Keyword: TAMPACRIMINALDEFENSELAWYER
Reverse Whois » KEYWORD [tampacriminaldefenselawyer ] { 6 domain names }
Num | Domain Name | Registrar | Created | Updated | Expiry |
---|---|---|---|---|---|
1 | tampacriminaldefenselawyer.com | 1&1 Internet AG | 17 Jun 2003 | 27 Mar 2018 | 17 Jun 2026 |
2 | tampacriminaldefenselawyer.work | 101domain, Inc. | 30 Jul 2015 | - | 30 Jul 2016 |
3 | tampacriminaldefenselawyer.mobi | 1&1 Internet AG | 17 Aug 2007 | 17 Aug 2019 | 17 Aug 2020 |
4 | tampacriminaldefenselawyer.net | 1&1 Internet AG | 8 Jan 2004 | 2 Oct 2018 | 8 Jan 2026 |
5 | tampacriminaldefenselawyer.org | 1&1 Internet AG | 8 Jan 2004 | 9 Jan 2017 | 8 Jan 2018 |
6 | tampacriminaldefenselawyers.com | GoDaddy.com, LLC | 15 Oct 2004 | 14 Aug 2025 | 15 Oct 2025 |

Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=tampacriminaldefenselawyer
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
---|---|---|---|---|
200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |