With support for 
Keyword: TEAMKENNEDY
Reverse Whois » KEYWORD [teamkennedy ] { 28 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | teamkennedy.com | GoDaddy.com, LLC | 7 May 2016 | 15 May 2026 | 7 May 2027 |
| 2 | teamkennedy.net | Porkbun, LLC | 23 Mar 2006 | 21 Mar 2026 | 22 Mar 2027 |
| 3 | teamkennedy.org | Advanced Internet Technologies, Inc. (AIT) | 8 Mar 2023 | 12 Aug 2026 | 8 Mar 2027 |
| 4 | teamkennedy.ca | - | 7 Jun 2022 | 12 Aug 2026 | 7 Jun 2034 |
| 5 | teamkennedywarren.com | GoDaddy.com, LLC | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 6 | teamkennedyrealty.com | GoDaddy.com, LLC | 4 Apr 2018 | 5 Apr 2026 | 4 Apr 2027 |
| 7 | teamkennedyforever.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 8 | teamkennedy-rc.com | register.com, Inc. | 2 Nov 2008 | 3 Oct 2025 | 2 Nov 2026 |
| 9 | teamkennedyhockey.com | GoDaddy.com, LLC | 12 Oct 2013 | 15 Sep 2015 | 12 Oct 2016 |
| 10 | teamkennedycare.com | GoDaddy.com, LLC | 26 Oct 2016 | 27 Oct 2024 | 26 Oct 2026 |
| 11 | teamkennedyunited.org | pair Networks, Inc. d/b/a pairNIC | 13 May 2017 | 12 Jul 2017 | 13 May 2020 |
| 12 | teamkennedy2017.org | pair Networks, Inc. d/b/a pairNIC | 13 May 2017 | 12 Jul 2017 | 13 May 2018 |
| 13 | teamkennedy2019.com | Tucows Domains Inc. | 6 Dec 2018 | 10 Dec 2019 | 6 Dec 2019 |
| 14 | teamkennedyhouses4you.com | GoDaddy.com, LLC | 12 Nov 2019 | 12 Nov 2019 | 12 Nov 2021 |
| 15 | teamkennedylawnandlandscapingllc.com | GoDaddy.com, LLC | 9 Jun 2020 | 9 Jun 2020 | 9 Jun 2021 |
| 16 | teamkennedylawnandlandscaping.com | GoDaddy.com, LLC | 9 Jun 2020 | 9 Jun 2020 | 9 Jun 2021 |
| 17 | teamkennedycalgary.ca | - | 18 Oct 2022 | 19 Oct 2025 | 18 Oct 2028 |
| 18 | teamkennedy2024.org | GoDaddy.com, LLC | 15 Mar 2023 | 29 Apr 2025 | 15 Mar 2027 |
| 19 | teamkennedy24.org | GoDaddy.com, LLC | 15 Mar 2023 | 29 Apr 2025 | 15 Mar 2027 |
| 20 | teamkennedy2024.com | GoDaddy.com, LLC | 15 Mar 2023 | 16 Mar 2025 | 15 Mar 2027 |
| 21 | teamkennedy24.com | GoDaddy.com, LLC | 15 Mar 2023 | 16 Mar 2025 | 15 Mar 2027 |
| 22 | teamkennedy2024.net | GoDaddy.com, LLC | 15 Mar 2023 | 16 Mar 2025 | 15 Mar 2027 |
| 23 | teamkennedy24.net | GoDaddy.com, LLC | 15 Mar 2023 | 16 Mar 2025 | 15 Mar 2027 |
| 24 | teamkennedyedmonton.ca | - | 18 Oct 2022 | 9 Oct 2025 | 18 Oct 2028 |
| 25 | teamkennedybc.ca | - | 18 Oct 2022 | 9 Oct 2025 | 18 Oct 2028 |
| 26 | teamkennedyshanahan.com | GoDaddy.com, LLC | 26 Mar 2024 | 7 Jun 2026 | 26 Mar 2026 |
| 27 | teamkennedy-lc.com | Google, Inc. | 24 Jun 2024 | 9 Jun 2026 | 24 Jun 2027 |
| 28 | teamkennedyroofingsolutions.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jul 2026 | 1 Sep 2026 | 2 Jul 2027 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=teamkennedy
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 5,000 Reverse Whois API Queries | 5,000 | $50 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |