2023 | 13 May 2024 | 12 May 2024 |
| 730 | tekstilmalzemesi.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 13 Mar 2018 | 8 Mar 2024 | 13 Mar 2025 |
| 731 | tekstilfirmalari.com | GoDaddy.com, LLC | 16 Sep 2006 | 17 Sep 2023 | 16 Sep 2024 |
| 732 | tekstilurunleri.com | TurnCommerce, Inc. DBA NameBright.com | 26 Jul 2006 | 9 Jul 2022 | 26 Jul 2025 |
| 733 | tekstilkemeri.com | Name.com, Inc. | 25 Sep 2012 | 26 Sep 2016 | 25 Sep 2016 |
| 734 | tekstilticaret.com | Vautron Rechenzentrum AG | 12 Sep 2005 | 14 Sep 2023 | 12 Sep 2024 |
| 735 | tekstilkentrehberi.com | BigRock Solutions Ltd. | 11 Feb 2008 | 12 Jan 2017 | 11 Feb 2018 |
| 736 | tekstilpanosu.com | GoDaddy.com, LLC | 30 Sep 2010 | 1 Oct 2016 | 30 Sep 2017 |
| 737 | tekstitykset.com | George S. Patton, LLC | 3 Mar 2017 | 3 Mar 2017 | 3 Mar 2018 |
| 738 | tekstilkent.com | DomainSite, Inc. | 16 Oct 1998 | 3 Nov 2023 | 15 Oct 2025 |
| 739 | tekstilhome.com | Google, Inc. | 30 Apr 2020 | 1 May 2023 | 30 Apr 2024 |
| 740 | tekstileo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Oct 2013 | 10 Oct 2015 | 14 Oct 2016 |
| 741 | tekstiltrendy.com | Ä°simtescil BiliÅŸim A.Åž. | 26 Dec 2023 | 26 Dec 2023 | 26 Dec 2024 |
| 742 | tekstilkesimhane.com | Tucows Domains Inc. | 10 Jan 2014 | 14 Jan 2021 | 10 Jan 2021 |
| 743 | tekstilkomuru.com | FBS Inc. | 4 May 2017 | 4 Jul 2017 | 4 May 2018 |
| 744 | tekstilmalzeme.com | FBS Inc. | 6 Dec 2008 | 29 Nov 2019 | 6 Dec 2024 |
| 745 | tekstilkentavrupaemlak.com | IHS Telekom, Inc. | 22 May 2014 | 12 Jul 2016 | 22 May 2017 |
| 746 | tekstilmakinaboyasi.com | Google, Inc. | 7 Jul 2010 | 1 Mar 2024 | 7 Jul 2024 |
| 747 | tekstimuusa.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 14 Feb 2013 | 23 Jan 2017 | 14 Feb 2018 |
| 748 | tekstiltrykk.com | Realtime Register B.V. | 7 Aug 2013 | 9 Aug 2023 | 7 Aug 2024 |
| 749 | tekstiltanitim.com | Ä°simtescil BiliÅŸim A.Åž. | 16 Jul 2005 | 1 Jul 2023 | 16 Jul 2024 |
| 750 | tekstilmagasinet.com | Tucows Domains Inc. | 13 May 2009 | 14 Apr 2024 | 13 May 2025 |
| 751 | tekstimoi.com | 1&1 Internet AG | 25 May 2010 | 26 May 2016 | 25 May 2018 |
| 752 | tekstilden.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 16 Apr 2020 | 16 Apr 2020 | 16 Apr 2021 |
| 753 | tekstilmakinaparca.com | Key-Systems GmbH | 7 Dec 2013 | 22 Nov 2023 | 7 Dec 2024 |
| 754 | tekstililanlar.com | IHS Telekom, Inc. | 29 Mar 2014 | 3 Apr 2016 | 29 Mar 2017 |
| 755 | tekstilarama.com | DomainPeople, Inc. | 11 Sep 2000 | 17 Oct 2020 | 11 Sep 2021 |
| 756 | tekstilmanya.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Nov 2012 | 7 Nov 2016 | 27 Nov 2017 |
| 757 | tekstilaparat.com | FBS Inc. | 16 Jul 2014 | 21 Jul 2017 | 16 Jul 2018 |
| 758 | tekstilna-zapestnica.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2012 | 27 Dec 2016 | 28 Dec 2017 |
| 759 | tekstiviestilaina.com | Nordreg AB | 16 Nov 2008 | 27 Oct 2022 | 16 Nov 2024 |
| 760 | tekstilim.com | Reg2C.com Inc. | 20 Aug 2005 | 21 Jun 2021 | 20 Aug 2030 |
| 761 | tekstiltoptan.com | GoDaddy.com, LLC | 28 Jul 2023 | 28 Jul 2023 | 28 Jul 2024 |
| 762 | tekstilisveren.com | GoDaddy.com, LLC | 29 Nov 2005 | 10 Nov 2022 | 29 Nov 2024 |
| 763 | tekstilrehber.com | DROPCATCH.COM 782 LLC | 21 Nov 2017 | 21 Nov 2017 | 21 Nov 2018 |
| 764 | tekstilkentelektrik.com | Ä°simtescil BiliÅŸim A.Åž. | 1 Mar 2024 | 4 Apr 2024 | 1 Mar 2025 |
| 765 | tekstiletiketi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Apr 2008 | 7 Feb 2024 | 24 Apr 2025 |
| 766 | tekstival.com | NameCheap, Inc. | 23 Jan 2020 | 31 Jan 2024 | 23 Jan 2025 |
| 767 | tekstilmakinaboyalari.com | Google, Inc. | 7 Jul 2010 | 24 Feb 2024 | 7 Jul 2024 |
| 768 | tekstilvarak.com | Reg2C.com Inc. | 2 Jan 2011 | 22 Aug 2016 | 2 Jan 2017 |
| 769 | tekstileleman.com | Realtime Register B.V. | 28 Dec 2020 | 12 Dec 2023 | 28 Dec 2024 |
| 770 | tekstilev.com | Dynadot, LLC | 7 Aug 2022 | 17 Sep 2023 | 7 Aug 2024 |
| 771 | tekstiltasarim.com | IHS Telekom, Inc. | 15 Jan 2021 | 23 Mar 2024 | 15 Jan 2025 |
| 772 | tekstilkutu.com | IHS Telekom, Inc. | 13 May 2013 | 13 May 2024 | 13 May 2024 |
| 773 | tekstilprogrami.com | Tucows Domains Inc. | 5 Jan 2010 | 7 Jan 2023 | 5 Jan 2026 |
| 774 | tekstilaksesuarlari.com | Reg2C.com Inc. | 24 Jan 2003 | 7 Jan 2020 | 24 Jan 2025 |
| 775 | tekstililanlari.com | IHS Telekom, Inc. | 7 Apr 2023 | 3 May 2024 | 7 Apr 2025 |
| 776 | tekstilkoleji.com | Reg2C.com Inc. | 20 Jun 2013 | 2 Jun 2017 | 20 Jun 2018 |
| 777 | tekstilkenttoner.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Apr 2013 | 29 Apr 2017 | 7 Apr 2018 |
| 778 | tekstilyardimcikimyasallari.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Dec 2012 | 20 Dec 2022 | 20 Dec 2024 |
| 779 | tekstilmakine.com | Ä°simtescil BiliÅŸim A.Åž. | 7 May 2024 | 7 May 2024 | 7 May 2029 |
| 780 | tekstilgrafiktasarim.com | FBS Inc. | 3 Dec 2013 | 6 Nov 2017 | 3 Dec 2018 |
| 781 | tekstilne-zapestnice.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2012 | 27 Dec 2016 | 28 Dec 2017 |
| 782 | tekstilservis.com | Omnis Network, LLC | 14 Mar 2001 | 1 Dec 2022 | 14 Mar 2032 |
| 783 | tekstilhaberleri.com | register.com, Inc. | 16 Apr 2023 | 18 Apr 2024 | 16 Apr 2025 |
| 784 | tekstilkentelitemlak.com | Name.com, Inc. | 8 Jun 2012 | 1 Jun 2023 | 8 Jun 2024 |
| 785 | tekstilgiyim.com | GoDaddy.com, LLC | 11 Jan 2024 | 18 Feb 2024 | 11 Jan 2025 |
| 786 | tekstilfabrikken.com | Key-Systems GmbH | 28 Feb 2006 | 29 Feb 2016 | 28 Feb 2017 |
| 787 | tekstilkentkolici.com | Ä°simtescil BiliÅŸim A.Åž. | 27 Feb 2014 | 27 Feb 2024 | 27 Feb 2025 |
| 788 | tekstilpasaji.com | GoDaddy.com, LLC | 28 Apr 2009 | 29 Apr 2024 | 28 Apr 2025 |
| 789 | tekstilprojeleri.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Nov 2013 | 19 Nov 2016 | 20 Nov 2017 |
| 790 | tekstiltorbasi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Mar 2013 | 19 Mar 2024 | 17 Mar 2025 |
| 791 | tekstilekspres.com | Realtime Register B.V. | 6 Jun 2005 | 10 Jun 2023 | 6 Jun 2024 |
| 792 | tekstiltelefleri.com | FBS Inc. | 21 Feb 2012 | 21 Feb 2016 | 21 Feb 2017 |
| 793 | tekstilbazar.com | Reg2C.com Inc. | 8 Jan 2013 | 10 Jan 2017 | 8 Jan 2018 |
| 794 | tekstilsrbija.com | Tucows Domains Inc. | 23 Jul 2009 | 27 Jul 2021 | 23 Jul 2021 |
| 795 | tekstilfason.com | Name.com, Inc. | 6 Sep 2012 | 3 Oct 2016 | 6 Sep 2017 |
| 796 | tekstilmakineleri.com | GoDaddy.com, LLC | 20 Mar 2007 | 21 Mar 2024 | 20 Mar 2025 |
| 797 | tekstilstempler.com | Key-Systems GmbH | 17 Sep 2010 | 18 Sep 2015 | 17 Sep 2017 |
| 798 | tekstilkentkozaplazasatilikkiralik.com | Name.com, Inc. | 22 Nov 2012 | 20 Nov 2016 | 22 Nov 2017 |
| 799 | tekstil-nemlendirme.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Mar 2013 | 22 Mar 2016 | 22 Mar 2017 |
| 800 | tekstilmakinelerifuari.com | Realtime Register B.V. | 30 Jan 2007 | 17 Jul 2017 | 30 Jan 2018 |
| 801 | tekstilcilerr.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Jun 2014 | 12 May 2016 | 3 Jun 2017 |
| 802 | tekstilcephegiydirme.com | eNom, Inc. | 16 Feb 2010 | 18 Jan 2017 | 16 Feb 2018 |
| 803 | tekstilkunst.com | NameForward LLC | 25 Apr 2013 | 26 Apr 2017 | 25 Apr 2018 |
| 804 | tekstiviestit.com | eNom, Inc. | 10 Jun 2001 | 9 Jun 2017 | 10 Jun 2018 |
| 805 | tekstinbedrijf.com | Hosting Concepts B.V. dba Openprovider | 4 Nov 2022 | 14 Jan 2024 | 4 Nov 2023 |
| 806 | teksti-pesen.com | Tucows Domains Inc. | 28 Feb 2022 | 28 Feb 2022 | 28 Feb 2023 |
| 807 | tekstilmakinaborsasi.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 1 Oct 2009 | 5 Jun 2023 | 1 Oct 2026 |
| 808 | tekstilyapi.com | NameCheap, Inc. | 13 Jul 2006 | 16 Jun 2023 | 13 Jul 2024 |
| 809 | tekstilsitesi.com | IHS Telekom, Inc. | 20 Apr 2020 | 20 Apr 2020 | 20 Apr 2021 |
| 810 | tekstilshop.com | GoDaddy.com, LLC | 23 Feb 2012 | 27 Feb 2024 | 23 Feb 2025 |
| 811 | tekstilkanal.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Oct 2009 | 20 Oct 2023 | 27 Oct 2024 |
| 812 | tekstilfashion.com | GoDaddy.com, LLC | 7 Mar 2024 | 8 Mar 2024 | 7 Mar 2025 |
| 813 | tekstilcephe.com | NameCheap, Inc. | 16 Feb 2010 | 18 Jan 2024 | 16 Feb 2025 |
| 814 | tekstilyapilar.com | FastDomain Inc. | 5 Aug 2023 | 19 Dec 2023 | 5 Aug 2024 |
| 815 | tekstilpark.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 20 Sep 2007 | 13 Sep 2023 | 20 Sep 2024 |
| 816 | tekstil-partner.com | Nictrade Internet Identity Provider AB. | 14 Nov 2006 | 15 Aug 2017 | 14 Nov 2019 |
| 817 | tekstilbarby.com | Hosting Concepts B.V. dba Openprovider | 22 Sep 2021 | 24 Sep 2021 | 22 Sep 2022 |
| 818 | tekstilavm.com | Ä°simtescil BiliÅŸim A.Åž. | 22 Mar 2023 | 27 Aug 2023 | 22 Mar 2025 |
| 819 | tekstilport.com | Automattic Inc. | 22 Dec 2012 | 25 Oct 2023 | 22 Dec 2024 |
| 820 | tekstina.com | Realtime Register B.V. | 5 Oct 2000 | 1 Oct 2023 | 5 Oct 2024 |
| 821 | tekstilbanktv.com | Alantron BiliÅŸim Ltd Åžti. | 11 Oct 2015 | 3 Feb 2010 | 4 Oct 2016 |
| 822 | tekstilbulteni.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 3 Mar 2024 | 3 Mar 2024 | 3 Mar 2025 |
| 823 | tekstilab.com | FBS Inc. | 6 Feb 2014 | 8 Apr 2014 | 6 Feb 2021 |
| 824 | tekstilkurutma.com | Vautron Rechenzentrum AG | 7 Oct 2010 | 9 Oct 2017 | 7 Oct 2018 |
| 825 | tekstilciburaya.com | eNom, Inc. | 24 Nov 2011 | 14 Nov 2017 | 24 Nov 2017 |
| 826 | tekstildijitalbaski.com | Google, Inc. | 16 Aug 2019 | 25 Nov 2023 | 16 Aug 2024 |
| 827 | tekstilinevi.com | Realtime Register B.V. | 6 Dec 2007 | 13 Dec 2023 | 6 Dec 2024 |
| 828 | tekstildergisi.com | 1API GmbH | 26 Sep 2009 | 22 May 2018 | 26 Sep 2024 |
| 829 | tekstilmakinalari.com | GoDaddy.com, LLC | 17 Apr 2006 | 29 Apr 2024 | 17 Apr 2025 |
| 830 | tekstilkentwebtasarim.com | FBS Inc. | 15 Feb 2013 | 12 Jun 2017 | 15 Feb 2018 |
| 831 | tekstildiyari.com | - | 13 Mar 2014 | 10 May 2023 | 13 Mar 2032 |
| 832 | tekstiki.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Feb 2014 | 23 Feb 2017 | 2 Feb 2018 |
| 833 | tekstilotel.com | FBS Inc. | 15 May 2012 | 22 May 2023 | 15 May 2024 |
| 834 | tekstilturk.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 22 Feb 2024 | 22 Feb 2024 | 22 Feb 2025 |
| 835 | teksting.com | Tucows Domains Inc. | 24 Feb 2011 | 28 Nov 2016 | 24 Feb 2018 |
| 836 | tekstilcity.com | eNom, Inc. | 8 Feb 2010 | 6 Jun 2017 | 8 Feb 2018 |
| 837 | tekstil-lux.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jan 2012 | 11 Jan 2016 | 18 Jan 2017 |
| 838 | tekstinzicht.com | Key-Systems GmbH | 24 May 2023 | 24 May 2023 | 24 May 2024 |
| 839 | tekstilsarayi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Oct 2010 | 9 Oct 2023 | 10 Oct 2024 |
| 840 | tekstilimalat.com | Wix.com Ltd. | 23 Oct 2021 | 27 Oct 2022 | 23 Oct 2022 |
| 841 | tekstid.com | TurnCommerce, Inc. DBA NameBright.com | 26 Mar 2014 | 20 Mar 2021 | 26 Mar 2025 |
| 842 | tekstil-71.com | - | 7 Oct 2016 | 7 Oct 2016 | 7 Oct 2017 |
| 843 | tekstilschiky.info | Regtime Ltd. | 12 Dec 2007 | 21 Feb 2017 | 12 Dec 2017 |
| 844 | tekstil-2012.info | 1&1 Internet AG | 19 Sep 2012 | 28 Sep 2016 | 19 Sep 2017 |
| 845 | tekstilstempler.info | Key-Systems GmbH | 17 Sep 2010 | 30 Oct 2017 | 17 Sep 2018 |
| 846 | tekstildesign.info | Web Commerce Communications Limited dba WebNic.cc | 22 Jul 2014 | 17 Jun 2018 | 22 Jul 2020 |
| 847 | tekstiviestit.info | GMO Internet Inc. | 29 Oct 2013 | 7 Oct 2016 | 29 Oct 2016 |
| 848 | tekstilaksesuarlari.info | GoDaddy.com, LLC | 6 Jan 2012 | 6 Jan 2015 | 6 Jan 2020 |
| 849 | tekstilstempel.info | Key-Systems GmbH | 2 Sep 2010 | 2 Sep 2016 | 2 Sep 2017 |
| 850 | tekstilkolbandi.info | Nics Telekomünikasyon Ticaret Ltd. Şti. | 15 Sep 2013 | 17 Sep 2016 | 15 Sep 2017 |
| 851 | tekstiiliteollisuus.info | CommuniGal Communication Ltd. | 28 Mar 2024 | 29 Mar 2024 | 28 Mar 2025 |
| 852 | tekstilisveren.info | GoDaddy.com, LLC | 25 Nov 2011 | 12 Aug 2023 | 25 Nov 2024 |
| 853 | tekstilsertifikasyon.info | GoDaddy.com, LLC | 13 Jul 2011 | 2 Jul 2013 | 13 Jul 2018 |
| 854 | tekstilkentfotografcilik.com | - | 12 Oct 2016 | 12 Oct 2016 | 12 Oct 2017 |
| 855 | tekstilmarmara.com | FBS Inc. | 11 Oct 2016 | 21 Nov 2017 | 11 Oct 2017 |
| 856 | tekstilkentkurye.net | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 13 Oct 2016 | 23 Nov 2017 | 13 Oct 2017 |
| 857 | tekstilkentmarket.com | FBS Inc. | 28 Jan 2019 | 28 Jan 2019 | 28 Jan 2020 |
| 858 | tekstilcekimleri.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Oct 2016 | 26 Nov 2017 | 15 Oct 2017 |
| 859 | tekstilstore.net | FBS Inc. | 17 Oct 2016 | 27 Nov 2017 | 17 Oct 2017 |
| 860 | tekstilneshitje.com | - | 17 Oct 2016 | 17 Oct 2016 | 17 Oct 2017 |
| 861 | tekstilreyonu.net | Google, Inc. | 12 Oct 2021 | 13 Oct 2023 | 12 Oct 2024 |
| 862 | tekstilbilet.net | Tucows Domains Inc. | 14 Nov 2012 | 18 Nov 2017 | 14 Nov 2017 |
| 863 | tekstilistanbul.net | FBS Inc. | 12 Feb 2014 | 11 Mar 2024 | 12 Feb 2025 |
| 864 | tekstilne-zapestnice.net | Gransy s.r.o. d/b/a subreg.cz | 28 Dec 2012 | 17 Jan 2024 | 28 Dec 2023 |
| 865 | tekstilpazari.net | GoDaddy.com, LLC | 15 Jun 2000 | 26 Jun 2023 | 15 Jun 2024 |
| 866 | tekstilatolyesi.net | IHS Telekom, Inc. | 16 Dec 2013 | 23 Dec 2016 | 16 Dec 2017 |
| 867 | tekstitykset.net | Domain Secure LLC | 1 Aug 2017 | 2 Aug 2017 | 1 Aug 2018 |
| 868 | tekstilkentbilgisayarservisi.net | Ä°simtescil BiliÅŸim A.Åž. | 14 Sep 2015 | 14 Sep 2023 | 14 Sep 2024 |
| 869 | tekstilnazapestnica.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2012 | 28 Nov 2017 | 28 Dec 2018 |
| 870 | tekstilaksesuarlar.net | Reg2C.com Inc. | 28 Nov 2011 | 28 Nov 2017 | 28 Nov 2017 |
| 871 | tekstilci.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 14 Dec 2022 | 23 Feb 2024 | 14 Dec 2023 |
| 872 | tekstilnezapestnice.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2012 | 28 Nov 2017 | 28 Dec 2018 |
| 873 | tekstilportal.net | OnlineNIC, Inc. | 1 Feb 2005 | 8 Jan 2024 | 1 Feb 2025 |
| 874 | tekstila.net | Hosting Concepts B.V. dba Openprovider | 19 Jan 2014 | 19 Jan 2024 | 19 Jan 2025 |
| 875 | tekstililanlari.net | IHS Telekom, Inc. | 18 Jun 2014 | 27 Jun 2016 | 18 Jun 2017 |
| 876 | tekstilisveren.net | GoDaddy.com, LLC | 29 Nov 2005 | 10 Nov 2022 | 29 Nov 2024 |
| 877 | tekstilmakinaboyasi.net | FBS Inc. | 7 Jul 2010 | 5 Jul 2017 | 7 Jul 2018 |
| 878 | tekstilboya.net | FBS Inc. | 7 Jul 2010 | 5 Jul 2017 | 7 Jul 2018 |
| 879 | tekstileleman.net | IHS Telekom, Inc. | 10 Apr 2014 | 25 Apr 2017 | 10 Apr 2018 |
| 880 | tekstilurunleri.net | IHS Telekom, Inc. | 24 Mar 2014 | 15 Jan 2024 | 24 Mar 2025 |
| 881 | tekstilinternet.net | Namesilo, LLC | 25 Jun 2018 | 26 Jun 2018 | 25 Jun 2019 |
| 882 | tekstiviestilaina.net | Nordreg AB | 16 Nov 2008 | 27 Oct 2022 | 16 Nov 2024 |
| 883 | tekstil-kimyasallari.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Dec 2011 | 14 Dec 2016 | 16 Dec 2017 |
| 884 | tekstilstempel.net | Key-Systems GmbH | 2 Sep 2010 | 3 Sep 2016 | 2 Sep 2017 |
| 885 | tekstiltasarim.net | Dynadot, LLC | 13 Mar 2022 | 13 Mar 2023 | 13 Mar 2024 |
| 886 | tekstilna-zapestnica.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Dec 2012 | 28 Nov 2017 | 28 Dec 2018 |
| 887 | tekstili.net | Reg2C.com Inc. | 26 Oct 2011 | 2 Dec 2017 | 26 Oct 2017 |
| 888 | tekstilcaddesi.net | GoDaddy.com, LLC | 6 Jan 2014 | 4 May 2015 | 6 Jan 2017 |
| 889 | tekstilbank.net | FBS Inc. | 20 Sep 2008 | 20 Sep 2016 | 20 Sep 2016 |
| 890 | tekstilkumas.net | Reg2C.com Inc. | 28 Nov 2011 | 28 Nov 2017 | 28 Nov 2017 |
| 891 | tekstilstempler.net | Key-Systems GmbH | 17 Sep 2010 | 18 Sep 2016 | 17 Sep 2017 |
| 892 | tekstitakomo.net | OVH sas | 4 Jul 2013 | 10 Jun 2017 | 4 Jul 2018 |
| 893 | tekstilisleri.net | IHS Telekom, Inc. | 26 Oct 2010 | 30 Oct 2023 | 26 Oct 2024 |
| 894 | tekstilmakinaboyalari.net | FBS Inc. | 7 Jul 2010 | 5 Jul 2017 | 7 Jul 2018 |
| 895 | tekstildefirsat.net | Ä°simtescil BiliÅŸim A.Åž. | 6 Mar 2012 | 3 Mar 2024 | 6 Mar 2025 |
| 896 | tekstililan.net | IHS Telekom, Inc. | 10 Apr 2014 | 28 Apr 2016 | 10 Apr 2017 |
| 897 | tekstilyazici.net | FBS Inc. | 27 Jan 2014 | 18 May 2017 | 27 Jan 2018 |
| 898 | tekstilticaret.net | Reg2C.com Inc. | 28 Nov 2011 | 28 Nov 2017 | 28 Nov 2017 |
| 899 | tekstilport.net | GoDaddy.com, LLC | 19 Jan 2011 | 25 Apr 2015 | 19 Jan 2017 |
| 900 | tekstilbankasi.net | Alantron BiliÅŸim Ltd Åžti. | 20 Jan 2018 | 8 Feb 2018 | 1 Jan 2019 |
| 901 | tekstiililehti.net | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 24 Feb 2003 | 25 Jan 2017 | 24 Feb 2018 |
| 902 | tekstilsertifikasyon.net | GoDaddy.com, LLC | 13 Jul 2011 | 2 Jul 2013 | 13 Jul 2018 |
| 903 | tekstilboyalari.net | FBS Inc. | 7 Jul 2010 | 5 Jul 2017 | 7 Jul 2018 |
| 904 | teksting.net | Tucows Domains Inc. | 5 Mar 2014 | 9 Mar 2018 | 5 Mar 2018 |
| 905 | tekstilbursa.net | FBS Inc. | 27 Mar 2018 | 27 Mar 2018 | 27 Mar 2019 |
| 906 | tekstivelho.net | Wix.com Ltd. | 29 Apr 2023 | 3 May 2024 | 29 Apr 2025 |
| 907 | tekstilisguvenligi.net | IHS Telekom, Inc. | 11 Jul 2014 | 21 Jul 2017 | 11 Jul 2018 |
| 908 | tekstilev.net | FBS Inc. | 7 Apr 2011 | 7 Apr 2016 | 7 Apr 2017 |
| 909 | tekstilmakinasi.net | Reg2C.com Inc. | 28 Nov 2011 | 28 Nov 2017 | 28 Nov 2017 |
| 910 | tekstilmakinesi.net | Reg2C.com Inc. | 28 Nov 2011 | 28 Nov 2017 | 28 Nov 2017 |
| 911 | tekstilciler.net | GoDaddy.com, LLC | 4 May 2008 | 5 May 2016 | 4 May 2017 |
| 912 | tekstilokulu.net | eNom, Inc. | 20 Jan 2010 | 25 Dec 2017 | 20 Jan 2019 |
| 913 | tekstilboyasi.net | FBS Inc. | 7 Jul 2010 | 5 Jul 2017 | 7 Jul 2018 |
| 914 | tekstilkentcicekci.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Feb 2011 | 22 Feb 2017 | 22 Feb 2018 |
| 915 | tekstil.net | Ä°simtescil BiliÅŸim A.Åž. | 17 Apr 2001 | 20 Apr 2024 | 17 Apr 2025 |
| 916 | tekstildunyasi.net | Domain.com, LLC | 10 Nov 2004 | 12 Aug 2017 | 10 Nov 2018 |
| 917 | tekstileff.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Oct 2013 | 7 Oct 2016 | 6 Oct 2016 |
| 918 | tekstilportali.net | GMO Internet Inc. | 26 Dec 2010 | 11 Dec 2016 | 26 Dec 2017 |
| 919 | tekstilkenthaber.net | Automattic Inc. | 21 Nov 2022 | 2 Aug 2023 | 21 Nov 2026 |
| 920 | tekstilkent.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 24 Feb 2019 | 5 Dec 2023 | 24 Feb 2025 |
| 921 | tekstiilitaito.net | eNom, Inc. | 26 Feb 2010 | 12 Feb 2016 | 26 Feb 2017 |
| 922 | tekstilstempler.org | Key-Systems GmbH | 17 Sep 2010 | 18 Sep 2016 | 17 Sep 2017 |
| 923 | tekstilkent.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Oct 2017 | 16 Sep 2023 | 9 Oct 2024 |
| 924 | tekstil.org | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 7 Dec 1997 | 20 Nov 2023 | 6 Dec 2024 |
| 925 | tekstilyatekstil.org | EPAG Domainservices GmbH | 11 Apr 2014 | 12 Apr 2017 | 11 Apr 2018 |
| 926 | tekstilpazari.org | GoDaddy.com, LLC | 29 Jan 2011 | 14 Mar 2024 | 29 Jan 2025 |
| 927 | tekstid.org | Hosting Concepts B.V. dba Openprovider | 20 Jun 2007 | 4 Aug 2023 | 20 Jun 2024 |
| 928 | tekstilsanayi.org | IHS Telekom, Inc. | 17 Jan 2010 | 26 Feb 2016 | 17 Jan 2017 |
| 929 | tekstilkentcicekci.org | FBS Inc. | 10 Jun 2013 | 12 Jun 2017 | 10 Jun 2018 |
| 930 | tekstilistanbul.org | FBS Inc. | 7 Nov 2017 | 7 Nov 2017 | 7 Nov 2018 |
| 931 | tekstilmakinalari.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jul 2010 | 18 Aug 2017 | 13 Jul 2018 |
| 932 | tekstilisveren.org | GoDaddy.com, LLC | 29 Nov 2005 | 17 Aug 2023 | 29 Nov 2024 |
| 933 | teksting.org | Tucows Domains Inc. | 23 Feb 2011 | 28 Jan 2017 | 23 Feb 2018 |
| 934 | tekstilkolbandi.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 15 Sep 2013 | 17 Sep 2016 | 15 Sep 2017 |
| 935 | tekstilstempel.org | Key-Systems GmbH | 2 Sep 2010 | 3 Sep 2016 | 2 Sep 2017 |
| 936 | tekstilsertifikasyon.org | GoDaddy.com, LLC | 13 Jul 2011 | 2 Jul 2013 | 13 Jul 2018 |
| 937 | tekstilkunst.org | Domeneshop AS dba domainnameshop.com | 5 Apr 2006 | 15 Mar 2024 | 5 Apr 2025 |
| 938 | tekstilbaskimakineleri.com | - | 21 Oct 2016 | 21 Oct 2016 | 21 Oct 2017 |
| 939 | tekstilpedia.com | CV. Jogjacamp | 8 Jan 2019 | 23 Jan 2024 | 8 Jan 2025 |
| 940 | tekstiltasimaciligi.xyz | FBS Inc. | 12 Apr 2016 | 17 Apr 2016 | 12 Apr 2017 |
| 941 | tekstilistanbul.xyz | NameCheap, Inc. | 3 Jun 2016 | 10 Sep 2016 | 3 Jun 2017 |
| 942 | tekstilshchiki.xyz | OnlineNIC, Inc. | 2 Jun 2016 | 29 Jul 2016 | 2 Jun 2017 |
| 943 | tekstilfirmalari.xyz | Nics Telekomünikasyon Ticaret Ltd. Şti. | 26 Oct 2016 | 31 Oct 2016 | 26 Oct 2017 |
| 944 | tekstil-tryk.dk | - | 19 Mar 2010 | - | 31 Mar 2025 |
| 945 | tekstilgrafikkursu.com | Name.com, Inc. | 27 Oct 2016 | 25 Oct 2017 | 27 Oct 2018 |
| 946 | tekstilpazar.org | - | 27 Oct 2016 | 27 Oct 2016 | 27 Oct 2017 |
| 947 | tekstilpleje.dk | - | 15 Feb 2006 | - | 28 Feb 2025 |
| 948 | tekstiil.eu | EuroDNS S.A. | - | - | - |
| 949 | tekstildesign.dk | - | 2 Dec 2015 | - | 31 Dec 2017 |
| 950 | tekstile-illusioner.dk | - | 28 Sep 2004 | - | 30 Sep 2024 |
| 951 | tekstilerum.dk | - | 10 Nov 2011 | - | 30 Nov 2024 |
| 952 | tekstillaug.dk | - | 13 Mar 2002 | - | 31 Mar 2022 |
| 953 | tekstilkesimci.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Oct 2016 | 9 Dec 2017 | 28 Oct 2017 |
| 954 | tekstilpazar.net | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 27 Dec 2021 | 27 Dec 2021 | 27 Dec 2022 |
| 955 | tekstilkentmotokurye.com | - | 31 Oct 2016 | 31 Oct 2016 | 31 Oct 2017 |
| 956 | tekstiletiket.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 18 Oct 2006 | 20 Oct 2023 | 18 Oct 2024 |
| 957 | tekstil-etiket.xyz | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Nov 2016 | 20 Dec 2017 | 9 Nov 2017 |
| 958 | tekstir.net | eNom, Inc. | 10 Nov 2016 | 5 Nov 2017 | 10 Nov 2018 |
| 959 | tekstilspot.net | FBS Inc. | 10 Nov 2016 | 5 Jun 2017 | 10 Nov 2018 |
| 960 | tekstilyolu.com | eNom, Inc. | 11 Nov 2016 | 12 Nov 2017 | 11 Nov 2018 |
| 961 | tekstiltasima.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 31 Jul 2021 | 31 Jul 2021 | 31 Jul 2022 |
| 962 | tekstil.space | Limited Liability Company "Registrar of domain nam… | 12 Nov 2016 | - | 12 Nov 2017 |
| 963 | tekstilsarf.xyz | Nics Telekomünikasyon Ticaret Ltd. Şti. | 15 Nov 2016 | 26 Dec 2017 | 15 Nov 2017 |
| 964 | tekstilbrend.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 15 Nov 2016 | 20 Nov 2017 | 15 Nov 2018 |
| 965 | tekstilurunleri.xyz | FBS Inc. | 19 Nov 2016 | 24 Nov 2016 | 19 Nov 2017 |
| 966 | tekstilsehri.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 28 Apr 2022 | 29 Apr 2023 | 28 Apr 2024 |
| 967 | tekstil-collection.online | Regional Network Information Center, JSC dba RU-CE… | 26 Nov 2016 | 1 Dec 2016 | 26 Nov 2018 |
| 968 | tekstilkurslari.xyz | FBS Inc. | 27 Nov 2016 | 28 Dec 2017 | 27 Nov 2017 |
| 969 | tekstilfirmalarim.xyz | FBS Inc. | 28 Nov 2016 | 29 Nov 2017 | 28 Nov 2017 |
| 970 | tekstilisilanlari.info | FBS Inc. | 4 Dec 2016 | 4 Dec 2017 | 4 Dec 2018 |
| 971 | tekstilkenti.com | GoDaddy.com, LLC | 2 Jun 2018 | 2 Jun 2018 | 2 Jun 2019 |
| 972 | tekstilpark.net | Reg2C.com Inc. | 10 Dec 2016 | 6 Dec 2017 | 10 Dec 2018 |
| 973 | tekstiil.design | Porkbun, LLC | 13 Dec 2016 | 12 Jan 2018 | 13 Dec 2017 |
| 974 | tekstilkalipofisi.com | GoDaddy.com, LLC | 15 Dec 2016 | 15 Dec 2016 | 15 Dec 2017 |
| 975 | tekstilfirmam.com | GoDaddy.com, LLC | 17 Dec 2016 | 17 Dec 2016 | 17 Dec 2018 |
| 976 | tekstilhaber.site | FBS Inc. | 17 Dec 2016 | 18 Dec 2017 | 17 Dec 2017 |
| 977 | tekstillaminasyon.com | Name.com, Inc. | 19 Dec 2016 | 19 Nov 2017 | 19 Dec 2018 |
| 978 | tekstilgb.com | GMO Internet Inc. | 10 Mar 2018 | - | 9 Mar 2019 |
| 979 | tekstilbaskisi.net | GoDaddy.com, LLC | 22 Dec 2016 | 22 Dec 2016 | 22 Dec 2021 |
| 980 | tekstilsanat.com | Ä°simtescil BiliÅŸim A.Åž. | 22 Jan 2022 | 3 Jan 2024 | 22 Jan 2025 |
| 981 | tekstileku.com | CV. Jogjacamp | 6 Jan 2017 | 7 Jan 2018 | 6 Jan 2018 |
| 982 | tekstilsempozyumu.org | Realtime Register B.V. | 6 Jan 2017 | 8 Mar 2017 | 6 Jan 2018 |
| 983 | tekstillightbox.com | FBS Inc. | 9 Jan 2017 | 5 Jun 2017 | 9 Jan 2019 |
| 984 | tekstillightbox.net | FBS Inc. | 9 Jan 2017 | 15 Dec 2017 | 9 Jan 2019 |
| 985 | tekstil-etiket.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 13 Jan 2017 | 14 Jan 2018 | 13 Jan 2019 |
| 986 | tekstilkentsigorta.com | IHS Telekom, Inc. | 17 Jan 2017 | 16 Jan 2018 | 17 Jan 2019 |
| 987 | tekstilmatter.com | GoDaddy.com, LLC | 18 Jan 2017 | 18 Jan 2017 | 18 Jan 2019 |
| 988 | tekstilumay.com | IHS Telekom, Inc. | 18 Jan 2017 | 18 Jan 2018 | 18 Jan 2018 |
| 989 | tekstil-ithalatcilari.com | FBS Inc. | 19 Jan 2017 | 22 May 2017 | 19 Jan 2018 |
| 990 | tekstilimalatcilari.com | FBS Inc. | 19 Jan 2017 | 22 May 2017 | 19 Jan 2018 |
| 991 | tekstil-ihracatcilari.com | FBS Inc. | 19 Jan 2017 | 22 May 2017 | 19 Jan 2018 |
| 992 | tekstil-imalatcilari.com | FBS Inc. | 19 Jan 2017 | 22 May 2017 | 19 Jan 2018 |
| 993 | tekstilimalatcilari.net | FBS Inc. | 19 Jan 2017 | 22 May 2017 | 19 Jan 2018 |
| 994 | tekstil-imalatcilari.net | FBS Inc. | 19 Jan 2017 | 22 May 2017 | 19 Jan 2018 |
| 995 | tekstilithalatcilari.com | FBS Inc. | 19 Jan 2017 | 22 May 2017 | 19 Jan 2018 |
| 996 | tekstilihracatcilari.com | FBS Inc. | 19 Jan 2017 | 22 May 2017 | 19 Jan 2018 |
| 997 | tekstilimalatcilari.xyz | FBS Inc. | 19 Jan 2017 | - | 19 Jan 2018 |
| 998 | tekstilmart.com | GoDaddy.com, LLC | 21 Jan 2017 | 22 Jan 2024 | 21 Jan 2025 |
| 999 | tekstilmedya.com | Network Solutions, LLC | 18 Jan 2019 | 18 Jan 2019 | 18 Jan 2020 |
| 1000 | tekstilkentfuar.com | Key-Systems GmbH | 26 Jan 2017 | 10 Feb 2017 | 26 Jan 2018 |
Displaying 1,000 out of 2,113 domains starting with the keyword "TEKSTI". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=teksti
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |