Our database now contains whois records of 676 Million (676,152,083) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [676 Million Domains] $10,000 Details

Keyword: TAPCL

Reverse Whois » KEYWORD [tapcl ]  { 890 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1tapcl.mobiGMO Internet Inc.21 Oct 201421 Oct 201421 Oct 2015
2tapcl.xyzGransy s.r.o. d/b/a subreg.cz1 Jun 201619 Sep 20161 Jun 2017
3tapcl.comGoDaddy.com, LLC6 Sep 201220 Dec 20256 Sep 2026
4tapclicks.comGoDaddy.com, LLC8 Jun 20119 Jun 20248 Jun 2026
5tapclub.comTucows Domains Inc.13 Oct 200013 Oct 202513 Oct 2027
6tapclix.comGoDaddy.com, LLC15 Aug 201130 Sep 202515 Aug 2026
7tapclicksave.comeNom, Inc.17 Sep 201417 Sep 201417 Sep 2015
8tapclic.comNameCheap, Inc.19 Jan 202218 Jan 202419 Jan 2025
9tapclicksrelay.comGoDaddy.com, LLC3 Oct 20143 Mar 20253 Oct 2026
10tapcloudsucks.comFastDomain Inc.2 Oct 20142 Oct 20172 Oct 2018
11tapcleaners.comGoDaddy.com, LLC29 Nov 201430 Nov 202529 Nov 2026
12tapclickpay.comNameCheap, Inc.28 Jun 202528 Jun 202528 Jun 2026
13tapcloudblog.comFastDomain Inc.20 Jan 201520 Jan 201720 Jan 2018
14tapcleaningservices.comCloudFlare, Inc.31 May 20257 Jun 202531 May 2026
15tapclans.comTurnCommerce, Inc. DBA NameBright.com24 Apr 201718 Apr 202124 Apr 2026
16tapclans.neteNom, Inc.4 Feb 20154 Feb 20154 Feb 2017
17tapclans.orgeNom, Inc.4 Feb 20154 Feb 20154 Feb 2017
18tapcleaning.comGoDaddy.com, LLC20 Jan 20171 Oct 202220 Jan 2027
19tapclash.comTurnCommerce, Inc. DBA NameBright.com16 Feb 201511 Nov 202516 Feb 2026
20tapclash.netGabia, Inc.29 Jan 202025 Jan 202629 Jan 2027
21tapclash.usNameCheap, Inc.26 Apr 201726 Apr 201725 Apr 2018
22tapclash.orgName.com, Inc.1 Sep 20256 Sep 20251 Sep 2026
23tapclash.mobiGoDaddy.com, LLC24 Feb 201524 Feb 201524 Feb 2016
24tapclash.infoGoDaddy.com, LLC24 Feb 2015-24 Feb 2016
25tapclicktap.comGoDaddy.com, LLC4 Mar 20155 Mar 20264 Mar 2027
26tapclick.clickNameCheap, Inc.21 May 202526 May 202521 May 2026
27tapclick.bizRegtime Ltd.25 Mar 201512 Feb 202624 Mar 2027
28tapcleanherpes.winAlpnames Limited28 Aug 201528 Aug 201527 Aug 2016
29tapclashmail.comKey-Systems GmbH16 Apr 201516 Apr 201516 Apr 2016
30tapclash-mail.comKey-Systems GmbH16 Apr 201516 Apr 201516 Apr 2016
31tapclickread.orgGandi SAS16 Apr 201518 Mar 202516 Apr 2026
32tapclashmail.orgKey-Systems GmbH16 Apr 201516 Apr 201516 Apr 2016
33tapclashmail.netKey-Systems GmbH16 Apr 201516 Apr 201516 Apr 2016
34tapclash-mail.orgKey-Systems GmbH16 Apr 201516 Apr 201516 Apr 2016
35tapclash-mail.netKey-Systems GmbH16 Apr 201516 Apr 201516 Apr 2016
36tapclickread.comGandi SAS1 Jul 201527 May 20251 Jul 2026
37tapclips.netGoDaddy.com, LLC2 May 20153 May 20252 May 2026
38tapclips.comGoDaddy.com, LLC8 May 20159 May 20258 May 2026
39tapclicker.comMAFF Inc.10 Aug 202219 Oct 202310 Aug 2023
40tapclient.comGoDaddy.com, LLC12 Aug 202216 Jan 202612 Aug 2027
41tapclothing.comGoDaddy.com, LLC31 Jan 202019 Dec 202531 Jan 2027
42tapclv.orgNameCheap, Inc.31 Jan 201820 Dec 202531 Jan 2027
43tapclickweb.com1&1 Internet AG17 Oct 201518 Oct 201617 Oct 2017
44tapclickgames.com1&1 Internet AG17 Oct 201527 Mar 201817 Oct 2026
45tapclickapps.com1&1 Internet AG17 Oct 201518 Oct 201617 Oct 2017
46tapclk.comNameCheap, Inc.25 Feb 202310 Feb 202625 Feb 2027
47tapclioks.comGoDaddy.com, LLC9 Jan 20169 Jan 20169 Jan 2017
48tapcloset.comTucows Domains Inc.8 Jan 201412 Jan 20168 Jan 2017
49tapclothingco.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Jan 201615 Jan 201615 Jan 2017
50tapclicks.mobiGoDaddy.com, LLC25 Feb 201626 Feb 201725 Feb 2018
51tapclickfix.com1&1 Internet AG2 Mar 201612 Mar 20172 Mar 2018
52tapclap.comGoDaddy.com, LLC5 Mar 20169 Feb 20235 Mar 2028
53tapclashglobal.orgGoDaddy.com, LLC28 Mar 201628 Mar 201628 Mar 2017
54tapclashglobal.infoGoDaddy.com, LLC28 Mar 201628 Mar 201628 Mar 2017
55tapclicks.chatGoDaddy.com, LLC28 Mar 201612 May 202528 Mar 2026
56tapclashglobal.netGoDaddy.com, LLC28 Mar 201628 Mar 201628 Mar 2017
57tapclashglobal.comGoDaddy.com, LLC28 Mar 201628 Mar 201628 Mar 2017
58tapclashglobal.us-28 Mar 201628 Mar 201627 Mar 2017
59tapclickshop.comGoogle, Inc.12 Apr 201628 Mar 202512 Apr 2026
60tapclique.comRealtime Register B.V.14 Apr 20228 Apr 202514 Apr 2026
61tapclone.com-4 Jun 201627 Feb 20264 Jun 2027
62tapclickwin.comGoDaddy.com, LLC6 Jun 201618 Jul 20246 Jun 2024
63tapclean.com.mxasf25 Nov 200510 Jan 201624 Nov 2016
64tapclix.bizGoDaddy.com, LLC22 Aug 201124 Oct 202521 Aug 2026
65tapclean.bizGandi SAS21 Jan 201315 Aug 201720 Jan 2018
66tapclicks.bizGoDaddy.com, LLC22 Aug 201124 Oct 202521 Aug 2026
67tapclgroup.orgGoDaddy.com, LLC20 Jul 201631 Aug 201720 Jul 2018
68tapclickandimagine.comeNom, Inc.23 Jul 201623 Jul 201623 Jul 2018
69tapclub.netGoogle, Inc.10 Jun 202326 May 202510 Jun 2026
70tapclever.comGoDaddy.com, LLC13 Sep 202113 Sep 202113 Sep 2022
71tapclouds.infoGoDaddy.com, LLC13 Sep 201625 Oct 201713 Sep 2018
72tapclit.usNameCheap, Inc.15 Sep 201615 Sep 201614 Sep 2017
73tapcliq.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Dec 201119 Nov 202516 Dec 2026
74tapclients.comGoDaddy.com, LLC17 Nov 201117 Nov 202517 Nov 2026
75tapclob.comWebfusion Ltd.25 Jan 201326 Jan 202625 Jan 2027
76tapclinic.comGoDaddy.com, LLC18 May 202313 Apr 202518 May 2026
77tapcloudresearch.comGoDaddy.com, LLC6 May 201324 Apr 20146 May 2019
78tapclickssitebuilder.comGoDaddy.com, LLC3 Jul 201319 Jun 20153 Jul 2017
79tapclickmedia.comNameCheap, Inc.21 Aug 201322 Jul 202521 Aug 2026
80tapclickspages.comGoDaddy.com, LLC3 Jul 201319 Jun 20153 Jul 2017
81tapclickfood.comGoDaddy.com, LLC21 Sep 201114 Sep 201521 Sep 2016
82tapcleanwater.comeNom, Inc.23 Oct 20235 Dec 202423 Oct 2024
83tapclassifieds.comGoDaddy.com, LLC16 Aug 201217 Aug 202416 Aug 2026
84tapcleaner.comGoDaddy.com, LLC16 Jul 200926 Jun 202516 Jul 2026
85tapclear.comGoDaddy.com, LLC19 Aug 20101 Oct 202519 Aug 2026
86tapcloudreports.comGoDaddy.com, LLC6 May 201324 Apr 20146 May 2019
87tapcloudhealth.comFastDomain Inc.29 Oct 201212 Jan 202429 Oct 2023
88tapclean.comPorkbun, LLC11 Sep 201912 Sep 202511 Sep 2026
89tapclickswebsites.comGoDaddy.com, LLC3 Jul 201319 Jun 20153 Jul 2017
90tapclan.comWild West Domains, LLC23 Apr 200927 Oct 202523 Apr 2026
91tapclassifiedsauto.comGoDaddy.com, LLC25 Nov 201326 Nov 202525 Nov 2026
92tapcleanersllc.comMAFF Inc.21 Mar 201821 Mar 201821 Mar 2019
93tapclicklearn.comGoDaddy.com, LLC6 Jun 20186 Jun 20186 Jun 2019
94tapclickpress.comDomain.com, LLC7 Nov 201210 Nov 20177 Nov 2017
95tapclicklabs.comregister.com, Inc.2 Aug 20123 Jul 20252 Aug 2026
96tapclinicaltrials.comCSC Corporate Domains, Inc.9 May 20015 May 20259 May 2026
97tapclip.comGoDaddy.com, LLC28 Nov 20221 Dec 202528 Nov 2026
98tapcloudanalytics.comGoDaddy.com, LLC6 May 201324 Apr 20146 May 2019
99tapclima.comCronon AG23 Jan 201314 Mar 202523 Jan 2027
100tapclay.comNameCheap, Inc.15 Dec 201115 Nov 202515 Dec 2026
101tapcloud.comGoDaddy.com, LLC11 May 200822 Apr 202511 May 2026
102tapclose.comGoDaddy.com, LLC3 May 201324 Feb 20263 May 2026
103tapclickgo.comFastDomain Inc.15 Jan 201413 Jan 202615 Jan 2027
104tapclassifiedauto.comGoDaddy.com, LLC25 Nov 201326 Nov 202525 Nov 2026
105tapclasses.comDot Holding Inc.22 Dec 200728 Aug 202422 Dec 2026
106tapclues.comDropCatch.com 1255 LLC21 Jul 202422 Jul 202421 Jul 2026
107tapclicktech.comGoDaddy.com, LLC24 Jun 201424 Jun 202524 Jun 2026
108tapcloudventures.comGoDaddy.com, LLC6 May 201324 Apr 20146 May 2019
109tapclick.comGoDaddy.com, LLC28 Jun 200721 Jul 202528 Jun 2026
110tapclock.comGoDaddy.com, LLC28 Jun 202123 Jun 202528 Jun 2026
111tapclickplay.comregister.com, Inc.2 Aug 20123 Jul 20252 Aug 2026
112tapclass.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Nov 200424 Oct 202525 Nov 2026
113tapclicksanalytics.comGoDaddy.com, LLC25 Sep 201226 Sep 202525 Sep 2026
114tapclout.comGoDaddy.com, LLC19 Feb 201419 Feb 201419 Feb 2017
115tapclassified.comGoDaddy.com, LLC3 Dec 20124 Dec 20253 Dec 2026
116tapclassifiedsauto.net1&1 Internet AG4 Oct 201617 Dec 20254 Oct 2025
117tapclover.comAmazon Registrar, Inc.5 Oct 201631 Aug 20255 Oct 2026
118tapclouds.comAnnulet LLC9 Oct 20169 Oct 20259 Oct 2026
119tapclix.infoGoDaddy.com, LLC22 Aug 20116 Oct 202522 Aug 2026
120tapcloud.infoGoDaddy.com, LLC30 May 201314 Jul 202530 May 2026
121tapclean.infoGandi SAS21 Jan 20131 Nov 201721 Jan 2018
122tapclicks.infoGoDaddy.com, LLC22 Aug 20116 Oct 202522 Aug 2026
123tapclix.mobiGoDaddy.com, LLC22 Aug 20116 Oct 202522 Aug 2026
124tapcloud.netGoDaddy.com, LLC1 Dec 20202 Dec 20251 Dec 2026
125tapclob.netWebfusion Ltd.25 Jan 201326 Jan 202625 Jan 2027
126tapclix.netGoDaddy.com, LLC22 Aug 201123 Aug 202522 Aug 2026
127tapclear.netGoDaddy.com, LLC19 Aug 201020 Aug 201619 Aug 2017
128tapclick.neteNom, Inc.21 May 201222 Apr 201721 May 2018
129tapclean.netGandi SAS21 Jan 201322 Nov 201721 Jan 2018
130tapcliq.netPDR Ltd. d/b/a PublicDomainRegistry.com3 Nov 20124 Nov 20243 Nov 2025
131tapclicks.netGoDaddy.com, LLC22 Aug 201123 Aug 202522 Aug 2026
132tapclan.netWild West Domains, LLC2 Dec 20123 Dec 20252 Dec 2026
133tapclass.orgGoDaddy.com, LLC4 Dec 202110 Nov 20254 Dec 2026
134tapclear.orgGoDaddy.com, LLC19 Aug 201020 Aug 201719 Aug 2018
135tapcliq.orgPDR Ltd. d/b/a PublicDomainRegistry.com3 Nov 201215 Dec 20243 Nov 2024
136tapcloud.orgNameCheap, Inc.24 May 201429 Apr 202524 May 2026
137tapclix.orgGoDaddy.com, LLC22 Aug 20116 Oct 202522 Aug 2026
138tapclean.orgKey-Systems GmbH21 Jan 201321 Mar 201621 Jan 2017
139tapclicks.orgGoDaddy.com, LLC22 Aug 20116 Oct 202522 Aug 2026
140tapcloud.xyzGMO Internet Inc.28 Aug 20253 Sep 202528 Aug 2026
141tapclicks.coGoDaddy.com, LLC22 Aug 201122 Jul 201721 Aug 2019
142tapcloth.siteNameCheap, Inc.28 Oct 201628 Oct 201628 Oct 2017
143tapcloth.techNameCheap, Inc.28 Oct 201628 Oct 201628 Oct 2017
144tapcloth.spaceNameCheap, Inc.28 Oct 20163 Dec 201728 Oct 2017
145tapcloth.winNameCheap, Inc.28 Oct 201628 Oct 201727 Oct 2017
146tapcloth.usNameCheap, Inc.28 Oct 201628 Oct 201727 Oct 2017
147tapclickmagic.comAmazon Registrar, Inc.4 Nov 201630 Sep 20254 Nov 2026
148tapclub.cat10dencehispahard, S.L.11 Nov 201611 Dec 201711 Nov 2017
149tapclutch.comDropCatch.com 1011 LLC25 Jun 202426 Jun 202425 Jun 2026
150tapclickbuy.comGoDaddy.com, LLC8 Dec 20169 Dec 20258 Dec 2026
151tapclickformore.comeNom, Inc.12 Dec 201615 Dec 201712 Dec 2017
152tapcloudy.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…12 Jan 201712 Jan 201712 Jan 2018
153tapclicksold.comGoogle, Inc.12 Jan 201712 Jan 201812 Jan 2019
154tapclefts.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…12 Jan 201712 Jan 201712 Jan 2018
155tapclient.xyzHostinger, UAB15 Jan 201729 Jul 201715 Jan 2019
156tapcln.onlineAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…18 Jan 20172 Mar 201718 Jan 2018
157tapclickmarketing.comGoDaddy.com, LLC20 Jan 201720 Jan 201720 Jan 2019
158tapclaim.comGoDaddy.com, LLC19 Jun 202519 Jun 202519 Jun 2026
159tapcleanrooms.comGoDaddy.com, LLC5 Feb 20176 Feb 20245 Feb 2027
160tapclam.comTucows Domains Inc.31 May 201931 May 201931 May 2020
161tapclaim.netInterweb Advertising D.B.A. Profile Builder4 Mar 20174 Mar 20174 Mar 2018
162tapclain.comGoDaddy.com, LLC15 Feb 201715 Feb 201715 Feb 2018
163tapcliam.comKey-Systems GmbH20 Apr 201720 Apr 201720 Apr 2018
164tapclame.comGoDaddy.com, LLC20 Feb 201720 Feb 201720 Feb 2018
165tapclaum.comKey-Systems GmbH12 May 201712 May 201712 May 2018
166tapclicktowinforlife.comNameCheap, Inc.27 Feb 201727 Feb 201727 Feb 2018
167tapcloudwebsites.comGoogle, Inc.1 Mar 201716 Aug 20171 Mar 2019
168tapclim.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Mar 20178 Mar 20178 Mar 2018
169tapclaime.comGoDaddy.com, LLC8 Mar 20178 Mar 20178 Mar 2018
170tapclsim.comGoDaddy.com, LLC21 Apr 201721 Apr 201721 Apr 2018
171tapclicksteam.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
172tapcla.comGoDaddy.com, LLC27 Mar 201727 Mar 201727 Mar 2018
173tapclaims.comSquarespace Domains LLC27 Aug 202516 Feb 202627 Aug 2027
174tapclai.comGoDaddy.com, LLC29 Mar 201729 Mar 201729 Mar 2018
175tapclik.comGoDaddy.com, LLC7 Jan 20227 Jan 20227 Jan 2023
176tapclakm.comGoDaddy.com, LLC4 Apr 20174 Apr 20174 Apr 2018
177tapcleanerwaterfromhome.infoGoDaddy.com, LLC6 Apr 20175 Jun 20176 Apr 2018
178tapclail.comGoDaddy.com, LLC7 Apr 20177 Apr 20177 Apr 2018
179tapclqim.comGoDaddy.com, LLC10 Apr 201710 Apr 201710 Apr 2018
180tapcliclks.comTucows Domains Inc.13 Apr 201713 Apr 201713 Apr 2018
181tapclaom.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Apr 201714 Jun 201714 Apr 2018
182tapclub.meParagon Internet Group Ltd t/a Paragon Names1 Nov 20153 Dec 20171 Nov 2018
183tapclicks.reportGandi SAS30 Apr 201714 Jun 202530 Apr 2025
184tapclaimed.comGoDaddy.com, LLC9 May 20179 May 20179 May 2018
185tapclami.comGoDaddy.com, LLC10 May 201710 May 201710 May 2018
186tapclicks045.onlineNameCheap, Inc.17 May 201717 May 201717 May 2018
187tapclickpush.comNameCheap, Inc.25 Aug 2021-25 Aug 2022
188tapcloudtest.comGoogle, Inc.19 Jun 201711 Oct 201719 Jun 2018
189tapcloud.bizGoDaddy.com, LLC22 Jun 201724 Oct 202521 Jun 2026
190tapclick.orgTucows Domains Inc.10 Aug 201710 Aug 201710 Aug 2018
191tapclt.orgGoDaddy.com, LLC25 Aug 201725 Aug 201725 Aug 2018
192tapclickcommerce.comGabia, Inc.16 May 202117 May 202116 May 2022
193tapclashgame.comNamecatch Zone LLC19 Mar 202119 Mar 202119 Mar 2022
194tapcllicks.comGoDaddy.com, LLC21 Nov 202521 Nov 202521 Nov 2026
195tapcliciks.comTucows Domains Inc.27 Oct 201731 Oct 201827 Oct 2018
196tapclicksstuff.comNameCheap, Inc.13 Nov 201713 Nov 201713 Nov 2018
197tapclick.infoNameCheap, Inc.29 Nov 201729 Nov 201729 Nov 2018
198tapclick24.comNameCheap, Inc.4 Dec 20174 Dec 20174 Dec 2018
199tapclickwin.co.uk-6 Sep 20176 Sep 20176 Sep 2018
200tapclickgo.co.uk-24 Feb 201625 Jan 201724 Feb 2018
201tapclt.infoGoDaddy.com, LLC6 Jan 201820 Feb 20266 Jan 2027
202tapclever.co.ukGandi SAS7 Sep 201623 Aug 20177 Sep 2018
203tapclick.co.uk-14 Jul 202213 Aug 202414 Jul 2026
204tapclob.uk-23 Jun 201424 Jun 202523 Jun 2026
205tapclob.co.uk-25 Jan 201326 Jan 202525 Jan 2026
206tapclt.bizGoDaddy.com, LLC6 Jan 201812 Jan 20266 Jan 2027
207tapcleaningpdx.comNameCheap, Inc.24 Apr 201824 Apr 201824 Apr 2019
208tapcleanerspdx.comNameCheap, Inc.24 Apr 201824 Apr 201824 Apr 2019
209tapclarity.comGoDaddy.com, LLC5 Sep 202017 Oct 20245 Sep 2024
210tapclearance.onlineNameCheap, Inc.19 Jun 201819 Jun 201819 Jun 2019
211tapclgrl.loanALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED25 Jun 2018-25 Jun 2019
212tapclaupse.comNameCheap, Inc.9 Jul 20189 Jul 20189 Jul 2019
213tapcloudbee.comGMO Internet Inc.16 Jul 201823 May 202416 Jul 2033
214tapcliff.comLaunchpad, Inc.1 Aug 20181 Aug 20181 Aug 2019
215tapclicktalk.comGoDaddy.com, LLC22 Aug 201823 Aug 202422 Aug 2026
216tapclaimit.comNameCheap, Inc.13 Oct 201813 Oct 201813 Oct 2019
217tapclimb.comCSL Computer Service Langenbach GmbH d/b/a joker.c…20 Oct 201820 Oct 201820 Oct 2019
218tapclicks.servicesGoDaddy.com, LLC12 Nov 201812 Nov 201812 Nov 2019
219tapclicktocall.comNameCheap, Inc.10 Feb 201910 Feb 201910 Feb 2020
220tapclickenhance.comNameCheap, Inc.22 Feb 201922 Feb 201922 Feb 2020
221tapclimbing.comGoDaddy.com, LLC23 Feb 201924 Feb 202623 Feb 2027
222tapclk946.comNameCheap, Inc.11 Mar 201911 Mar 201911 Mar 2020
223tapclk306.comNameCheap, Inc.11 Mar 201911 Mar 201911 Mar 2020
224tapclk181.comNameCheap, Inc.11 Mar 201911 Mar 201911 Mar 2020
225tapclink.comDreamHost, LLC13 Mar 201913 Mar 201913 Mar 2020
226tapclickswipe.comGoDaddy.com, LLC6 Apr 20247 Apr 20256 Apr 2026
227tapcloth.comNameCheap, Inc.1 May 202313 Jul 20241 May 2024
228tapclassbrewing.comGoDaddy.com, LLC7 Jun 20197 Jun 20197 Jun 2020
229tapclk18.comGoDaddy.com, LLC1 Oct 20201 Oct 20201 Oct 2021
230tapcloudcomputing.comKey-Systems GmbH17 Jun 201917 Jun 201917 Jun 2020
231tapcloudcomputing.netPSI-USA, Inc. dba Domain Robot17 Jun 20191 Jun 202217 Jun 2022
232tapclickhomeloan.comGoogle, Inc.21 Jul 20191 Sep 202521 Jul 2025
233tapclickhomeloan.netGoogle, Inc.21 Jul 20191 Sep 202521 Jul 2025
234tapclickhomes.netGoogle, Inc.20 Jul 201931 Aug 202520 Jul 2025
235tapclickhome.netGoogle, Inc.20 Jul 201920 Jul 201920 Jul 2020
236tapclickhome.comRegister.it SPA30 Sep 202120 Sep 202530 Sep 2026
237tapclickrealestate.comGoogle, Inc.20 Jul 201931 Aug 202520 Jul 2025
238tapclickloanhome.comGoogle, Inc.21 Jul 20191 Sep 202521 Jul 2025
239tapclickloanhome.netGoogle, Inc.21 Jul 20191 Sep 202521 Jul 2025
240tapclickre.comGoogle, Inc.20 Jul 201920 Jul 201920 Jul 2020
241tapclickhomes.comDropCatch.com 981 LLC7 Oct 20258 Oct 20257 Oct 2026
242tapclickloan.netGoogle, Inc.21 Jul 20191 Sep 202521 Jul 2025
243tapclickloan.comGoogle, Inc.21 Jul 20191 Sep 202521 Jul 2025
244tapclubmt.comGoDaddy.com, LLC24 Jul 20196 Sep 202524 Jul 2026
245tapclubpub.comGoDaddy.com, LLC24 Jul 20198 Aug 202524 Jul 2026
246tapclubbrew.comGoDaddy.com, LLC24 Jul 20198 Aug 202524 Jul 2026
247tapclickhomeloans.netGoogle, Inc.1 Aug 201931 Aug 20241 Aug 2024
248tapclickhomeloans.comGoogle, Inc.1 Aug 201931 Aug 20241 Aug 2024
249tapclickfindhomes.comGoogle, Inc.26 Aug 201926 Aug 201926 Aug 2020
250tapclickfindhomes.netGoogle, Inc.26 Aug 201926 Aug 201926 Aug 2020
251tapclickfit.comGoDaddy.com, LLC16 Sep 201916 Sep 201916 Sep 2020
252tapclubs.netNameCheap, Inc.15 Oct 2019-15 Oct 2020
253tapclatter.comFastDomain Inc.2 Dec 20192 Dec 20192 Dec 2020
254tapcleaningsis.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jan 202023 Jan 202023 Jan 2021
255tapclicko.comNameCheap, Inc.7 Apr 20257 Apr 20257 Apr 2026
256tapclassic.comGoDaddy.com, LLC25 Mar 20204 Nov 202525 Mar 2026
257tapclickpost.comGoDaddy.com, LLC4 May 20204 May 20204 May 2021
258tapclickship.comTucows Domains Inc.3 Jun 20203 Jun 20203 Jun 2021
259tapclin.storeHosting Ukraine LLC12 Aug 202012 Aug 202012 Aug 2021
260tapcloud.spaceGoDaddy.com, LLC4 Aug 201729 Oct 20194 Aug 2021
261tapclouds.netNamesilo, LLC5 Oct 20206 Oct 20205 Oct 2021
262tapclogistics.comP.A. Viet Nam Company Limited5 Jan 20222 Jan 20255 Jan 2026
263tapclicksnap.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
264tapclickdigital.comGoDaddy.com, LLC4 Apr 20235 Apr 20254 Apr 2026
265tapclicklabs.siteregister.com, Inc.12 Dec 202012 Dec 202012 Dec 2021
266tapclick1.com1API GmbH11 Dec 202024 Jan 202511 Dec 2024
267tapclothes.comHiChina Zhicheng Technology Limited14 Dec 202014 Dec 202014 Dec 2021
268tapclicreview.comTucows Domains Inc.8 Jan 202112 Jan 20258 Jan 2026
269tapclickreview.comTucows Domains Inc.10 Jan 202110 Jan 202610 Jan 2027
270tapclubfitness.comFastDomain Inc.25 Feb 20217 Apr 202425 Feb 2024
271tapclickgo.xyzNameCheap, Inc.2 Oct 202313 Dec 20242 Oct 2024
272tapclasseslive.comDomain.com, LLC20 Mar 20213 Jun 202420 Mar 2024
273tapclickmore.comGabia, Inc.10 May 202111 May 202110 May 2022
274tapclickcom.comGabia, Inc.16 May 202117 May 202116 May 2022
275tapcling.siteWeb Commerce Communications Limited dba WebNic.cc17 May 202117 May 202117 May 2022
276tapclickdeal.comGabia, Inc.12 May 202112 May 202111 May 2022
277tapclickmall.comGabia, Inc.12 May 202112 May 202111 May 2022
278tapclever.onlineAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 May 202119 May 202119 May 2022
279tapcling.onlineWeb Commerce Communications Limited dba WebNic.cc13 Jun 202113 Jun 202113 Jun 2022
280tapclknow.comGoDaddy.com, LLC12 Jul 202112 Jul 202112 Jul 2022
281tapclubs.comNameCheap, Inc.20 Jul 2021-20 Jul 2022
282tapclick.onlineLimited Liability Company "Registrar of domain nam…13 Sep 202113 Sep 202113 Sep 2022
283tapclickinfo.comNameCheap, Inc.12 Nov 202123 Jan 202612 Nov 2025
284tapclassonline.comGoDaddy.com, LLC23 Nov 20215 Dec 202423 Nov 2025
285tapclickgo.netNameCheap, Inc.28 Jan 2022-28 Jan 2023
286tapcleaningoregon.comNameCheap, Inc.5 Feb 20225 Feb 20265 Feb 2027
287tapcleaningcalifornia.comNameCheap, Inc.5 Feb 20224 Feb 20255 Feb 2026
288tapcleaningla.comNameCheap, Inc.5 Feb 20224 Feb 20255 Feb 2026
289tapcleaningportland.comNameCheap, Inc.5 Feb 20225 Feb 20265 Feb 2027
290tapcleaningusa.comNameCheap, Inc.5 Feb 2022-5 Feb 2023
291tapclickvalue.comeNom, Inc.12 Feb 202227 Mar 202512 Feb 2025
292tapclicks-sembear.netGMO Internet Inc.11 Mar 202212 Mar 202611 Mar 2026
293tapclik.xyzGMO Internet Inc.28 Jun 20248 Aug 202528 Jun 2025
294tapclapgame.comNameCheap, Inc.7 Apr 202219 May 20237 Apr 2023
295tapclinical.comNameCheap, Inc.11 Apr 202212 Mar 202511 Apr 2026
296tapclapgameforsport.comNameCheap, Inc.27 Apr 202228 Apr 202327 Apr 2024
297tapclics.comeName Technology Co., Ltd.3 May 202214 Jun 20233 May 2023
298tapclinicnc.comGoDaddy.com, LLC2 Mar 20183 Mar 20262 Mar 2027
299tapclick.spaceHosting Ukraine LLC7 Jun 202212 Jun 20227 Jun 2024
300tapclickbook.comNameCheap, Inc.24 Jul 20225 Oct 202324 Jul 2023
301tapcloudsite.comDynadot, LLC27 Jan 202627 Jan 202627 Jan 2027
302tapcleaner.in-22 Apr 202117 Apr 202522 Apr 2026
303tapclickapp.comNameCheap, Inc.10 Oct 202221 Dec 202310 Oct 2023
304tapclone.co.inGoDaddy.com, LLC26 Feb 202130 May 202526 Feb 2027
305tapclub.app1API GmbH13 Oct 202226 Dec 202413 Oct 2024
306tapclub.uk-13 Oct 202212 Oct 202313 Oct 2024
307tapclub.co.uk-13 Oct 202212 Oct 202313 Oct 2024
308tapcljwater.comNameCheap, Inc.1 Nov 202214 Dec 20231 Nov 2023
309tapclothe.comGandi SAS6 Nov 202216 Dec 20236 Nov 2023
310tapclickrefresh.comNameCheap, Inc.18 Nov 202230 Dec 202318 Nov 2023
311tapclk.infoNamesilo, LLC1 Dec 20222 Dec 20231 Dec 2024
312tapclone.onlineHostinger, UAB6 Jan 202313 Mar 20246 Jan 2024
313tapclicks.appGoDaddy.com, LLC8 May 201810 Oct 20258 May 2026
314tapclean.be-1 Feb 2019--
315tapclap.appGoogle, Inc.7 Aug 202010 Oct 20257 Aug 2026
316tapcleaningandries.beOne.com A/S27 Feb 2016--
317tapclips.appGoDaddy.com, LLC30 Jan 202331 Jan 202630 Jan 2027
318tapclick.siteNameCheap, Inc.2 Jun 202414 Jul 20252 Jun 2025
319tapclothes.storeGoDaddy.com, LLC5 Feb 20256 Feb 20265 Feb 2027
320tapclick.uk-15 Feb 202316 Jan 202615 Feb 2027
321tapclicks.xyzCV. Jogjacamp3 Mar 20236 May 20243 Mar 2024
322tapclt.comGoDaddy.com, LLC6 Jan 20186 Jan 20266 Jan 2027
323tapclickme.comWebfusion Ltd.14 Apr 202026 Apr 202414 Apr 2025
324tapcleansg.comWix.com Ltd.28 Apr 20208 Jul 202428 Apr 2024
325tapclassifieds.infoNameCheap, Inc.24 Mar 20235 May 202424 Mar 2024
326tapclassifieds.xyzNameCheap, Inc.24 Mar 20235 May 202424 Mar 2024
327tapclassifieds.orgNameCheap, Inc.24 Mar 20235 May 202424 Mar 2024
328tapclassifieds.techNameCheap, Inc.24 Mar 20235 May 202424 Mar 2024
329tapclassifieds.netNameCheap, Inc.24 Mar 202325 Mar 202424 Mar 2025
330tapcluster.comRealtime Register B.V.6 Oct 20217 Oct 20256 Oct 2026
331tapclap.gamesGoDaddy.com, LLC5 Nov 202115 Oct 20245 Nov 2026
332tapclone.inGoDaddy.com, LLC2 Aug 201916 Sep 20252 Aug 2026
333tapclicks.ioGandi SAS30 Apr 201714 Jul 202530 Apr 2025
334tapclasses.liveDomain.com, LLC20 Mar 20213 May 202420 Mar 2024
335tapclt.netGoDaddy.com, LLC6 Jan 20186 Jan 20266 Jan 2027
336tapclean.nl-9 Nov 200622 Dec 2021-
337tapclicks.nl-8 May 201311 Jul 2025-
338tapclap.xyzGoogle, Inc.7 May 20237 Jul 20247 May 2024
339tapcleann.shopNameCheap, Inc.1 Nov 202227 Mar 20231 Nov 2023
340tapclickreview.co.uk-10 Jan 202110 Jan 202610 Jan 2027
341tapclick.funBeget LLC18 May 202328 Jun 202418 May 2024
342tapclick.topHostinger, UAB25 May 202531 Aug 202525 May 2026
343tapclub.coGoDaddy.com, LLC29 May 202310 Jul 202429 May 2024
344tapclicks.uk-26 Nov 201927 Nov 202526 Nov 2026
345tapclock.co.uk-8 Aug 20213 Aug 20248 Aug 2025
346tapclub.orgGoogle, Inc.10 Jun 202318 Jul 202510 Jun 2026
347tapclicks.clickHostinger, UAB26 Jul 20235 Sep 202426 Jul 2024
348tapcloudreceive.topNamesilo, LLC21 Aug 202324 Sep 202421 Aug 2024
349tapcloudfiles.topNamesilo, LLC21 Aug 202324 Aug 202321 Aug 2025
350tapcloudtech.comNameCheap, Inc.6 Sep 20237 Sep 20256 Sep 2026
351tapcleanservice.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Sep 202326 Aug 202511 Sep 2026
352tapclick.xyzNameCheap, Inc.12 Dec 20231 Dec 202512 Dec 2026
353tapclipmovie.comTucows Domains Inc.19 Dec 20231 Mar 202519 Dec 2024
354tapclone.orgHostinger, UAB8 Jan 202421 Feb 20258 Jan 2025
355tapclickreviews.comGoDaddy.com, LLC26 Jan 20241 Feb 202626 Jan 2027
356tapclicks-group.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
357tapclickshub.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
358tapclicks-agency.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
359tapclicks-data.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
360tapclicks-digital.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
361tapclicks-growth.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
362tapclicks-hub.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
363tapclicks-marketing.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
364tapclicks-platform.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
365tapclicks-reporting.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
366tapclicks-software.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
367tapclicks-success.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
368tapclicks-web.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
369tapclicksagency.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
370tapclicksdata.comPorkbun, LLC25 Sep 202525 Sep 202525 Sep 2026
371tapclicksdigital.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
372tapclicksgroup.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
373tapclicksgrowth.comPorkbun, LLC25 Sep 202525 Sep 202525 Sep 2026
374tapclicksmarketing.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
375tapclicksplatform.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
376tapclicksreporting.comPorkbun, LLC25 Sep 202525 Sep 202525 Sep 2026
377tapclickssoftware.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
378tapclicksuccess.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
379tapclicksweb.comGoDaddy.com, LLC27 Mar 20248 Jun 202527 Mar 2025
380tapclickme.co.uk-14 Apr 202019 Dec 202314 Apr 2024
381tapclicksell.comEpik Inc.14 Apr 20241 Apr 202514 Apr 2026
382tapclub.xyzGMO Internet Inc.23 Jul 20254 Aug 202523 Jul 2026
383tapclicksnet.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
384tapclicks-info.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
385tapclicks-net.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
386tapclicks-pro.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
387tapclicks-tech.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
388tapclicksco.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
389tapclicksconnect.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
390tapclicksglobal.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
391tapclicksinfo.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
392tapclicksmedia.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
393tapclicksportal.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
394tapclickspro.comPorkbun, LLC25 Sep 202525 Sep 202525 Sep 2026
395tapclickstech.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
396tapclicksus.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
397tapcloud.cn????????????29 Mar 2024-29 Mar 2026
398tapcltd.co.uk-7 Feb 201931 Jan 20267 Feb 2027
399tapclap.ru-20 Jul 2017-20 Jul 2026
400tapclean.ru-18 Sep 2024-18 Sep 2025
401tapclick.ru-7 Feb 2019-7 Feb 2027
402tapclient.ru-25 Dec 2023-25 Dec 2025
403tapclients.ru-25 Dec 2023-25 Dec 2025
404tapcloud.worldNamesilo, LLC4 Jun 20244 Jun 20254 Jun 2026
405tapclicksdigitals.comPorkbun, LLC6 Jun 202419 Jul 20256 Jun 2025
406tapclicksapp.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
407tapclicksbiz.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
408tapclicksbrand.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
409tapclickscloud.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
410tapclicksconsulting.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
411tapclicks360.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
412tapclickscenter.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
413tapclickscentral.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
414tapclicksconsultants.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
415tapclickscorp.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
416tapclickscreative.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
417tapclicksdirect.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
418tapclicksexpert.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
419tapclicksexperts.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
420tapclicksfirm.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
421tapclickshq.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
422tapclicksinc.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
423tapclickslabs.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
424tapclickslink.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
425tapclicksnetwork.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
426tapclicksnetworks.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
427tapclicksnow.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
428tapclicksone.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
429tapclickspartner.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
430tapclickspartners.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
431tapclickspoint.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
432tapclickspros.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
433tapclicksvisions.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
434tapclickschannel.comPorkbun, LLC6 Jun 202417 Jun 20256 Jun 2026
435tapclicksedge.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
436tapclickslab.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
437tapclicksservice.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
438tapclicksservices.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
439tapclickssite.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
440tapclickssolutions.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
441tapclickssystems.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
442tapclicksteams.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
443tapclickstools.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
444tapclicksvision.comPorkbun, LLC25 Sep 202525 Sep 202525 Sep 2026
445tapclicksworld.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
446tapclickszone.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
447tapclicksstudio.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
448tapclickswork.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
449tapclicksworks.comPorkbun, LLC6 Jun 20247 Jun 20256 Jun 2026
450tapclothing.storeTucows Domains Inc.8 Jul 202412 Jul 20258 Jul 2026
451tapclient.techHostinger, UAB5 Aug 20246 Aug 20255 Aug 2026
452tapclover-test.appPDR Ltd. d/b/a PublicDomainRegistry.com27 Aug 202412 Sep 202427 Aug 2025
453tapclover.appPDR Ltd. d/b/a PublicDomainRegistry.com27 Aug 202413 Sep 202427 Aug 2025
454tapclickshype.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
455tapclicksads.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
456tapclicksavvy.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
457tapclicksbeyond.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
458tapclicksbuzzfeed.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
459tapclickscampaign.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
460tapclicksbuilder.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
461tapclicksbusiness.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
462tapclicksbuzz.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
463tapclickscale.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
464tapclicksclick.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
465tapclicksdemo.comGoDaddy.com, LLC17 Sep 202421 Sep 202517 Sep 2026
466tapclicksdomain.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
467tapclicksdrive.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
468tapclickscatalyst.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
469tapclickscores.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
470tapclicksdynamic.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
471tapclicksengineers.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
472tapclicksevolve.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
473tapclicksfactory.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
474tapclicksforce.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
475tapclicksdash.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
476tapclicksengine.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
477tapclickservices.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
478tapclicksfuture.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
479tapclicksgain.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
480tapclicksgrowthhub.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
481tapclicksgrowthpath.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
482tapclicksguide.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
483tapclickshigh.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
484tapclickshorizon.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
485tapclicksboost.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
486tapclicksemail.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
487tapclicksleads.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
488tapclickslive.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
489tapclicksmade.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
490tapclicksmarket.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
491tapclicksmarketplace.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
492tapclicksmart.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
493tapclicksminds.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
494tapclicksmomentum.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
495tapclicksnetworking.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
496tapclicksplans.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
497tapclicksfocus.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
498tapclicksmaster.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
499tapclicksmetrics.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
500tapclicksmove.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
501tapclickspath.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
502tapclickspower.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
503tapclicksresults.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
504tapclickssolutionshub.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
505tapclicksspotlight.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
506tapclicksmotion.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
507tapclicksnation.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
508tapclicksprime.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
509tapclickspulse.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
510tapclicksquare.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
511tapclicksscope.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
512tapclickssimplify.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
513tapclicksstrategy.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
514tapclickstechnology.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
515tapclickstrack.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
516tapclickstream.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
517tapclickstrend.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
518tapclicksvibes.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
519tapclicksgateway.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
520tapclicksscaleup.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
521tapclickssuccess.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
522tapclickstracker.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
523tapclickstribe.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
524tapclicksvault.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
525tapclickswave.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
526tapclicksxpress.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
527tapclicksynergy.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
528tapclickssuccesshub.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
529tapclicksxpert.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
530tapclickswizard.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
531tapclicksfusion.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
532tapclickspotential.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
533tapclicksreach.comPorkbun, LLC17 Sep 20241 Dec 202517 Sep 2025
534tapclicksbranddemo.comGandi SAS24 Sep 20248 Nov 202524 Sep 2025
535tapclassplace.comSquarespace Domains LLC1 Oct 202416 Sep 20251 Oct 2026
536tapclapopay.proHosting Concepts B.V. dba Openprovider10 Oct 202415 Oct 202410 Oct 2025
537tapclicku.comGoDaddy.com, LLC13 Oct 202420 Sep 202513 Oct 2026
538tapclickuni.comGoDaddy.com, LLC13 Oct 202425 Oct 202513 Oct 2026
539tapclickuniversity.comGoDaddy.com, LLC13 Oct 202420 Sep 202513 Oct 2026
540tapclick.onePorkbun, LLC5 Nov 202419 Dec 20255 Nov 2025
541tapclickloja.comGoDaddy.com, LLC5 Nov 202417 Dec 20255 Nov 2025
542tapclick.cz-17 Sep 201526 Oct 201617 Sep 2026
543tapclicksonline.comPorkbun, LLC22 Nov 20243 Dec 202522 Nov 2026
544tapclickssource.comPorkbun, LLC22 Nov 20243 Dec 202522 Nov 2026
545tapclicksstore.comPorkbun, LLC22 Nov 20243 Dec 202522 Nov 2026
546tapclicksai.comPorkbun, LLC22 Nov 20244 Feb 202622 Nov 2025
547tapclicksinsights.comPorkbun, LLC22 Nov 20243 Dec 202522 Nov 2026
548tapclicksplus.comPorkbun, LLC22 Nov 20243 Dec 202522 Nov 2026
549tapclicksprotools.comPorkbun, LLC22 Nov 20243 Dec 202522 Nov 2026
550tapclickstoday.comPorkbun, LLC22 Nov 20243 Dec 202522 Nov 2026
551tapclicksway.comPorkbun, LLC22 Nov 20244 Feb 202622 Nov 2025
552tapclicksview.comPorkbun, LLC22 Nov 20244 Feb 202622 Nov 2025
553tapclearaus.comTucows Domains Inc.26 Nov 20246 Jan 202626 Nov 2025
554tapclickventures.comWebfusion Ltd.27 Nov 202427 Nov 202427 Nov 2026
555tapclickventures.co.uk-27 Nov 202427 Nov 202427 Nov 2026
556tapclicksca.comOne.com A/S9 Dec 202415 Jan 20269 Dec 2026
557tapclaptribe.orgSquarespace Domains LLC18 Dec 20248 Dec 202518 Dec 2026
558tapclaptribe.comSquarespace Domains LLC18 Dec 20243 Dec 202518 Dec 2026
559tapclaptribe.netSquarespace Domains LLC18 Dec 20243 Dec 202518 Dec 2026
560tapclaptribe.co.uk-18 Dec 20243 Dec 202518 Dec 2026
561tapclack.comCloudFlare, Inc.11 Jan 202520 Feb 202611 Jan 2026
562tapcloud.inHostinger, UAB10 Dec 202415 Dec 202410 Dec 2026
563tapcloud.artNamesilo, LLC15 Jan 20255 Jan 202615 Jan 2027
564tapcloud.icuNamesilo, LLC15 Jan 20255 Jan 202615 Jan 2027
565tapcloud.sbsNamesilo, LLC15 Jan 20255 Jan 202615 Jan 2027
566tapcloud.clickNamesilo, LLC15 Jan 202525 Dec 202515 Jan 2027
567tapcloud.topNamesilo, LLC15 Jan 202515 Jan 202515 Jan 2027
568tapclicksdashboard.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
569tapclicksgenius.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
570tapclicksreports.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
571tapclickssuite.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
572tapclicksworkflow.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
573tapclicksync.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
574tapclicksgrowthteam.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
575tapclickspipeline.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
576tapclickssystem.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
577tapclicksmanager.comNameCheap, Inc.15 Jan 202518 Dec 202515 Jan 2027
578tapclusters.comGoDaddy.com, LLC23 Jan 202523 Jan 202623 Jan 2027
579tapcly.siteHostinger, UAB30 Jan 202531 Jan 202630 Jan 2027
580tapcleanbeg.org-4 Feb 20254 Feb 20264 Feb 2027
581tapclothes.orgGoDaddy.com, LLC5 Feb 20256 Feb 20265 Feb 2027
582tapclothes.xyzGoDaddy.com, LLC5 Feb 20256 Feb 20265 Feb 2027
583tapclothes.netGoDaddy.com, LLC5 Feb 20255 Feb 20265 Feb 2027
584tapclothes.co.uk-5 Feb 20256 Feb 20265 Feb 2027
585tapclothing.co.uk-5 Feb 20256 Feb 20265 Feb 2027
586tapclickstarget.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
587tapclicksconvert.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
588tapclicksgo.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
589tapclicksimpact.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
590tapclickslaunch.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
591tapclicksready.comCloudFlare, Inc.19 Feb 202527 Feb 202519 Feb 2026
592tapclickswin.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
593tapclicksdemand.comCloudFlare, Inc.19 Feb 202527 Feb 202519 Feb 2026
594tapclicksflow.comCloudFlare, Inc.19 Feb 202527 Feb 202519 Feb 2026
595tapclicksmax.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
596tapclicksnext.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
597tapclicksperform.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
598tapclicksscale.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
599tapclickssmart.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
600tapclicksturbo.comCloudFlare, Inc.19 Feb 202526 Feb 202519 Feb 2026
601tapclicks.onlineGoDaddy.com, LLC25 Feb 202526 Feb 202625 Feb 2027
602tapclicks.cloudGoDaddy.com, LLC11 Mar 202511 Mar 202611 Mar 2027
603tapclassroom.comOVH sas25 Mar 202513 Nov 202525 Mar 2026
604tapclickgo.ru-6 Apr 2025-6 Apr 2026
605tapcloud.de--2 Sep 2022-
606tapclick.techTucows Domains Inc.15 May 202510 Jun 202515 May 2026
607tapcloud01.bizPDR Ltd. d/b/a PublicDomainRegistry.com20 May 202523 Oct 202520 May 2026
608tapcloud02.bizPDR Ltd. d/b/a PublicDomainRegistry.com20 May 202523 Oct 202520 May 2026
609tapcloud03.bizPDR Ltd. d/b/a PublicDomainRegistry.com20 May 202523 Oct 202520 May 2026
610tapcloud04.bizPDR Ltd. d/b/a PublicDomainRegistry.com20 May 202523 Oct 202520 May 2026
611tapcloud05.bizPDR Ltd. d/b/a PublicDomainRegistry.com20 May 202524 Oct 202520 May 2026
612tapcloud06.bizPDR Ltd. d/b/a PublicDomainRegistry.com20 May 202523 Oct 202520 May 2026
613tapclickplaywin.comNameCheap, Inc.20 May 202528 May 202520 May 2026
614tapcloud.meNamesilo, LLC15 Jan 202525 Dec 202515 Jan 2027
615tapcleaningservice.comCloudFlare, Inc.21 May 202528 May 202521 May 2026
616tapclickszendesk.comNameCheap, Inc.25 May 202525 May 202525 May 2026
617tapclickzendesk.comNamesilo, LLC2 Jun 20251 Feb 20262 Jun 2026
618tapcloudmarmot.todayGoDaddy.com, LLC4 Jun 20259 Jun 20254 Jun 2026
619tapclash.appOVH sas19 Jun 202519 Jun 202519 Jun 2026
620tapclashapp.comOVH sas19 Jun 202519 Jun 202519 Jun 2025
621tapclaim.clickNameKing.com Inc.2 Jul 20257 Jul 20252 Jul 2026
622tapclip.ru.comNameKing.com Inc.28 Jun 20253 Jul 202528 Jun 2026
623tapclickfunzone.comNameCheap, Inc.14 Jul 202515 Jul 202514 Jul 2026
624tapclicker.clickWeb Commerce Communications Limited dba WebNic.cc21 Jul 202526 Jul 202521 Jul 2026
625tapclash.siteNameCheap, Inc.29 Jul 20251 Sep 202529 Jul 2026
626tapclick.meNamesilo, LLC28 Jul 20252 Aug 202528 Jul 2026
627tapclickzone.comNameCheap, Inc.4 Aug 202510 Jan 20264 Aug 2026
628tapclickclub.comNameCheap, Inc.4 Aug 202510 Jan 20264 Aug 2026
629tapcloudblazer.comeNom, Inc.31 Jul 20255 Aug 202531 Jul 2026
630tapclick.linkPorkbun, LLC8 Aug 202513 Aug 20258 Aug 2026
631tapclickfun.comNameCheap, Inc.12 Aug 202510 Jan 202612 Aug 2026
632tapclicksblog.comGoDaddy.com, LLC14 Aug 202514 Aug 202514 Aug 2030
633tapclienity.comGoDaddy.com, LLC15 Aug 202515 Aug 202515 Aug 2026
634tapclaw.comGoDaddy.com, LLC25 Aug 202525 Aug 202525 Aug 2026
635tapclickarena.comGoDaddy.com, LLC27 Aug 202527 Aug 202527 Aug 2026
636tapclean.appPorkbun, LLC10 Sep 202510 Sep 202510 Sep 2026
637tapclapandlearn.comTucows Domains Inc.15 Sep 202515 Sep 202515 Sep 2026
638tapclicksadvance.comPorkbun, LLC25 Sep 202525 Sep 202525 Sep 2026
639tapclicksperformer.comPorkbun, LLC25 Sep 202525 Sep 202525 Sep 2026
640tapclicksvalue.comPorkbun, LLC25 Sep 202525 Sep 202525 Sep 2026
641tapclover.xyzGMO Internet Inc.28 Sep 20253 Oct 202528 Sep 2026
642tapclv.xyzGMO Internet Inc.28 Sep 20253 Oct 202528 Sep 2026
643tapclicksinllc.com-6 Oct 20256 Oct 20256 Oct 2026
644tapclash.gamesWhois Networks Co., Ltd.16 Oct 202521 Oct 202516 Oct 2026
645tapclicker.ru-25 Oct 2025-25 Oct 2026
646tapclaude.appName.com, Inc.4 Nov 20259 Nov 20254 Nov 2026
647tapcliicks.comGoDaddy.com, LLC21 Nov 202521 Nov 202521 Nov 2026
648tapclicksagencyservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
649tapclicksai.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
650tapclicksbrandspro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
651tapclicksconnectpro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
652tapclicks-hq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
653tapclicksagency.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
654tapclicksagencyhq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
655tapclicksagencypro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
656tapclicksanalytics.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
657tapclicksanalyticspro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
658tapclicksanalyticsservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
659tapclicksautomation.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
660tapclicksautomationhq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
661tapclicksautomationservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
662tapclicksbrands.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
663tapclicksagencyhub.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
664tapclicksanalytics-hq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
665tapclicksautomationpro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
666tapclicksbrands-hq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
667tapclickscloud.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
668tapclickscloudhq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
669tapclickscloudpro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
670tapclickscloudservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
671tapclicksconnect.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
672tapclicksconnecthq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
673tapclicksconnectservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
674tapclicksdatahq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
675tapclicksbrandsservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
676tapclicksdashboard.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
677tapclicksdata.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
678tapclicksdatapro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
679tapclicksinsights.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
680tapclicksinsightspro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
681tapclicksdataservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
682tapclicksinsightsservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
683tapclicksintelligence.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
684tapclicksintelligencehq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
685tapclicksintelligencepro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
686tapclicksmarketing.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
687tapclicksmarketinghub.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
688tapclicksmediapro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
689tapclicksplatformpro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
690tapclicksinsightshq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
691tapclicksmarketinghq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
692tapclicksmarketingpro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
693tapclicksmediahq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
694tapclicksmediaservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
695tapclicksops.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
696tapclicksopspro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
697tapclicksserviceshq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
698tapclicksmarketingservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
699tapclicksmedia.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
700tapclicksopscenter.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
701tapclicksopshq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
702tapclicksopsservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
703tapclicksplatform.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
704tapclicksplatformhq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
705tapclicksplatformservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
706tapclickspro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
707tapclicksprohq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
708tapclicksreporting.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
709tapclicksreportingpro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
710tapclicksreportingservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
711tapclicksservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
712tapclicksvisualshq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
713tapclicksreports.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
714tapclicksreportshq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
715tapclicksstudio.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
716tapclicksvisuals.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
717tapclicksvisualspro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
718tapclicksvisualsservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
719tapclicksworkflow.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
720tapclicksworkflowhq.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
721tapclicksworkflowpro.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
722tapclicksworkflowservices.infoPorkbun, LLC24 Nov 202524 Nov 202524 Nov 2026
723tapclap.siteHostinger, UAB12 Dec 202517 Dec 202512 Dec 2026
724tapclicky.com-21 Dec 202521 Dec 202521 Dec 2026
725tapclickforgeon.techLimited Liability Company "Registrar of domain nam…26 Dec 202523 Feb 202626 Dec 2026
726tapclickodyssey.techLimited Liability Company "Registrar of domain nam…26 Dec 202523 Feb 202626 Dec 2026
727tapclubtrading.comGoDaddy.com, LLC30 Dec 202530 Dec 202530 Dec 2026
728tapclicks-connect-hq.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
729tapclicks-central.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
730tapclicks-certified.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
731tapclicks-connect.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
732tapclicks-ecosystem.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
733tapclicks-ads.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
734tapclicks-agency.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
735tapclicks-analytics.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
736tapclicks-api.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
737tapclicks-campaigns.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
738tapclicks-care.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
739tapclicks-cloud.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
740tapclicks-community.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
741tapclicks-consulting.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
742tapclicks-dashboard.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
743tapclicks-data-hub.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
744tapclicks-digital.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
745tapclicks-automation.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
746tapclicks-consultants.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
747tapclicks-experts.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
748tapclicks-group.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
749tapclicks-growth.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
750tapclicks-innovation.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
751tapclicks-ops.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
752tapclicks-hub.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
753tapclicks-insight.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
754tapclicks-insights.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
755tapclicks-integration.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
756tapclicks-learning.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
757tapclicks-academy.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
758tapclicks-data.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
759tapclicks-flow.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
760tapclicks-manager.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
761tapclicks-media.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
762tapclicks-operations.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
763tapclicks-optimize.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
764tapclicks-metrics.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
765tapclicks-optimizer.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
766tapclicks-performance.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
767tapclicks-report.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
768tapclicks-partners.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
769tapclicks-ppc.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
770tapclicks-reporting.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
771tapclicks-social.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
772tapclicks-software.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
773tapclicks-platform-hq.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
774tapclicks-pro.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
775tapclicks-seo.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
776tapclicks-software-hq.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
777tapclicks-solutions.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
778tapclicks-strategies.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
779tapclicks-strategy.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
780tapclicks-support.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
781tapclicks-workflow.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
782tapclickscampaigns.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
783tapclicks-platform.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
784tapclicks-services.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
785tapclicks-team.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
786tapclicksads.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
787tapclickscentral.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
788tapclicksdatahub.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
789tapclicksacademy.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
790tapclickscare.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
791tapclickscertified.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
792tapclickscommunity.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
793tapclicksconsultants.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
794tapclicksdigital.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
795tapclicksecosystem.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
796tapclicksgroup.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
797tapclickshq.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
798tapclicksinnovation.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
799tapclicks-training.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
800tapclicksconsulting.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
801tapclicksexperts.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
802tapclicksflow.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
803tapclickshub.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
804tapclicksmanager.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
805tapclicksapi.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
806tapclicksgrowth.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
807tapclicksinsight.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
808tapclickslearning.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
809tapclicksppc.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
810tapclickssocial.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
811tapclicksintegration.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
812tapclicksmetrics.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
813tapclicksoperations.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
814tapclicksoptimize.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
815tapclicksoptimizer.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
816tapclicksperformance.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
817tapclicksreport.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
818tapclicksstrategy.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
819tapclickspartners.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
820tapclickssoftwarehq.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
821tapclickssolutions.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
822tapclickstraining.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
823tapclicksseo.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
824tapclickssoftware.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
825tapclicksstrategies.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
826tapclickssupport.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
827tapclicksteam.infoPorkbun, LLC9 Jan 20269 Jan 20269 Jan 2027
828tapclobb.comGoDaddy.com, LLC13 Jan 202613 Jan 202613 Jan 2027
829tapclobi.comGoDaddy.com, LLC13 Jan 202613 Jan 202613 Jan 2027
830tapclobim.comGoDaddy.com, LLC13 Jan 202613 Jan 202613 Jan 2027
831tapclobis.comGoDaddy.com, LLC13 Jan 202613 Jan 202613 Jan 2027
832tapclicks456.topDynadot, LLC15 Jan 202615 Jan 202615 Jan 2027
833tapclicks999.topDynadot, LLC15 Jan 202615 Jan 202615 Jan 2027
834tapclicks333.infoDynadot, LLC15 Jan 202620 Jan 202615 Jan 2027
835tapclickzendesks.comRealtime Register B.V.14 Jan 202619 Jan 202614 Jan 2027
836tapclicksdatavis.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
837tapclickssmartreports.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
838tapclicks-ai-hq.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
839tapclicks-ai.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
840tapclicks-amplify.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
841tapclicks-bi.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
842tapclicks-connectors.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
843tapclicks-data-central.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
844tapclicks-data-vis.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
845tapclicks-help.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
846tapclicks-custom.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
847tapclicks-enterprise.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
848tapclicks-experience.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
849tapclicks-insight-center.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
850tapclicks-metrics-pro.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
851tapclicks-portal.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
852tapclicks-optimization.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
853tapclicks-orders.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
854tapclicks-report-studio.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
855tapclicks-smart-email.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
856tapclicks-smart-slides.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
857tapclicks-learn.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
858tapclicks-reports.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
859tapclicks-smart-reports.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
860tapclicks-smart.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
861tapclicks-view.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
862tapclicks-insight-hub.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
863tapclicks-test.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
864tapclicks-insights-pro.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
865tapclicksaihq.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
866tapclicksbi.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
867tapclicksamplify.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
868tapclickscustom.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
869tapclicksexperience.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
870tapclickshelp.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
871tapclicksinsightcenter.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
872tapclicksinsighthub.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
873tapclicksmart.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
874tapclicksoptimization.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
875tapclicksreportstudio.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
876tapclickssmartemail.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
877tapclickssmartslides.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
878tapclicksenterprise.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
879tapclicksorders.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
880tapclicksportal.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
881tapclickslearn.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
882tapclicksmetricspro.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
883tapclickstest.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
884tapclicksview.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
885tapclicksconnectors.infoPorkbun, LLC29 Jan 202629 Jan 202629 Jan 2027
886tapcli.com-2 Feb 20262 Feb 20262 Feb 2027
887tapclearance.life-21 Feb 202621 Feb 2026-
888tapclaw.appGoDaddy.com, LLC24 Feb 202627 Feb 202624 Feb 2027
889tapcleanse.comHostinger, UAB4 Mar 20264 Mar 20264 Mar 2027
890tapclick.digitalDynadot, LLC6 Mar 20266 Mar 20266 Mar 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=tapcl

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now