Our database now contains whois records of 697 Million (697,391,088) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1596 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [697 Million Domains] $10,000 Details

Keyword: TBSE

Reverse Whois » KEYWORD [tbse ]  { 741 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1tbse.in-11 Dec 200925 Jan 202611 Dec 2026
2tbse.comNetwork Solutions, LLC17 Aug 199817 Jun 202216 Aug 2027
3tbse.xyzGMO Internet Inc.10 Jun 2026-10 Jun 2027
4tbse.topChengdu West Dimension Digital Technology Co., Ltd…15 Feb 2016-15 Feb 2017
5tbse.wangeName Technology Co., Ltd.1 Mar 2016-1 Mar 2017
6tbse.net-9 Apr 20249 May 20269 Apr 2027
7tbse.orgDynadot, LLC19 Jul 20192 Sep 202519 Jul 2026
8tbse.ltdMesh Digital Limited4 Apr 20172 Apr 20204 Apr 2021
9tbse.org.uk-24 Apr 201711 Jun 201724 Apr 2018
10tbse.co.inWild West Domains, LLC25 Mar 201530 May 202525 Mar 2027
11tbse.info-6 May 20266 May 2026-
12tbse.exchangeGoDaddy.com, LLC17 Feb 202018 Apr 202317 Feb 2023
13tbse.siteNetwork Solutions, LLC9 Oct 202021 Dec 20239 Oct 2023
14tbse.usGoDaddy.com, LLC30 Jun 20102 Jul 202429 Jun 2027
15tbse.ccChengdu West Dimension Digital Technology Co., Ltd…21 Jul 201321 Jul 201321 Jul 2027
16tbse.cn-7 Jun 2015-7 Jun 2027
17tbse.com.cn????????????4 May 2013-4 May 2027
18tbse.co.uk-22 Aug 202123 Jul 202522 Aug 2026
19tbse.coCSC Corporate Domains, Inc.24 Aug 201624 Aug 202523 Aug 2026
20tbse.nl-15 Feb 202314 Feb 2025-
21tbse.ca-9 Mar 20222 Feb 20269 Mar 2027
22tbse.uk-14 Oct 202315 Oct 202514 Oct 2027
23tbse.shopRealtime Register B.V.10 Jan 202522 Feb 202610 Jan 2026
24tbse.ru-9 Dec 2014-9 Dec 2026
25tbse.se-27 May 20251 May 202627 May 2027
26tbse.asiaAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…9 May 202410 May 20259 May 2026
27tbse.atWorld4You Internet Services GmbH-15 Apr 2020-
28tbse.de--6 Mar 2026-
29tbse.euRealtime Register B.V.---
30tbse.co.jp-8 Apr 20221 May 2026-
31tbse.londonNameCheap, Inc.4 Mar 202515 Apr 20264 Mar 2026
32tbservers.comCloudFlare, Inc.7 Apr 202614 Apr 20267 Apr 2027
33tbsexchange.comMisk.com, Inc.13 Oct 200522 Nov 202313 Oct 2023
34tbsenglish.com-21 Jul 202524 Jul 202521 Jul 2026
35tbsexy.comeName Technology Co., Ltd.5 Dec 20125 Dec 20125 Dec 2018
36tbselectronics.comeNom, Inc.21 Aug 20013 Jun 202621 Aug 2030
37tbselectronicsinc.comTucows Domains Inc.6 Feb 201210 Feb 20166 Feb 2017
38tbserv.comWild West Domains, LLC5 Nov 20146 Nov 20245 Nov 2026
39tbservera.comXiamen Nawang Technology Co., Ltd25 Jun 201525 Jun 201525 Jun 2017
40tbseeu.comeNom, Inc.6 Feb 20156 Feb 20156 Feb 2016
41tbsenterpriseinc.comGoDaddy.com, LLC7 Nov 20148 Nov 20257 Nov 2026
42tbsen.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…3 Aug 202311 Sep 20243 Aug 2024
43tbsewo.comXin Net Technology Corporation1 Feb 201820 Feb 20181 Feb 2019
44tbsellers.comMetaregistrar BV Applications23 Nov 20252 Feb 202623 Nov 2026
45tbseq.comGoDaddy.com, LLC26 Aug 201426 Aug 202426 Aug 2026
46tbseoservices.comGoDaddy.com, LLC14 Aug 201414 Aug 201414 Aug 2015
47tbsegclub.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2019
48tbsesv.comGoDaddy.com, LLC11 Sep 201412 Sep 201411 Sep 2015
49tbservices-online.com1&1 Internet AG15 Nov 201415 Nov 201415 Nov 2015
50tbservices.infoKey-Systems GmbH6 May 20226 May 20266 May 2027
51tbsevenoakspet.comGoDaddy.com, LLC19 Nov 201419 Nov 201419 Nov 2015
52tbseo2016.comHiChina Zhicheng Technology Limited21 Nov 201421 Nov 201421 Nov 2015
53tbseo2015.comHiChina Zhicheng Technology Limited21 Nov 201414 Nov 201621 Nov 2017
54tbseo2014.comHiChina Zhicheng Technology Limited21 Nov 201421 Nov 201421 Nov 2015
55tbsequity.com1API GmbH12 Dec 202012 Dec 202012 Dec 2021
56tbsese.comXiamen Nawang Technology Co., Ltd27 Sep 201427 Sep 201427 Sep 2015
57tbsey.orgFastDomain Inc.24 Sep 201424 Sep 201424 Sep 2015
58tbsecrestlaw.orgDomain.com, LLC22 Nov 201422 Nov 201422 Nov 2015
59tbsearlyed.orgGoDaddy.com, LLC16 Oct 201416 Oct 201416 Oct 2022
60tbseccurityshpping.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Nov 201425 Nov 201425 Nov 2015
61tbselectronics.netPlanetDomain Pty Ltd21 Sep 201123 Sep 201721 Sep 2018
62tbseal.comXin Net Technology Corporation11 Oct 200927 Aug 202511 Oct 2032
63tbseurope.comTurnCommerce, Inc. DBA NameBright.com25 Dec 201419 Dec 202025 Dec 2026
64tbsenterprises.comTurnCommerce, Inc. DBA NameBright.com26 Dec 20149 Mar 202526 Dec 2024
65tbseltx7.xyzNetwork Solutions, LLC18 Jul 201421 Jul 201418 Jul 2015
66tbservices.website1&1 Internet AG15 Nov 201415 Nov 201415 Nov 2015
67tbservers.net1&1 Internet AG6 Sep 20247 Sep 20256 Sep 2026
68tbseventos.comGoDaddy.com, LLC18 May 201618 May 201618 May 2017
69tbseaa.comXin Net Technology Corporation11 Jan 201511 Jan 201511 Jan 2016
70tbseo.topNamesilo, LLC17 Jun 202016 Jun 202517 Jun 2026
71tbsearch.workGMO Internet Inc.12 Jun 201512 Jun 201512 Jun 2016
72tbsedu.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…30 Mar 20258 May 202630 Mar 2026
73tbsedu.netDNSPod, Inc.21 Apr 202221 Jun 202321 Apr 2023
74tbselfproclaimed.useNom, Inc.5 Feb 20155 Feb 20154 Feb 2016
75tbsedu.orgHiChina Zhicheng Technology Limited5 Feb 2015-5 Feb 2016
76tbser.comNameCheap, Inc.29 Jul 202410 Oct 202529 Jul 2025
77tbset.comGoDaddy.com, LLC7 Sep 201721 Nov 20257 Sep 2026
78tbsentreprenad.comAscio Technologies, Inc. Danmark - Filial af Ascio…4 Mar 20155 Mar 20264 Mar 2027
79tbsecb.comeNom, Inc.8 Mar 20159 Mar 20158 Mar 2016
80tbseu.comNameCheap, Inc.31 May 201931 May 201931 May 2020
81tbservicessarl.comAscio Technologies, Inc. Danmark - Filial af Ascio…13 Mar 201513 Mar 201513 Mar 2016
82tbseo.netBeijing Lanhai Jiye Technology Co., Ltd31 May 202428 May 202631 May 2027
83tbsemporium.comTucows Domains Inc.30 Mar 20153 Apr 201930 Mar 2019
84tbseoprgsdnsgd.bizGMO Internet Inc.1 Apr 20152 Apr 201531 Mar 2016
85tbsec.comTurnCommerce, Inc. DBA NameBright.com5 Apr 201530 Mar 20215 Apr 2027
86tbseng.netNom-iq Ltd. dba COM LAUDE2 Sep 20158 Oct 20252 Sep 2026
87tbsentertainmentgroup.comDomain.com, LLC13 Apr 201524 Mar 202613 Apr 2027
88tbsez.comXin Net Technology Corporation21 Apr 201521 Apr 201521 Apr 2016
89tbsecuritysolution.comGoDaddy.com, LLC25 Apr 201525 Apr 201525 Apr 2017
90tbselektronik.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Sep 20151 Sep 20168 Sep 2017
91tbserp.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…20 Dec 202121 Nov 202520 Dec 2026
92tbsezn.comXin Net Technology Corporation4 May 20154 May 20154 May 2016
93tbsesolutions.comGoDaddy.com, LLC7 May 20157 May 20157 May 2016
94tbsex8.comGoDaddy.com, LLC27 Nov 201627 Nov 201627 Nov 2017
95tbsedian.comHiChina Zhicheng Technology Limited12 Sep 201512 Sep 201512 Sep 2016
96tbserver.netGMO Internet Inc.13 May 201517 Mar 202613 May 2027
97tbselektrik.comDropCatch.com 581 LLC30 Nov 201730 Nov 201730 Nov 2018
98tbsenterprisesinc.comTLD Registrar Solutions Ltd.21 May 201521 May 201521 May 2016
99tbsequip.comBeijing Lanhai Jiye Technology Co., Ltd22 Oct 202123 Oct 202322 Oct 2024
100tbseven.comMetaregistrar BV Applications19 Nov 202521 Jan 202619 Nov 2026
101tbse7enby.comGoDaddy.com, LLC1 Jun 20152 Jun 20151 Jun 2016
102tbse7en.comGoDaddy.com, LLC1 Jun 20152 Jun 20151 Jun 2016
103tbsetaomega.orgGoogle, Inc.15 Sep 20155 Sep 202515 Sep 2026
104tbsevent.comGoDaddy.com, LLC29 Sep 202529 Sep 202529 Sep 2026
105tbsevens.comGoDaddy.com, LLC4 Jun 20154 Jun 20154 Jun 2016
106tbservicesinc.comNameCheap, Inc.18 Sep 201718 Sep 201718 Sep 2018
107tbsex.comTurnCommerce, Inc. DBA NameBright.com3 Feb 202315 Mar 20253 Feb 2025
108tbseo1288.comGMO Internet Inc.25 Mar 202128 Mar 202125 Mar 2022
109tbsestates.comeNom, Inc.15 Jun 20156 Jun 202615 Jun 2026
110tbsezj.comBeijing Innovative Linkage Technology Ltd. dba dns…17 Jun 201420 Jun 201517 Jun 2016
111tbsetiawargi.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Jun 201527 Jun 201527 Jun 2016
112tbseporjokdkrim.comGoDaddy.com, LLC2 Jul 20152 Jul 20152 Jul 2016
113tbsexo.comTurnCommerce, Inc. DBA NameBright.com20 Sep 201831 Oct 202520 Sep 2025
114tbsesports.comGoDaddy.com, LLC23 Aug 20174 Nov 202523 Aug 2025
115tbsesat.comDomainshype.com, Inc.24 Sep 20154 Nov 201624 Sep 2018
116tbseat.comHiChina Zhicheng Technology Limited22 Oct 20199 Oct 202522 Oct 2026
117tbsev.infoGoDaddy.com, LLC9 Jul 201523 Aug 20259 Jul 2026
118tbservicespainting.comHostinger, UAB24 Dec 201817 Jan 202624 Dec 2032
119tbseo2013.comCNOBIN INFORMATION TECHNOLOGY LIMITED27 Dec 202127 Dec 202127 Dec 2022
120tbseasyfixedassets.comGoDaddy.com, LLC22 Jul 201522 Jul 201522 Jul 2017
121tbsells.com1&1 Internet AG11 Sep 202511 Sep 202511 Sep 2026
122tbsells.net1&1 Internet AG11 Sep 202511 Sep 202511 Sep 2026
123tbseblog.comNameCheap, Inc.1 Aug 201527 Apr 20241 Aug 2026
124tbsep.comGoogle, Inc.6 Oct 202122 Sep 20236 Oct 2023
125tbservicesrl.comHongkong Domain Name Information Management Co., L…26 Jan 202126 Jan 202126 Jan 2022
126tbsee.comNordreg AB13 Apr 202613 Apr 202613 Apr 2027
127tbserviapp.comLaunchpad, Inc.27 Oct 201527 Oct 201627 Oct 2017
128tbseny.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Oct 201530 Oct 201530 Oct 2016
129tbserviices.net----
130tbservicescleaning.comGoDaddy.com, LLC8 Nov 20158 Nov 20158 Nov 2017
131tbsecure.comTurnCommerce, Inc. DBA NameBright.com14 Jan 20243 Mar 202614 Jan 2027
132tbsec.loanAlpnames Limited2 Dec 2015-1 Dec 2016
133tbsetaalpha.netShanghai Meicheng Technology Information Co., Ltd16 May 201816 May 201816 May 2019
134tbserve.comGoDaddy.com, LLC25 Mar 202026 Mar 202625 Mar 2027
135tbsesslingen.com1&1 Internet AG29 Dec 201519 Apr 201729 Dec 2017
136tbsediting.comGoDaddy.com, LLC2 Jan 20162 Jan 20162 Jan 2017
137tbseer.comGoDaddy.com, LLC27 Jan 202128 Jan 202627 Jan 2027
138tbsengineering.netCloudFlare, Inc.4 Jan 201627 Jan 20264 Jan 2027
139tbsengineering.infoCloudFlare, Inc.4 Jan 201619 May 20254 Jan 2027
140tbsentertainmentworldwide.comNetwork Solutions, LLC13 Jan 201613 Jan 201613 Jan 2017
141tbsek.orgDynadot, LLC2 Apr 20267 Apr 20262 Apr 2027
142tbseo.clubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Jan 201620 Dec 201618 Jan 2018
143tbser15.comTucows Domains Inc.21 Jan 201625 Jan 202021 Jan 2020
144tbselab.comGoDaddy.com, LLC1 Feb 20161 Feb 20161 Feb 2019
145tbseewinter.comWild West Domains, LLC3 Feb 20163 Feb 20163 Feb 2017
146tbsearch.plNamware.com, Inc.5 Feb 201630 Jan 20265 Feb 2027
147tbselektronik.netPDR Ltd. d/b/a PublicDomainRegistry.com10 Mar 201610 Mar 201610 Mar 2017
148tbset.linkAlpnames Limited18 Mar 201628 Apr 201718 Mar 2017
149tbseihan.comKagoya Japan Inc.4 Apr 20163 Apr 20264 Apr 2027
150tbseminolegoodyr.comWild West Domains, LLC7 Apr 20167 Apr 20167 Apr 2017
151tbsetzim.orgNetwork Solutions, LLC24 Apr 201626 Apr 202524 Apr 2026
152tbsexpress.comGoDaddy.com, LLC25 Jan 201526 Jan 202625 Jan 2028
153tbseventsolutions.comTucows Domains Inc.27 May 201631 May 201727 May 2017
154tbservicos.com.br-11 May 199812 Dec 202511 May 2027
155tbseo.vipNameCheap, Inc.18 Feb 202517 Oct 202518 Feb 2028
156tbsengineers.comGoDaddy.com, LLC8 Jun 20164 Oct 20228 Jun 2027
157tbseresults.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Jun 201610 Jun 201610 Jun 2017
158tbser.topJiangsu Bangning Science and technology Co. Ltd.5 Jul 2016-5 Jul 2017
159tbservice56.comGoogle, Inc.2 Jan 202518 Dec 20252 Jan 2027
160tbsecbags.topAlpnames Limited7 Jul 20167 Jul 20167 Jul 2017
161tbsetpwp3017.xyzNameCheap, Inc.20 Jun 201627 Jun 201620 Jun 2017
162tbsembalagens.com.br-9 Nov 20151 Dec 20159 Nov 2016
163tbsesolutions.in-2 Jul 20133 Jul 20162 Jul 2017
164tbsemadhyamikresult2016.in-3 Sep 201515 Sep 20173 Sep 2018
165tbseen.londonGo France Domains, LLC9 Sep 201410 Sep 20159 Sep 2016
166tbservicesonline.bizGoDaddy.com, LLC27 Jun 201213 Aug 201626 Jun 2017
167tbsenterprises.bizNameCheap, Inc.11 Jan 200616 Dec 201910 Jan 2021
168tbsebaidu.comeNom, Inc.20 Jul 201631 Aug 201720 Jul 2017
169tbsebaidu.neteNom, Inc.20 Jul 201621 Jun 201720 Jul 2018
170tbsequel.orgTucows Domains Inc.18 Aug 201625 Jul 202518 Aug 2026
171tbse51.netPSI-USA, Inc. dba Domain Robot28 Apr 202128 Apr 202128 Apr 2022
172tbse51.comEranet International Limited8 Dec 202424 Nov 20258 Dec 2026
173tbserwis.comOVH sas6 Sep 20166 Sep 20166 Sep 2017
174tbservis.netTucows Domains Inc.14 Sep 201518 Sep 201814 Sep 2018
175tbseen.comGoDaddy.com, LLC8 Aug 201419 Jul 20258 Aug 2026
176tbsenerji.comregister.com, Inc.29 Jun 20111 Jul 202529 Jun 2026
177tbse2010.comGoDaddy.com, LLC3 Nov 20094 Nov 20153 Nov 2017
178tbsenviro-dri.comNom-iq Ltd. dba COM LAUDE12 Jun 200916 May 202612 Jun 2027
179tbservicesfrance.comTucows Domains Inc.1 Apr 20115 Apr 20171 Apr 2017
180tbseniorliving.comMarkMonitor Inc.8 Apr 20117 Mar 20268 Apr 2027
181tbsemi.comBizcn.com, Inc.28 Sep 20072 Sep 202528 Sep 2026
182tbsev.comGoDaddy.com, LLC18 Oct 201013 May 202618 Oct 2029
183tbsellerwebinar.comGoDaddy.com, LLC10 Apr 201311 Apr 201610 Apr 2017
184tbserver.comTurnCommerce, Inc. DBA NameBright.com20 Aug 201214 Aug 202020 Aug 2026
185tbservicereviews.comeNom, Inc.28 Jun 201430 May 201628 Jun 2017
186tbsevents.comTucows Domains Inc.25 Oct 20245 Jan 202625 Oct 2025
187tbses.comOVH sas30 Apr 20047 Mar 202630 Apr 2027
188tbsengines.comPromo People inc.22 Jul 200815 Jul 202522 Jul 2026
189tbsentertainments.comNamesilo, LLC25 Mar 201412 Feb 202625 Mar 2027
190tbsecocentre.comMesh Digital Limited20 Jul 201220 Jul 201720 Jul 2019
191tbsemail.comDomainPeople, Inc.9 Jun 20094 Jun 20269 Jun 2027
192tbsehardrock.comGoDaddy.com, LLC7 Oct 20098 Oct 20157 Oct 2017
193tbsend.comGoDaddy.com, LLC28 May 202129 May 202628 May 2027
194tbse2011.comGoDaddy.com, LLC3 Nov 20094 Nov 20153 Nov 2017
195tbseng.comeNom, Inc.9 Feb 20106 Jun 20269 Feb 2027
196tbservices.comGoDaddy.com, LLC1 Mar 200815 May 20261 Mar 2029
197tbsestore.comWild West Domains, LLC23 Nov 20114 Jan 202623 Nov 2025
198tbseniors.comPorkbun, LLC26 Mar 202626 Mar 202626 Mar 2027
199tbse2012.comGoDaddy.com, LLC3 Nov 20094 Nov 20153 Nov 2017
200tbsetazeta.comGoDaddy.com, LLC25 May 201226 May 201625 May 2017
201tbsem.comGoDaddy.com, LLC21 Oct 200616 Oct 202521 Oct 2026
202tbsecurity.comGoDaddy.com, LLC7 Aug 202230 Sep 20257 Aug 2026
203tbsentinels.comGoDaddy.com, LLC6 Jun 20116 Jun 20166 Jun 2017
204tbsea.comHefei Juming Network Technology Co., Ltd28 Feb 20132 Jun 202628 Feb 2027
205tbsevansdale.comDomainPeople, Inc.9 Jan 201211 Dec 20169 Jan 2018
206tbseguros.comGoogle, Inc.21 Apr 202621 Apr 202621 Apr 2027
207tbsegypt.comGoDaddy.com, LLC30 Jul 200831 Jul 202530 Jul 2026
208tbsengineering.comGoDaddy.com, LLC11 Jul 20002 Jun 202611 Jul 2027
209tbserviceinc.comTucows Domains Inc.14 Nov 20089 Nov 202514 Nov 2026
210tbsequipmentservice.comDomainPeople, Inc.11 Jun 201227 May 202611 Jun 2027
211tbseast.comGoDaddy.com, LLC19 Oct 201131 Dec 202419 Oct 2024
212tbsenterprise.comTLDs LLC dba SRSplus30 Nov 200323 Apr 202530 Nov 2030
213tbseo.comeName Technology Co., Ltd.19 Feb 201325 Feb 202619 Feb 2027
214tbsearch.comGoDaddy.com, LLC17 Nov 200922 Jul 202517 Nov 2026
215tbselfstorage.comGoDaddy.com, LLC21 May 201222 May 202621 May 2027
216tbseagles.comGoDaddy.com, LLC18 Jan 202218 Jan 202218 Jan 2023
217tbseducation.comGandi SAS29 May 201328 Apr 202629 May 2027
218tbsenbstore.comGoDaddy.com, LLC12 Jun 201213 Jun 202512 Jun 2026
219tbsell.comeNom, Inc.28 Jun 200214 May 202628 Jun 2026
220tbseller.comHiChina Zhicheng Technology Limited15 May 201915 May 201915 May 2020
221tbservicesonline.comDropCatch.com 1380 LLC14 Sep 201714 Sep 201714 Sep 2018
222tbseltx7.comNetwork Solutions, LLC11 Feb 20055 Mar 201711 Feb 2020
223tbsewing.comName.com, Inc.11 Mar 201417 Feb 201711 Mar 2018
224tbseiren.comGMO Internet Inc.5 Jan 201221 Dec 20255 Jan 2027
225tbselevkar.comNameCheap, Inc.18 Aug 202218 Aug 202218 Aug 2023
226tbsellshomes.comGoDaddy.com, LLC22 Jan 20105 Apr 202522 Jan 2025
227tbserviceogvinduespolering.comTucows Domains Inc.19 Jun 201330 Aug 202419 Jun 2024
228tbsenergy.comTurnCommerce, Inc. DBA NameBright.com23 Sep 201217 Sep 202023 Sep 2026
229tbselastomers.comDomaininfo AB, aka domaininfo.com27 May 200420 May 202627 May 2027
230tbsenterprisess.comGood Domain Registry Pvt Ltd.24 Apr 201425 May 201624 Apr 2017
231tbservice.comDynadot, LLC27 May 200328 May 202627 May 2027
232tbseo8.comEranet International Limited13 Feb 202511 Feb 202613 Feb 2027
233tbservice.bizTucows Domains Inc.3 Oct 20166 Oct 20182 Oct 2018
234tbsentregas.comPSI-USA, Inc. dba Domain Robot4 Oct 20166 Oct 20174 Oct 2018
235tbservicesonline.infoGoDaddy.com, LLC27 Jun 20129 Jul 201627 Jun 2017
236tbsefydcksj.infoReserved for non-billable transactions where Regis…11 Jan 201211 Jan 202011 Jan 2021
237tbseen.infoGoDaddy.com, LLC10 Jul 201416 Jun 201610 Jul 2018
238tbservicesonline.mobiGoDaddy.com, LLC27 Jun 20129 Jul 201627 Jun 2017
239tbseducation.mobiGandi SAS29 May 201312 Jul 202529 May 2025
240tbseducation.catGandi SAS30 May 201329 Apr 202630 May 2027
241tbselektrik.netPDR Ltd. d/b/a PublicDomainRegistry.com14 Oct 201625 Nov 201714 Oct 2017
242tbsexchange.netMisk.com, Inc.18 Jul 200218 Jul 202518 Jul 2026
243tbseducation.netGandi SAS29 May 201330 Mar 202629 May 2027
244tbservicesonline.netGoDaddy.com, LLC27 Jun 20129 Jul 201727 Jun 2018
245tbsenterpriseinc.netGoDaddy.com, LLC28 Jun 200929 Jun 202528 Jun 2026
246tbservice.netTucows Domains Inc.20 Jul 200830 Sep 202420 Jul 2024
247tbservicesltd.netTucows Domains Inc.28 Mar 200726 Feb 202628 Mar 2027
248tbserv.netPDR Ltd. d/b/a PublicDomainRegistry.com2 Jul 201011 Sep 20242 Jul 2026
249tbsexchange2003.netMisk.com, Inc.26 Apr 200722 Apr 201126 Apr 2017
250tbservicesfrance.netTucows Domains Inc.1 Apr 20115 Apr 20171 Apr 2017
251tbservices.netWild West Domains, LLC27 Nov 200028 Nov 202527 Nov 2026
252tbseen.netGoDaddy.com, LLC10 Jul 201416 Jun 201610 Jul 2018
253tbsef.orgeNom, Inc.28 Jun 200512 Aug 202528 Jun 2026
254tbsealsmexico.orgTucows Domains Inc.24 Jan 20035 Jan 201724 Jan 2018
255tbservicesfrance.orgTucows Domains Inc.1 Apr 20115 Apr 20171 Apr 2018
256tbsev.orgGoDaddy.com, LLC18 Oct 20102 Dec 202418 Oct 2026
257tbservicesonline.orgGoDaddy.com, LLC27 Jun 20129 Jul 201727 Jun 2018
258tbsec.orgWeb Commerce Communications Limited dba WebNic.cc18 Apr 20088 Apr 202318 Apr 2028
259tbserv.orgDomainPeople, Inc.21 Mar 201116 Mar 201721 Mar 2018
260tbsentinels.orgGoDaddy.com, LLC6 Jun 20116 Jun 20166 Jun 2017
261tbseducation.orgGandi SAS29 May 20134 Apr 202629 May 2027
262tbservice.beEuroDNS S.A.10 Aug 2011--
263tbseon.ch----
264tbsequipement.frInfomaniak Network SA25 Mar 202631 Mar 202625 Mar 2028
265tbservice.fr-17 Aug 201116 Aug 2016-
266tbsearch.fr-15 Sep 201515 Sep 2016-
267tbservice.it-4 Apr 202121 Apr 20265 Apr 2027
268tbse2017.comGoDaddy.com, LLC31 Oct 201612 Jan 202531 Oct 2024
269tbsea.loanAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…11 Nov 201621 Nov 201610 Nov 2017
270tbseodz.comHiChina Zhicheng Technology Limited11 Dec 201613 Dec 201711 Dec 2017
271tbselect.com-7 Feb 20248 Nov 20257 Feb 2027
272tbself.infoGoDaddy.com, LLC8 Jan 20178 Jan 20188 Jan 2019
273tbservices.com.au--29 Jan 2026-
274tbsegt.bizGMO Internet Inc.7 Feb 2017-6 Feb 2018
275tbseir.comTucows Domains Inc.25 May 202625 May 202625 May 2027
276tbseven.menAlpnames Limited15 Mar 201720 Mar 201715 Mar 2018
277tbsellemoto.comTucows Domains Inc.29 Mar 20172 Apr 202329 Mar 2024
278tbsenet.comGoDaddy.com, LLC14 Apr 201714 Apr 201714 Apr 2018
279tbseen.co.uk-10 Jul 201415 Sep 201710 Jul 2018
280tbsecityurqzv.winPDR Ltd. d/b/a PublicDomainRegistry.com24 Apr 201725 May 201724 Apr 2018
281tbseos.infoWest263 International Limited26 Apr 201723 Dec 201726 Apr 2018
282tbsewallet.comGoDaddy.com, LLC16 May 201716 May 201716 May 2018
283tbsepehr.com1API GmbH23 May 20175 Feb 201823 May 2019
284tbsetlz.loanAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 May 201730 May 201725 May 2018
285tbsendner.comeNom, Inc.4 Jun 20173 Jun 20174 Jun 2018
286tbseyra.bizHangzhou AiMing Network Co., LTD10 Jun 201716 Jun 20179 Jun 2018
287tbseicollege.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Jun 201718 Jan 201810 Jun 2018
288tbser.usNameCheap, Inc.27 May 201727 May 201726 May 2018
289tbsecurity.orgGoogle, Inc.1 Jun 20221 Jun 20231 Jun 2024
290tbsever.comTurnCommerce, Inc. DBA NameBright.com31 Aug 202028 May 202631 Aug 2026
291tbsensor.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…27 Jun 20178 Feb 202527 Jun 2028
292tbseng.ca-21 Oct 201423 Jun 201721 Oct 2019
293tbsengines.infoDomain.com, LLC18 Jul 201730 Sep 202318 Jul 2023
294tbsek.comNetwork Information Center Mexico, S.C.17 Jul 201712 Jul 202517 Jul 2026
295tbservices.co.ukReserved12 Feb 201611 Apr 201712 Feb 2018
296tbsegnjq.com1&1 Internet AG9 Aug 201710 Aug 20179 Aug 2018
297tbsern.infoNameCheap, Inc.10 Aug 201711 Aug 201710 Aug 2018
298tbsesdev.comAmazon Registrar, Inc.12 Aug 20178 Jul 202512 Aug 2026
299tbsemi2017.comGMO Internet Inc.6 Sep 201718 Oct 20256 Sep 2025
300tbserwis.com.pl-10 Apr 201710 Apr 201710 Apr 2018
301tbserwis.pl-20 Oct 20114 Aug 201720 Oct 2017
302tbsellsmiami.comDomain.com, LLC21 Sep 201721 Sep 201721 Sep 2018
303tbsedy.infoHiChina Zhicheng Technology Limited30 Sep 201730 Sep 201730 Sep 2018
304tbseed.comeName Technology Co., Ltd.13 Mar 201913 Mar 201913 Mar 2020
305tbsenquete.comNameCheap, Inc.1 Nov 20171 Nov 20171 Nov 2018
306tbservice.ltdNameCheap, Inc.3 Nov 20173 Nov 20173 Nov 2018
307tbsedayu.comCV. Jogjacamp3 Dec 20173 Dec 20173 Dec 2018
308tbsenterprises.netGoogle, Inc.18 Dec 201718 Dec 201718 Dec 2018
309tbsesprod.comAmazon Registrar, Inc.21 Dec 201716 Nov 202521 Dec 2026
310tbsecuritylocksmith.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…15 Jun 20179 Jul 201715 Jun 2018
311tbsecurity.co.uk-2 Oct 200817 Sep 20162 Oct 2018
312tbseurope.co.uk-16 Jan 202516 Jan 202616 Jan 2026
313tbsengineering-southern.co.uk-3 May 201126 Apr 20173 May 2018
314tbsellingnlturnerbutler.co.uk-14 Jan 201514 Jan 201714 Jan 2019
315tbselectrical.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…14 Apr 201112 Apr 201714 Apr 2019
316tbselectronics.co.ukReserved11 Sep 200216 Dec 201611 Sep 2018
317tbservicescastleford.co.uk-6 Dec 20127 Nov 20176 Dec 2018
318tbsecure.co.uk-28 Apr 200927 Apr 202628 Apr 2027
319tbsecocentre.co.uk-20 Jul 201220 Jul 201720 Jul 2026
320tbsentertainment.co.ukKey-Systems GmbH30 Jun 201517 Jun 201730 Jun 2018
321tbseewm.winWest263 International Limited9 Jan 2018-9 Jan 2019
322tbservices.org.uk-14 Apr 202514 Apr 202614 Apr 2026
323tbsemails.co.uk-19 Jan 202619 Jan 202619 Jan 2027
324tbselectrical.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…14 Jun 20157 Jun 201714 Jun 2018
325tbsetiajaya.comTucows Domains Inc.12 Jan 201816 Jan 201912 Jan 2019
326tbserver.co.ukHello Internet Corp.23 Jan 201823 Jan 201823 Jan 2020
327tbseke.loanWest263 International Limited12 Mar 2018-12 Mar 2019
328tbserviceetjardin.com1&1 Internet AG12 Mar 201812 Mar 201812 Mar 2019
329tbsefe.loanWest263 International Limited13 Mar 2018-13 Mar 2019
330tbsezv.loanALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED4 Apr 20189 Apr 20184 Apr 2019
331tbserf.loanWest263 International Limited26 Mar 201831 Mar 201826 Mar 2019
332tbsellsnc.comGoogle, Inc.12 May 201812 May 201812 May 2019
333tbsea.netMat Bao Trading & Service Company Limited d/b/a Ma…29 Aug 202230 Aug 202329 Aug 2024
334tbsecrets.com1&1 Internet AG18 Jun 201818 Jun 201818 Jun 2019
335tbsecinfo.comAmazon Registrar, Inc.21 Jun 201821 Jun 201821 Jun 2019
336tbseloeb.loanALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED24 Jun 2018-24 Jun 2019
337tbsebeats.comGoDaddy.com, LLC16 Jul 201816 Jul 201816 Jul 2020
338tbseeds.com-21 Jan 20259 Jan 202621 Jan 2027
339tbseries.comDynadot, LLC24 Aug 201824 Aug 201824 Aug 2019
340tbsewing.netNameCheap, Inc.25 Aug 201825 Aug 201825 Aug 2019
341tbsert.comIHS Telekom, Inc.7 Sep 20188 Sep 20257 Sep 2026
342tbsed.comGoDaddy.com, LLC14 Sep 201814 Sep 201814 Sep 2019
343tbservices.coGoDaddy.com, LLC20 Aug 201818 Aug 202520 Aug 2026
344tbseafood.comGoDaddy.com, LLC13 Nov 202413 Nov 202413 Nov 2027
345tbserviciosgenerales.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Nov 20189 Nov 20189 Nov 2019
346tbsex.netTucows Domains Inc.25 May 20245 Jul 202525 May 2025
347tbsequipements.comImminentdomains.net LLC27 Feb 202312 May 202427 Feb 2024
348tbseogroup.comChengdu West Dimension Digital Technology Co., Ltd…14 Dec 201814 Dec 201814 Dec 2019
349tbservices.eu----
350tbseojtxl.clubBizcn.com, Inc.26 Dec 201826 Dec 201826 Dec 2019
351tbseunlimited.comGoDaddy.com, LLC27 Dec 201827 Dec 201827 Dec 2019
352tbseajtxl.clubBizcn.com, Inc.27 Dec 201827 Dec 201827 Dec 2019
353tbseet.comFastDomain Inc.10 Oct 20201 Oct 202510 Oct 2026
354tbservicos.comeNom, Inc.30 Jan 201929 Apr 202630 Jan 2029
355tbsenergies.comTucows Domains Inc.10 Feb 201914 Feb 202010 Feb 2020
356tbserviceswithprimaryhealthsystem.topNamesilo, LLC24 Mar 201924 Mar 201924 Mar 2020
357tbsell.clubChengdu West Dimension Digital Technology Co., Ltd…1 Sep 2021-1 Sep 2022
358tbsellsland.comGoDaddy.com, LLC9 May 201920 Jul 20259 May 2025
359tbseowhy.comDropCatch.com 599 LLC6 Nov 20216 Nov 20216 Nov 2022
360tbsecuritysac.comGoDaddy.com, LLC19 Jun 201919 Jun 201919 Jun 2020
361tbsedtech.comeNom, Inc.23 Jun 20195 Aug 202023 Jun 2020
362tbselectrical.comGoDaddy.com, LLC4 Jul 20194 Jul 20194 Jul 2020
363tbseesports.comNamesilo, LLC19 Jul 201920 Jul 201919 Jul 2020
364tbsefacilities.comGoDaddy.com, LLC22 Jul 201922 Jul 201922 Jul 2020
365tbsegaming.comGoDaddy.com, LLC22 Jul 201922 Jul 201922 Jul 2020
366tbselive.comGoDaddy.com, LLC22 Jul 201922 Jul 201922 Jul 2020
367tbsecommercialsales.comGoDaddy.com, LLC22 Jul 201922 Jul 201922 Jul 2020
368tbsessions.comGandi SAS29 Jul 201929 Jul 201929 Jul 2020
369tbselevator.comGoDaddy.com, LLC30 Jul 201930 Jul 201930 Jul 2021
370tbselectric.comGoDaddy.com, LLC25 Aug 201718 Aug 202525 Aug 2026
371tbsedsites.comNom-iq Ltd. dba COM LAUDE9 Aug 201923 Dec 20259 Aug 2026
372tbsetaomega.com1&1 Internet AG28 Aug 201913 Nov 202128 Aug 2026
373tbsecpro.comGoDaddy.com, LLC17 Oct 201918 Oct 202517 Oct 2027
374tbseagartala.comGoDaddy.com, LLC22 Oct 201922 Oct 201922 Oct 2020
375tbsexpress.clubRegional Network Information Center, JSC dba RU-CE…7 Nov 20197 Nov 20197 Nov 2020
376tbsecuriteprivee.comWild West Domains, LLC2 Dec 20192 Dec 20192 Dec 2020
377tbsetac.comGoDaddy.com, LLC18 Dec 201929 Jan 202518 Dec 2024
378tbsetextmessagessettlement.comWest263 International Limited24 Dec 201924 Dec 201924 Dec 2020
379tbsetextmessagesettlement.comAmazon Registrar, Inc.23 Dec 201918 Nov 202523 Dec 2026
380tbsetextmesagesettlement.comWest263 International Limited24 Dec 201924 Dec 201924 Dec 2020
381tbseetapp.comNameCheap, Inc.19 Jan 2020-19 Jan 2021
382tbsetextmessagesetlement.comNamesilo, LLC19 Feb 202020 Feb 202019 Feb 2021
383tbsetextmessagesettelment.comNamesilo, LLC19 Feb 202020 Feb 202019 Feb 2021
384tbsetextmessagesettlment.comNamesilo, LLC19 Feb 202020 Feb 202019 Feb 2021
385tbsettextmessagesettlement.comGoDaddy.com, LLC21 Feb 202021 Feb 202021 Feb 2021
386tbse-754e-z7s.comGMO Internet Inc.5 Mar 20206 Mar 20205 Mar 2021
387tbserveu.comGoDaddy.com, LLC11 Mar 202011 Mar 202011 Mar 2021
388tbsesites.comFastDomain Inc.31 Mar 202031 Mar 202031 Mar 2022
389tbseel.comHiChina Zhicheng Technology Limited9 Apr 20209 Apr 20239 Apr 2024
390tbsengineeringuk.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Apr 20209 Apr 20209 Apr 2021
391tbseastpsgroup.comGoogle, Inc.30 Apr 202030 Apr 202030 Apr 2021
392tbservices.proGandi SAS14 Feb 201813 Feb 202014 Feb 2021
393tbsentertainment.comAmazon Registrar, Inc.15 May 202020 May 202315 May 2023
394tbselec.infoGoDaddy.com, LLC12 Apr 201924 Apr 202012 Apr 2021
395tbselectric.netDomain.com, LLC21 May 20206 May 202621 May 2027
396tbsecret.comGandi SAS23 Jun 202023 Jun 202023 Jun 2021
397tbse-learning.comNameCheap, Inc.11 Jul 2020-11 Jul 2021
398tbsect.comNameCheap, Inc.5 Aug 2020-5 Aug 2021
399tbseproperty.comHosting Concepts B.V. dba Openprovider7 Sep 202017 Dec 20257 Sep 2026
400tbsedizioni.comTucows Domains Inc.14 Sep 202018 Sep 202114 Sep 2021
401tbsenergiutama.comCV. Rumahweb Indonesia16 Sep 202027 Nov 202316 Sep 2023
402tbservices.de--12 Aug 2019-
403tbseri.clubGoDaddy.com, LLC19 Sep 202019 Sep 202019 Sep 2021
404tbsemirates.comTucows Domains Inc.6 Oct 202010 Oct 20216 Oct 2021
405tbsec.infoNameCheap, Inc.12 Oct 202012 Oct 202012 Oct 2021
406tbsegh.infoNameCheap, Inc.10 Nov 202010 Nov 202010 Nov 2021
407tbsecirity.comGoDaddy.com, LLC2 Dec 20202 Dec 20202 Dec 2021
408tbservices.siteregister.com, Inc.23 Jun 20223 Sep 202323 Jun 2023
409tbselgepp.siteAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…7 Aug 20201 Oct 20207 Aug 2021
410tbsenzgwahz.xyzGMO Internet Inc.25 Dec 2020-25 Dec 2021
411tbseak.xyzGoDaddy.com, LLC28 Dec 202028 Dec 202028 Dec 2021
412tbsewawesome.comGoDaddy.com, LLC28 Dec 202028 Dec 202028 Dec 2021
413tbsexpressllc.comGoogle, Inc.29 Dec 202014 Dec 202529 Dec 2026
414tbse6.comFastDomain Inc.30 Dec 202018 May 202330 Dec 2029
415tbsexport.comOVH sas29 Jan 202129 Jan 202129 Jan 2022
416tbsellscolorado.comGoDaddy.com, LLC8 Feb 202121 Mar 20248 Feb 2024
417tbsebastian.xyzNameCheap, Inc.19 Feb 202119 Feb 202119 Feb 2022
418tbsevrentals.comGoDaddy.com, LLC28 Feb 202111 Apr 202528 Feb 2025
419tbservicesgroup.comSquarespace Domains LLC28 Sep 202313 Sep 202528 Sep 2026
420tbseg.comName.com, Inc.19 Mar 202129 Mar 202619 Mar 2027
421tbservicesma.netGoogle, Inc.16 May 202116 May 202116 May 2022
422tbsexpo.comServer Plan Srl11 May 202611 May 202611 May 2027
423tbsedki.comGMO Internet Inc.11 May 202111 May 202111 May 2022
424tbsearth.comGoDaddy.com, LLC27 May 20215 Jun 202627 May 2027
425tbsenergi.comWeb Commerce Communications Limited dba WebNic.cc18 Jun 202113 May 202518 Jun 2026
426tbserramenti.comTucows Domains Inc.9 Jul 202113 Jul 20229 Jul 2022
427tbservice.infoGoDaddy.com, LLC5 Aug 20215 Aug 20215 Aug 2022
428tbseniorclub.krInames Co. Ltd.29 Mar 202129 Mar 202129 Mar 2022
429tbsexpressinc.comGoogle, Inc.22 Aug 202111 Nov 202522 Aug 2026
430tbse01.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…24 Sep 2021-24 Sep 2022
431tbsexcavating.comGoogle, Inc.26 Sep 202126 Sep 202126 Sep 2022
432tbsens.comNameCheap, Inc.3 Oct 2021-3 Oct 2022
433tbseeto.storeGoDaddy.com, LLC6 Oct 20216 Oct 20216 Oct 2022
434tbservice.onlineeNom, Inc.9 Oct 2021-9 Oct 2022
435tbsemaro.xyzGMO Internet Inc.29 Oct 202113 May 202229 Oct 2022
436tbsengineering.onlineCrazy Domains FZ-LLC2 Nov 20212 Nov 20212 Nov 2022
437tbsenerji.netHostinger, UAB5 Nov 20215 Nov 20215 Nov 2022
438tbsells.topPorkbun, LLC16 Nov 20217 Dec 202216 Nov 2023
439tbsexpress.netFastDomain Inc.16 Nov 202116 Nov 202116 Nov 2022
440tbsexpresslogistics.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Nov 202110 Feb 202429 Nov 2023
441tbservice.srlAscio Technologies, Inc. Danmark - Filial af Ascio…7 Dec 20217 Dec 20217 Dec 2022
442tbseshcu.comGoDaddy.com, LLC23 Dec 202123 Dec 202123 Dec 2022
443tbsevaa.storeGoDaddy.com, LLC28 Dec 202129 Dec 202128 Dec 2022
444tbservicesfinanciers.comTucows Domains Inc.30 Dec 202110 Dec 202530 Dec 2026
445tbserdbau.comGoogle, Inc.23 Jan 202223 Jan 202223 Jan 2023
446tbserve.netALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED5 Feb 202214 Mar 20245 Feb 2024
447tbservetest.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED9 Feb 202219 Mar 20259 Feb 2025
448tbservetestapi.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED9 Feb 20229 Feb 20229 Feb 2023
449tbserveit.netInfomaniak Network SA18 Feb 202222 Nov 202318 Feb 2024
450tbsecal.infoNamesilo, LLC21 Feb 202221 Feb 202221 Feb 2023
451tbsetalulum.comFastDomain Inc.21 Feb 202224 Apr 202321 Feb 2024
452tbservers.ca-11 Jan 202212 Jan 202611 Jan 2028
453tbse1vzvg9.techAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…12 Mar 202220 Apr 202312 Mar 2023
454tbsell.xyzDynadot, LLC23 Mar 202224 Mar 202323 Mar 2024
455tbsecuritysolutions.comTucows Domains Inc.22 Mar 20222 May 202622 Mar 2026
456tbservices.fr-15 Dec 201931 Jan 202615 Dec 2026
457tbserwisczeladz.comGoogle, Inc.31 Mar 202216 Mar 202631 Mar 2027
458tbseniorsolutions.comHostinger, UAB26 May 202130 May 202426 May 2028
459tbsefm.seoul.krInames Co. Ltd.19 Nov 200817 Aug 202219 Nov 2025
460tbservicioslogisticos.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Apr 20227 Apr 20236 Apr 2024
461tbserv.techPDR Ltd. d/b/a PublicDomainRegistry.com28 Apr 20224 Jul 202328 Apr 2023
462tbserv.onlinePDR Ltd. d/b/a PublicDomainRegistry.com4 May 202210 Jun 20234 May 2023
463tbselectrics.comGoDaddy.com, LLC4 Jun 202216 Aug 20234 Jun 2023
464tbsevolutionadvancedhresure.comCloudFlare, Inc.13 May 202422 Jun 202513 May 2025
465tbsetts.com1&1 Internet AG14 Jun 202227 Aug 202414 Jun 2024
466tbservice.co.kr-11 Aug 201711 Aug 201711 Aug 2022
467tbse365office.spaceeNom, Inc.21 Jun 20222 Sep 202321 Jun 2023
468tbse365office.siteeNom, Inc.21 Jun 20222 Sep 202321 Jun 2023
469tbse365office.onlineeNom, Inc.21 Jun 20222 Sep 202321 Jun 2023
470tbsecurepay.comHosting Concepts B.V. dba Openprovider22 Jul 20221 Aug 202422 Jul 2024
471tbsection.comNameCheap, Inc.13 Nov 202313 Nov 202313 Nov 2024
472tbsexpressrepairandrental.comGoDaddy.com, LLC15 Aug 202216 Aug 202515 Aug 2026
473tbsengineeringllc.comGoDaddy.com, LLC16 Aug 202228 Oct 202316 Aug 2023
474tbservico.comGoogle, Inc.22 Aug 202223 Aug 202322 Aug 2024
475tbseriesnmovies.comGoDaddy.com, LLC2 Sep 20222 Sep 20222 Sep 2023
476tbselectronics.storeTucows Domains Inc.9 Sep 202213 Sep 20239 Sep 2024
477tbservicestx.comGoogle, Inc.8 Sep 20229 Sep 20238 Sep 2024
478tbsevents.co.uk-1 Sep 202211 Jul 20251 Sep 2026
479tbsecurityco.comGoogle, Inc.23 Sep 20224 Nov 202523 Sep 2025
480tbselectric.orgNameCheap, Inc.27 Sep 20228 Dec 202327 Sep 2023
481tbsea.co.uk-7 Jul 202217 Jul 20247 Jul 2024
482tbseven.co.uk-5 Oct 20225 Oct 20225 Oct 2023
483tbsend5.comGoDaddy.com, LLC20 Oct 202221 Oct 202520 Oct 2026
484tbsend1.comGoDaddy.com, LLC20 Oct 202221 Oct 202520 Oct 2026
485tbsend3.comGoDaddy.com, LLC20 Oct 202221 Oct 202520 Oct 2026
486tbsend4.comGoDaddy.com, LLC20 Oct 202221 Oct 202520 Oct 2026
487tbsend6.comGoDaddy.com, LLC20 Oct 202221 Oct 202520 Oct 2026
488tbsend2.comGoDaddy.com, LLC20 Oct 202221 Oct 202520 Oct 2026
489tbseye.topNamesilo, LLC24 Oct 202224 Oct 202224 Oct 2023
490tbseoul.comGabia, Inc.4 Nov 202213 Dec 20244 Nov 2024
491tbseo3.comDropCatch.com 981 LLC8 Apr 202419 Jun 20258 Apr 2025
492tbseasoning.comGoDaddy.com, LLC6 Nov 20227 Nov 20246 Nov 2026
493tbseason.comTucows Domains Inc.9 Nov 202220 Jan 20249 Nov 2023
494tbsengineering.co.uk-4 Feb 20042 Jun 20264 Feb 2027
495tbsettlement.comDynadot, LLC12 Apr 202513 Apr 202612 Apr 2027
496tbservices.bizGoogle, Inc.28 Nov 20223 Dec 202228 Nov 2023
497tbseducationfr.comGoogle, Inc.5 Dec 20226 Dec 20235 Dec 2024
498tbseducationfile.comGoogle, Inc.11 Dec 202212 Dec 202311 Dec 2024
499tbseats.comNameCheap, Inc.15 Dec 202226 Feb 202415 Dec 2023
500tbservicesdubai.comGoDaddy.com, LLC20 Dec 20222 Mar 202420 Dec 2023
501tbsedu.xyzHosting Concepts B.V. dba Openprovider1 Jan 202312 Mar 20241 Jan 2024
502tbservs.comGoDaddy.com, LLC14 Jan 202315 Jan 202514 Jan 2027
503tbsenergies.beOVH sas4 Mar 2021--
504tbsecserv.com1&1 Internet AG17 Jan 202317 Jan 202317 Jan 2027
505tbsec.be-3 Mar 2016--
506tbservicios.cl-17 Nov 2017-17 Nov 2027
507tbserv.clickPDR Ltd. d/b/a PublicDomainRegistry.com8 May 202218 Jul 20238 May 2023
508tbsetac.orgGoDaddy.com, LLC8 Feb 202321 Mar 20248 Feb 2024
509tbse-hk.comGuangdong JinWanBang Technology Investment Co., Lt…18 Apr 201326 Mar 202518 Apr 2032
510tbsenergysolutions.comGoDaddy.com, LLC31 Jul 201713 Apr 202631 Jul 2029
511tbsey.clickGMO Internet Inc.24 Feb 20235 Apr 202424 Feb 2024
512tbservices.onlineSynergy Wholesale Pty Ltd30 Jun 20255 Jul 202530 Jun 2026
513tbseguros.cl-23 Jun 2022-23 Jun 2026
514tbsellsaz.comGoDaddy.com, LLC25 Feb 202325 Feb 202325 Feb 2028
515tbservicesllc.comGoDaddy.com, LLC20 Jun 202420 Jun 202420 Jun 2027
516tbsec.autosNameKing.com Inc.2 Mar 202316 May 20242 Mar 2024
517tbservssh1.xyzHostinger, UAB4 Mar 202310 Apr 20244 Mar 2024
518tbsempurna.comGoogle, Inc.12 Mar 202312 May 202412 Mar 2024
519tbservis.comWix.com Ltd.22 Feb 20203 May 202422 Feb 2024
520tbservicesltd.co.uk-16 Mar 202317 Mar 202616 Mar 2029
521tbse7encollection.comFastDomain Inc.20 Mar 20232 May 202420 Mar 2024
522tbseverywhere.comGoDaddy.com, LLC9 Apr 202110 Apr 20269 Apr 2027
523tbselected.comHiChina Zhicheng Technology Limited21 May 202122 May 202521 May 2027
524tbsewcialclub.comSquarespace Domains LLC6 Jun 20216 Aug 20246 Jun 2024
525tbsecondlife.comGoDaddy.com, LLC28 Aug 20219 Oct 202428 Aug 2024
526tbsevs.comDropCatch.com 1407 LLC16 Nov 202517 Nov 202516 Nov 2026
527tbsecurity.onlineSynergy Wholesale Pty Ltd2 Apr 202313 May 20242 Apr 2024
528tbsembalagens.comTucows Domains Inc.1 Jul 20245 Jul 20251 Jul 2026
529tbseditorialservices.comGoDaddy.com, LLC19 Oct 202131 Dec 202319 Oct 2023
530tbseditorials.comGoDaddy.com, LLC2 Dec 20213 Dec 20252 Dec 2027
531tbseo1.comGoDaddy.com, LLC20 Jan 20221 Feb 202420 Jan 2025
532tbseo2.comGoDaddy.com, LLC20 Jan 20221 Feb 202420 Jan 2025
533tbservedev.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED5 Feb 202215 Apr 20255 Feb 2025
534tbsegar.clickNameCheap, Inc.9 Apr 202321 May 20249 Apr 2024
535tbserveapi.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…7 Feb 20229 Apr 20257 Feb 2027
536tbservices.llcName.com, Inc.6 Mar 202025 Apr 20256 Mar 2027
537tbsegar02.clickNameCheap, Inc.12 Apr 202327 Apr 202412 Apr 2025
538tbservice.orgNamesilo, LLC13 Apr 202313 Apr 202413 Apr 2025
539tbsembroidery.comFastDomain Inc.8 Aug 202320 Sep 20248 Aug 2024
540tbserc.comNameCheap, Inc.14 Apr 202326 May 202414 Apr 2024
541tbservice.oneOne.com A/S14 Apr 202320 Mar 202614 Apr 2027
542tbsek.onlineGoogle, Inc.15 Apr 202328 May 202515 Apr 2025
543tbsegar3.clickNameCheap, Inc.19 Apr 202330 Jun 202419 Apr 2024
544tbself.funPDR Ltd. d/b/a PublicDomainRegistry.com19 Apr 202320 Apr 202419 Apr 2025
545tbseat.nl-6 Jul 20153 Apr 2026-
546tbsehw.cfdGMO Internet Inc.24 Apr 20234 Jun 202424 Apr 2024
547tbselectronics.nl-28 Apr 200313 Sep 2022-
548tbsegar4.clickNameCheap, Inc.25 Apr 20236 Jun 202425 Apr 2024
549tbservicecallpro.comGoDaddy.com, LLC25 Apr 202326 Apr 202625 Apr 2027
550tbsec.onlinePDR Ltd. d/b/a PublicDomainRegistry.com9 Jul 202020 Sep 20259 Jul 2025
551tbsei.orgNameCheap, Inc.6 May 20205 May 20266 May 2027
552tbservices.orgGoogle, Inc.28 Jun 202018 Jul 202528 Jun 2026
553tbsegar5.clickNameCheap, Inc.30 Apr 202311 Jun 202430 Apr 2024
554tbserviceplus.pl-30 Aug 202530 Aug 202530 Aug 2026
555tbselectronics.bioNameCheap, Inc.4 May 202315 Jul 20244 May 2024
556tbseng.co.uk-5 Aug 19972 Jun 20265 Aug 2026
557tbsenay.comAutomattic Inc.4 May 20232 Jun 20254 May 2025
558tbsegar6.clickNameCheap, Inc.6 May 202317 Jun 20246 May 2024
559tbsegar7.clickNameCheap, Inc.7 May 202318 Jul 20247 May 2024
560tbsegar8.clickNameCheap, Inc.8 May 202319 Jul 20248 May 2024
561tbseo.co.uk-5 Apr 20225 Apr 20265 Apr 2026
562tbsegar9.clickNameCheap, Inc.10 May 202321 Jul 202410 May 2024
563tbsegar11.clickNameCheap, Inc.14 May 202325 Jul 202414 May 2024
564tbsegar10.clickNameCheap, Inc.12 May 202323 Jul 202412 May 2024
565tbsegar12.clickNameCheap, Inc.15 May 202326 Jul 202415 May 2024
566tbsegar13.clickNameCheap, Inc.16 May 202327 Jul 202416 May 2024
567tbsegar14.clickNameCheap, Inc.17 May 202328 Jul 202417 May 2024
568tbsegar15.clickNameCheap, Inc.18 May 202329 Jul 202418 May 2024
569tbsegar18.clickNameCheap, Inc.22 May 20233 Jul 202422 May 2024
570tbsegar16.clickNameCheap, Inc.19 May 202330 Jun 202419 May 2024
571tbsegar17.clickNameCheap, Inc.20 May 202331 Jul 202420 May 2024
572tbsegar20.clickNameCheap, Inc.23 May 20234 Jul 202423 May 2024
573tbsegar19.clickNameCheap, Inc.22 May 20233 Jul 202422 May 2024
574tbsegar21.clickNameCheap, Inc.24 May 20234 Aug 202424 May 2024
575tbsearchalt.comCloudFlare, Inc.5 Jun 202315 Jul 20245 Jun 2024
576tbservicetech.co.uk-23 Mar 202222 Mar 202623 Mar 2027
577tbsengine.comKey-Systems GmbH8 Jun 202322 Aug 20248 Jun 2024
578tbseacactyyc.comGoDaddy.com, LLC10 Jun 202321 Aug 202410 Jun 2024
579tbset.bizNameCheap, Inc.30 Jun 202315 Jul 202530 Jun 2025
580tbselectric.co.uk-5 Jun 20184 Jun 20265 Jun 2027
581tbserver.siteAtak Domain Hosting Internet d/b/a Atak Teknoloji28 May 202529 May 202628 May 2027
582tbservices-divers.comHosting Concepts B.V. dba Openprovider25 Jul 20233 Sep 202425 Jul 2024
583tbservicesrl.blogeNom, Inc.26 Jul 20237 Sep 202426 Jul 2024
584tbservicesrl.storeeNom, Inc.26 Jul 20237 Sep 202426 Jul 2024
585tbseindia.comDomainshype.com, Inc.28 Jul 202315 Jul 202528 Jul 2026
586tbse888.comXin Net Technology Corporation1 Aug 202325 Jul 20251 Aug 2026
587tbsecurity.it-5 Aug 202021 Aug 20255 Aug 2026
588tbservicestn.comCosmotown, Inc.6 Aug 20237 Aug 20246 Aug 2025
589tbsegy.comGoDaddy.com, LLC4 Sep 202316 Oct 20254 Sep 2025
590tbsealtd.co.uk-13 Sep 20233 Oct 202413 Sep 2026
591tbsender.comeNom, Inc.14 Sep 202327 Oct 202414 Sep 2024
592tbservice.com.br-18 Mar 201620 Jan 202318 Mar 2028
593tbsessentialgoods.comTucows Domains Inc.22 Sep 202326 Sep 202422 Sep 2025
594tbsend.cloudGMO Internet Inc.4 Oct 202315 Dec 20244 Oct 2024
595tbseven8nine.comGoDaddy.com, LLC3 Oct 20233 Oct 20233 Oct 2026
596tbservices.appGoDaddy.com, LLC10 Oct 202321 Nov 202510 Oct 2025
597tbseo1688.comWeb Commerce Communications Limited dba WebNic.cc12 Nov 202312 Nov 202312 Nov 2024
598tbsetupmid.onlineGoDaddy.com, LLC15 Nov 202327 Nov 202415 Nov 2025
599tbseo168.comGoDaddy.com, LLC15 Nov 202327 Jan 202515 Nov 2024
600tbservers.gamesGoogle, Inc.26 Nov 20237 Jan 202626 Nov 2025
601tbseew.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Dec 20238 Feb 20252 Dec 2024
602tbsessence.comGoDaddy.com, LLC28 Dec 202310 Mar 202528 Dec 2024
603tbseiko.co.jp-15 Sep 20231 Oct 2025-
604tbsexim.comGMO Internet Inc.12 Jan 202420 Mar 202512 Jan 2025
605tbsequencing.orgNetwork Solutions, LLC16 Jan 202413 May 202516 Jan 2035
606tbsequencing.comNetwork Solutions, LLC16 Jan 202413 May 202516 Jan 2035
607tbsequencing.netNetwork Solutions, LLC16 Jan 202413 May 202516 Jan 2035
608tbseniorwellness.orgGoDaddy.com, LLC21 Jan 20244 Mar 202521 Jan 2025
609tbserum.comDNSPod, Inc.26 Jan 202412 Jan 202626 Jan 2027
610tbsewu.cyouWest263 International Limited30 Jan 20242 Mar 202530 Jan 2025
611tbservices.cloudNameCheap, Inc.4 Feb 202421 Mar 20264 Feb 2027
612tbsedukasi.comHostinger, UAB2 Feb 202417 Mar 20252 Feb 2025
613tbsedb.comLigne Web Services SARL2 Feb 20242 Feb 20242 Feb 2027
614tbsenergysolutions.com.au--15 Sep 2024-
615tbsecure.topBeijing Lanhai Jiye Technology Co., Ltd20 Feb 202323 Apr 202620 Feb 2028
616tbsecurity.netCloudFlare, Inc.26 Feb 20242 Jan 202526 Feb 2025
617tbseqatar.comWebfusion Ltd.6 Mar 20248 Mar 20246 Mar 2029
618tbsecurity.shopGoDaddy.com, LLC20 Mar 20244 Apr 202520 Mar 2026
619tbsealcoating.comGoogle, Inc.28 Mar 202413 Mar 202628 Mar 2027
620tbsexm.funGandi SAS31 Mar 202415 May 202531 Mar 2025
621tbsecurity-services.comGMO Internet Inc.9 Apr 202421 May 20259 Apr 2025
622tbsedu-fr.comCloud Yuqu LLC9 Apr 202423 May 20259 Apr 2025
623tbserial.onlineNameCheap, Inc.11 Apr 202422 Jun 202511 Apr 2025
624tbsent.comGoDaddy.com, LLC15 Apr 202427 May 202515 Apr 2025
625tbsevice.comDreamHost, LLC15 Apr 202427 Jun 202515 Apr 2025
626tbseb.shop-26 Nov 202325 Apr 202426 Nov 2024
627tbseducacional.com.br-7 Jan 201326 Mar 20267 Jan 2027
628tbserv.co.uk-17 Sep 201814 Aug 202517 Sep 2026
629tbservice.nlOne.com A/S27 Nov 20087 Nov 2024-
630tbservicesrl.it-10 Sep 202510 Sep 202510 Sep 2026
631tbsecure.ru-21 Dec 2015-21 Dec 2026
632tbsecurepmc.ru-12 May 2023-12 May 2027
633tbserv.ru-17 Mar 2023-17 Mar 2027
634tbservice.ru-10 Jun 2014-10 Jun 2026
635tbservices.ru-8 May 2024-8 May 2025
636tbserivces.comGoDaddy.com, LLC2 May 20242 May 20242 May 2027
637tbselab.se-25 Nov 201911 Nov 202525 Nov 2026
638tbselection.se-20 Sep 201818 Sep 202520 Sep 2026
639tbselev.se-12 Nov 200822 Nov 202512 Nov 2025
640tbsentreprenad.se-30 Mar 201525 Mar 202630 Mar 2027
641tbserviceab.se-24 Aug 202323 Aug 202524 Aug 2026
642tbservicemora.se-15 Nov 20231 Oct 202515 Nov 2026
643tbseurope.euGoDaddy.com, LLC---
644tbsevent.dk-3 Jan 2024-2 Jan 2027
645tbseventssalonsuites.comGoogle, Inc.7 May 202423 Apr 20267 May 2027
646tbsetabeta.orgSquarespace Domains LLC30 May 202430 May 202630 May 2027
647tbservice24.comRegistryGate GmbH13 Jun 202419 Apr 202613 Jun 2026
648tbservicellc.comGoDaddy.com, LLC21 Jun 202426 Jun 202521 Jun 2026
649tbservices.pt----
650tbserver.online1&1 Internet AG30 Jun 202422 Sep 202530 Jun 2026
651tbsengineering.de--15 May 2018-
652tbsetaca.comGoDaddy.com, LLC16 Jul 202428 Jul 202516 Jul 2026
653tbsec.netHostinger, UAB16 Jul 202428 Aug 202516 Jul 2025
654tbsearch.xyzNameCheap, Inc.22 Jul 20242 Sep 202522 Jul 2025
655tbsecure.com.cn-30 May 2024-30 May 2027
656tbselec.com.au--5 Feb 2026-
657tbsecure.netAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…27 Aug 202428 Aug 202527 Aug 2025
658tbseqatar.orgGoDaddy.com, LLC29 Aug 202413 Oct 202529 Aug 2026
659tbsea.org.uk-1 Oct 20241 Oct 20251 Oct 2026
660tbseeding.comiNET CORPORATION5 Oct 20245 Oct 20245 Oct 2025
661tbseo.fr-19 Jun 202317 Jul 202519 Jun 2025
662tbseguro.comNetwork Solutions, LLC14 Oct 202429 Sep 202514 Oct 2026
663tbselearning.comNamesilo, LLC28 Oct 202422 Oct 202528 Oct 2026
664tbserver.cloudGoDaddy.com, LLC10 Nov 202422 Dec 202510 Nov 2025
665tbserver.spaceName.com, Inc.10 Nov 202424 Dec 202510 Nov 2025
666tbserviceexpert.se-13 Nov 202423 Nov 202513 Nov 2025
667tbsequencing.infoNetwork Solutions, LLC13 May 202513 May 202515 Nov 2034
668tbsestateplanningservices.comNetwork Solutions, LLC23 Nov 202423 Nov 202423 Nov 2026
669tbsemeqqmaww.comURL Solutions, Inc.30 Dec 202415 Jan 202630 Dec 2026
670tbsentosabangunan.comNameCheap, Inc.1 Jan 20254 Dec 20251 Jan 2027
671tbseducationgoodies.comTucows Domains Inc.2 Jan 202520 Dec 20252 Jan 2027
672tbseleccion.comOVH sas15 Jan 202515 Jan 202515 Jan 2027
673tbservise56.comGoogle, Inc.19 Jan 20254 Jan 202619 Jan 2027
674tbsellshomestx.comGoDaddy.com, LLC6 Feb 202520 Mar 20266 Feb 2026
675tbseek.comNamesilo, LLC21 May 202621 May 202621 May 2027
676tbsensing.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 Feb 202517 Feb 202517 Feb 2030
677tbseguranca.com.br-24 Jan 20259 Feb 202624 Jan 2026
678tbse2025.comTucows Domains Inc.9 Mar 202519 Apr 20269 Mar 2026
679tbsengineering.website1&1 Internet AG14 Mar 202526 Apr 202614 Mar 2026
680tbsecurity.ru-27 Mar 2025-27 Mar 2026
681tbseducation.inHostinger, UAB21 Dec 202426 Dec 202421 Dec 2025
682tbseoq.xyzName.com, Inc.16 Apr 202517 Apr 202616 Apr 2027
683tbsense.comNameCheap, Inc.16 Apr 202528 May 202616 Apr 2026
684tbservice.topNamesilo, LLC30 May 202430 May 202530 May 2026
685tbservices.usGoDaddy.com, LLC1 May 202513 May 20261 May 2026
686tbseo.xyzChengdu West Dimension Digital Technology Co., Ltd…14 May 202515 May 202614 May 2027
687tbservices.ovhOVH sas26 May 20256 May 202626 May 2027
688tbservicesbelgium.be-30 May 2025--
689tbsetn.siteHostinger, UAB30 May 202531 May 202630 May 2027
690tbsetiaabadi.spaceCV. Rumahweb Indonesia15 Jun 202523 Jun 202515 Jun 2026
691tbsetiaabadi.siteCV. Rumahweb Indonesia15 Jun 202523 Jun 202515 Jun 2026
692tbsetiaabadi.comWeb Commerce Communications Limited dba WebNic.cc15 Jun 202515 Aug 202515 Jun 2026
693tbsecure.infoDynadot, LLC23 Jun 202528 Jun 202523 Jun 2026
694tbsecure.onlineGoDaddy.com, LLC24 Jun 202519 Mar 202624 Jun 2026
695tbseastside.comGoDaddy.com, LLC24 Jun 202524 Jun 202524 Jun 2026
696tbseztn1674.vipDynadot, LLC8 Jul 202513 Jul 20258 Jul 2026
697tbsed.onlineGoDaddy.com, LLC28 Jul 202519 Mar 202628 Jul 2026
698tbsex9h.shop-15 Aug 202515 Aug 2025-
699tbsells.online1&1 Internet AG11 Sep 202520 Oct 202511 Sep 2026
700tbsells.store1&1 Internet AG11 Sep 202520 Oct 202511 Sep 2026
701tbseal.cn????????????11 Sep 2025-11 Sep 2026
702tbsexpresswaterproofing.netGoDaddy.com, LLC23 Sep 202529 Sep 202523 Sep 2026
703tbsesm.infoNameCheap, Inc.3 Oct 2025--
704tbsempire.comGoDaddy.com, LLC7 Oct 202515 Dec 20257 Oct 2026
705tbseindhoven.comCronon AG10 Oct 202529 Nov 202510 Oct 2026
706tbservicewinterswijk.nl-20 Aug 202117 Jan 2026-
707tbsenercom.com-5 Nov 20255 Nov 20255 Nov 2026
708tbsentry.proOVH sas7 Nov 202510 Nov 20257 Nov 2026
709tbsealer.comGoDaddy.com, LLC9 Nov 20259 Nov 20259 Nov 2026
710tbseschool.comHostinger, UAB19 Nov 202519 Nov 202519 Nov 2026
711tbseqvi.bondGMO Internet Inc.21 Nov 202526 Nov 202521 Nov 2026
712tbsenshc.icu-23 Nov 202528 Nov 202523 Nov 2026
713tbsenergi.co.idReserved21 Jun 202128 Nov 202521 Jun 2026
714tbseo.ccHefei Juming Network Technology Co., Ltd24 Nov 20251 Jun 202624 Nov 2026
715tbseducation.info1&1 Internet AG6 Dec 202510 Feb 20266 Dec 2026
716tbsea.cn????????????14 Dec 2025-14 Dec 2026
717tbservizio.pro-22 Dec 202522 Dec 2025-
718tbsentrepreneurlab.comHosting Concepts B.V. dba Openprovider29 Dec 202529 Dec 202529 Dec 2026
719tbsellskc.comPorkbun, LLC7 Jan 20267 Jan 20267 Jan 2036
720tbseajgp7t6mts-8du.comTucows Domains Inc.25 Jan 202625 Jan 202625 Jan 2027
721tbservices2u.comWix.com Ltd.29 Jan 202612 Feb 202629 Jan 2031
722tbseventservices.comName.com, Inc.21 Feb 202624 Apr 202621 Feb 2027
723tbsek.vipDynadot, LLC2 Mar 20267 Mar 20262 Mar 2027
724tbsell.shopBeijing Lanhai Jiye Technology Co., Ltd11 Mar 2026-11 Mar 2027
725tbsend.lat-13 Mar 202618 Mar 202613 Mar 2027
726tbsejahtera.comRealtime Register B.V.2 Apr 20262 Apr 20262 Apr 2027
727tbse773.comNamesilo, LLC6 Apr 20266 Apr 20266 Apr 2027
728tbsedfhsazk.shopGoDaddy.com, LLC16 Apr 202616 Apr 202616 Apr 2027
729tbservis.ru-15 Apr 2026-15 Apr 2027
730tbsestate.comHosting Concepts B.V. dba Openprovider17 Apr 202617 Apr 202617 Apr 2027
731tbse75mq.lolGMO Internet Inc.21 Apr 202621 Apr 202621 Apr 2027
732tbsesports.com.br-29 May 202311 Jun 202529 May 2026
733tbsec.camBeijing Lanhai Jiye Technology Co., Ltd28 Apr 202628 Apr 202628 Apr 2027
734tbseen.orgGoDaddy.com, LLC29 Apr 202629 Apr 202629 Apr 2027
735tbsec.cn-21 Apr 2026-21 Apr 2027
736tbseptic.comWix.com Ltd.5 May 20265 May 20265 May 2029
737tbsei.com-13 May 202613 May 202613 May 2027
738tbservicegroup.comCloudFlare, Inc.13 May 202613 May 202613 May 2027
739tbseo.com.cn-19 Aug 2024-19 Aug 2026
740tbsedu.usGoDaddy.com, LLC28 Jul 20242 Aug 202428 Jul 2029
741tbsexis.xyzPDR Ltd. d/b/a PublicDomainRegistry.com11 Jun 202611 Jun 202611 Jun 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=tbse

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now