Our database now contains whois records of 546 Million (546,830,791) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1544 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [546 Million Domains] $10,000 Details

Keyword: TAILOPEZ

Reverse Whois » KEYWORD [tailopez ]  { 311 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1tailopez.comGoDaddy.com, LLC3 Nov 20036 Aug 20233 Nov 2030
2tailopez.guruGoDaddy.com, LLC11 Feb 201511 Aug 202311 Feb 2025
3tailopez.rocksregister.com, Inc.5 May 201510 Jan 20175 May 2020
4tailopez.usGoDaddy.com, LLC11 Feb 201525 Jan 201710 Feb 2022
5tailopez.xyzXin Net Technology Corporation22 Mar 202323 Mar 202422 Mar 2025
6tailopez.scienceAlpnames Limited7 Dec 2015-6 Dec 2016
7tailopez.clubGoDaddy.com, LLC7 Nov 202312 Nov 20237 Nov 2024
8tailopez.liveNameCheap, Inc.2 Dec 20172 Dec 20172 Dec 2018
9tailopez.onlineGoDaddy.com, LLC3 Sep 20203 Sep 20203 Sep 2021
10tailopez.winNameCheap, Inc.21 Jun 201621 Jun 201620 Jun 2017
11tailopez.bizGoDaddy.com, LLC3 Apr 201311 Aug 20232 Apr 2025
12tailopez.reviewNameCheap, Inc.9 Aug 20169 Aug 20178 Aug 2017
13tailopez.tipsNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
14tailopez.infoGoDaddy.com, LLC3 Apr 201311 Aug 20233 Apr 2025
15tailopez.netGoDaddy.com, LLC3 Apr 20136 Aug 20233 Apr 2028
16tailopez.orgGoDaddy.com, LLC3 Apr 201325 Aug 20233 Apr 2028
17tailopez.websiteNameCheap, Inc.12 Jan 201712 Jan 201712 Jan 2018
18tailopez.mediaEpik Inc.25 Mar 201729 Sep 201725 Mar 2018
19tailopez.agencyNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
20tailopez.mobiEvoPlus Ltd.18 Feb 202023 Mar 202318 Feb 2023
21tailopez.solutionsGoDaddy.com, LLC13 Sep 201713 Sep 201713 Sep 2018
22tailopez.siteGoDaddy.com, LLC13 Nov 201713 Nov 201713 Nov 2018
23tailopez.companyGoDaddy.com, LLC7 Apr 202012 Apr 20207 Apr 2021
24tailopez.lifeGoDaddy.com, LLC13 Nov 201713 Nov 201713 Nov 2018
25tailopez.businessCloudFlare, Inc.4 Aug 201910 Jul 20234 Aug 2024
26tailopez.ltdNameCheap, Inc.18 Nov 201718 Nov 201718 Nov 2018
27tailopez.worldNameCheap, Inc.18 Nov 201718 Nov 201718 Nov 2018
28tailopez.storeNameCheap, Inc.25 Nov 201725 Nov 201725 Nov 2018
29tailopez.servicesGoDaddy.com, LLC25 Mar 201925 Mar 201925 Mar 2020
30tailopez.networkNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
31tailopez.academyNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
32tailopez.proNameCheap, Inc.28 Jun 201927 Aug 201928 Jun 2020
33tailopez.educationDynadot, LLC8 Jul 201913 Jul 20198 Jul 2020
34tailopez.toolsNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
35tailopez.moneyNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
36tailopez.trainingNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
37tailopez.coachNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
38tailopez.venturesNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
39tailopez.universityNamesilo, LLC4 Aug 20199 Aug 20194 Aug 2020
40tailopez.digitalNameCheap, Inc.21 Oct 202126 Oct 202121 Oct 2022
41tailopez.nl-29 Jul 202024 Apr 2023-
42tailopez.vipGoDaddy.com, LLC7 Nov 202312 Nov 20237 Nov 2024
43tailopez.uk-28 Jun 201918 Jul 202328 Jun 2024
44tailopez.ru-31 Dec 2019-31 Dec 2024
45tailopezscam.comGoDaddy.com, LLC11 Feb 20157 Aug 202311 Feb 2025
46tailopezfraud.comGoDaddy.com, LLC11 Feb 20156 Aug 202311 Feb 2025
47tailopezscam.netGoDaddy.com, LLC11 Feb 20156 Aug 202311 Feb 2025
48tailopezfraud.netGoDaddy.com, LLC11 Feb 20157 Aug 202311 Feb 2025
49tailopezquotes.comGoDaddy.com, LLC25 Feb 201525 Feb 201525 Feb 2016
50tailopez67scam.comGoDaddy.com, LLC8 Mar 202020 Mar 20248 Mar 2025
51tailopez67stepsreview.comGoDaddy.com, LLC17 May 201517 May 201517 May 2017
52tailopezrocks.comWild West Domains, LLC25 May 201525 May 201525 May 2016
53tailopezofficial.com1API GmbH28 Jan 201812 Mar 202428 Jan 2024
54tailopez-douchebag.comGoDaddy.com, LLC11 Jun 201511 Jun 201511 Jun 2016
55tailopezreview.comCrazy Domains FZ-LLC5 Feb 20203 Feb 20245 Feb 2025
56tailopez67steps.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Oct 201718 Oct 201718 Oct 2018
57tailopezproductreview.comeNom, Inc.4 Oct 20154 Oct 20154 Oct 2016
58tailopez101.xyzHostinger, UAB23 Oct 201523 Oct 201523 Oct 2016
59tailopezthe67steps.comName.com, Inc.15 Nov 201515 Nov 201515 Nov 2016
60tailopezaccelerator.netLaunchpad, Inc.20 Nov 201525 Nov 201620 Nov 2018
61tailopezaccelerator.comLaunchpad, Inc.20 Nov 201525 Nov 201620 Nov 2018
62tailopezaccelerator.orgLaunchpad, Inc.20 Nov 20151 Dec 201620 Nov 2018
63tailopezsucks.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
64tailopezwiki.comGoDaddy.com, LLC10 Dec 201810 Dec 201810 Dec 2019
65tailopezstorm.comHebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.…2 Jan 20162 Jan 20162 Jan 2017
66tailopezreviews.comGoDaddy.com, LLC26 Jun 20198 Aug 202326 Jun 2024
67tailopezonline.comGoDaddy.com, LLC1 Jun 20201 Jun 20201 Jun 2021
68tailopezfit.comGoDaddy.com, LLC3 Jan 20163 Jan 20163 Jan 2018
69tailopezbooks.com1&1 Internet AG18 Apr 202018 Apr 202018 Apr 2021
70tailopezbook.comGoDaddy.com, LLC17 Jun 202017 Jun 202017 Jun 2021
71tailopez1.comeNom, Inc.18 Sep 201717 Sep 201718 Sep 2018
72tailopezwealthsystem.comeNom, Inc.11 Feb 201612 Feb 201611 Feb 2017
73tailopez67stepsbookreview.comeNom, Inc.13 Feb 201613 Feb 201613 Feb 2017
74tailopez67lifesteps.comGoDaddy.com, LLC21 Feb 201621 Feb 201621 Feb 2017
75tailopezintro.comGoDaddy.com, LLC25 Feb 201625 Feb 201625 Feb 2017
76tailopez67.comeNom, Inc.28 Feb 201628 Feb 201628 Feb 2017
77tailopez67review.comFastDomain Inc.4 Mar 20164 Mar 20164 Mar 2017
78tailopezpartner.comGoDaddy.com, LLC4 Mar 20164 Mar 20164 Mar 2018
79tailopezsteps.clubNameCheap, Inc.5 Mar 20165 Mar 20164 Mar 2017
80tailopezsocialmedia.comGoogle, Inc.17 Nov 201711 Apr 202417 Nov 2024
81tailopezbusinessbuilder.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Mar 201624 Mar 201624 Mar 2017
82tailopezbookclub.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Mar 201624 Mar 201624 Mar 2017
83tailopezbookclub.xyzPDR Ltd. d/b/a PublicDomainRegistry.com18 Apr 201618 Jun 201618 Apr 2017
84tailopezvip.comGoDaddy.com, LLC12 May 201613 May 202312 May 2024
85tailopeztoldmetodothis.comeNom, Inc.3 Jun 20163 Jun 20163 Jun 2017
86tailopez-67steps.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jun 201611 Jun 201611 Jun 2017
87tailopezshirts.comeNom, Inc.29 Jun 201631 May 201729 Jun 2018
88tailopeztees.comeNom, Inc.29 Jun 201631 May 201729 Jun 2018
89tailopezshirt.comeNom, Inc.29 Jun 201631 May 201729 Jun 2018
90tailopezapparel.comeNom, Inc.29 Jun 201631 May 201729 Jun 2018
91tailopezclothing.comeNom, Inc.29 Jun 201631 May 201729 Jun 2018
92tailopezscam.xyzNameCheap, Inc.30 Jun 201629 Jul 201630 Jun 2017
93tailopezmarketing.xyz-30 Jun 201630 Jun 201630 Jun 2017
94tailopezfraud.xyzNameCheap, Inc.30 Jun 201629 Jul 201630 Jun 2017
95tailopez67steps.netFastDomain Inc.5 Jul 20166 Aug 20175 Jul 2017
96tailopez67steps.orgGoDaddy.com, LLC7 Jul 201618 Aug 20177 Jul 2018
97tailopezaccelerator.xyzHostinger, UAB18 Jun 201617 Aug 201618 Jun 2017
98tailopezthe67stepsreview.comFastDomain Inc.11 Jul 201623 Jul 201711 Jul 2018
99tailopez67stepsinfo.comFastDomain Inc.13 Jul 201614 Aug 201713 Jul 2017
100tailopezandthe67stepsreview.comeNom, Inc.25 Jul 20166 Sep 201725 Jul 2017
101tailopezevaluation.comFastDomain Inc.26 Jul 201631 Jul 201726 Jul 2017
102tailopezlive.streamNameCheap, Inc.9 Aug 20169 Aug 20168 Aug 2017
103tailopezpage.streamNameCheap, Inc.9 Aug 20169 Aug 20168 Aug 2017
104tailopezpages.streamNameCheap, Inc.11 Aug 201611 Aug 201610 Aug 2017
105tailopezwork.streamNameCheap, Inc.11 Aug 201611 Aug 201610 Aug 2017
106tailopez67steps.siteAlpnames Limited17 Aug 201623 Sep 201717 Aug 2017
107tailopeznetworth.comGoDaddy.com, LLC26 Aug 20166 Aug 202326 Aug 2025
108tailopezreview.orgGoDaddy.com, LLC25 Aug 20166 Oct 201725 Aug 2018
109tailopez67steps.storeNameCheap, Inc.27 Aug 20162 Oct 201727 Aug 2017
110tailopezmentor.comGoDaddy.com, LLC11 Nov 201923 Jan 202411 Nov 2023
111tailopezthe67stepsreviews.com-1 Sep 20161 Sep 20161 Sep 2017
112tailopezwebinar.com-2 Sep 20162 Sep 20162 Sep 2017
113tailopez67steps.spaceNameCheap, Inc.3 Sep 20169 Oct 20173 Sep 2017
114tailopezvip.orgGoDaddy.com, LLC12 Sep 201624 Oct 201712 Sep 2018
115tailopez-training.comeNom, Inc.24 Sep 20166 Nov 201724 Sep 2017
116tailopez-conartist.comGandi SAS19 Oct 201618 Oct 201719 Oct 2019
117tailopezscam.orgGoDaddy.com, LLC11 Feb 201511 Aug 202311 Feb 2025
118tailopezfraud.orgGoDaddy.com, LLC11 Feb 201511 Aug 202311 Feb 2025
119tailopez67steps.onlineNameCheap, Inc.26 Oct 20161 Dec 201726 Oct 2017
120tailopez-67steps.usNameCheap, Inc.3 Nov 20163 Nov 20172 Nov 2017
121tailopezreview.neteNom, Inc.6 Nov 20166 Nov 20166 Nov 2017
122tailopezprogram.comNetwork Solutions, LLC12 Sep 201812 Sep 201812 Sep 2019
123tailopezrealestate.comGoogle, Inc.17 Nov 201710 Apr 202417 Nov 2024
124tailopeztalk.comGoDaddy.com, LLC18 Nov 201618 Nov 202318 Nov 2024
125tailopez67step.comGoDaddy.com, LLC22 Nov 201622 Nov 201622 Nov 2017
126tailopezagency.comGoDaddy.com, LLC21 Sep 20197 Aug 202321 Sep 2024
127tailopezsmma.comGoDaddy.com, LLC13 Jan 201710 Jan 202413 Jan 2025
128tailopez67stepsprogram.comGoDaddy.com, LLC15 Jan 201715 Jan 201715 Jan 2018
129tailopezsocialagency.comGoDaddy.com, LLC15 Jan 201715 Jan 201715 Jan 2018
130tailopezsocialmediamarketingcertificate.comNameCheap, Inc.18 Jan 201720 Dec 201718 Jan 2019
131tailopezsocialmediamarketingagency.comNamesilo, LLC20 Oct 201820 Oct 201820 Oct 2019
132tailopezsocialmediamarketing.comNameCheap, Inc.3 Sep 20183 Sep 20183 Sep 2019
133tailopezsystem.comGoDaddy.com, LLC17 Jan 201717 Jan 201717 Jan 2018
134tailopezsocialmediamarketingagencyreview.comLaunchpad, Inc.18 Jan 201717 Jan 201818 Jan 2019
135tailopezsocialmediaagency.comNameCheap, Inc.18 Jan 201718 Jan 201718 Jan 2018
136tailopezz.comEvoPlus Ltd.24 May 201924 Nov 202324 May 2024
137tailopeztranning.comGoDaddy.com, LLC26 Jan 201726 Jan 201726 Jan 2018
138tailopezsmagency.comGoDaddy.com, LLC27 Jan 201727 Jan 201727 Jan 2018
139tailopez67steptransformation.comAutomattic Inc.14 Feb 201715 Jan 201814 Feb 2019
140tailopezsocial.comGoDaddy.com, LLC21 Feb 201721 Feb 201721 Feb 2018
141tailopezilluminaticonfirmed.comGoDaddy.com, LLC24 Feb 201724 Feb 201724 Feb 2018
142tailopezvr.comGoDaddy.com, LLC4 Mar 20174 Mar 20174 Mar 2027
143tailopez67stepsreviews.comeNom, Inc.8 Mar 20177 Mar 20178 Mar 2018
144tailopezcustomerreviews.comGoDaddy.com, LLC13 Mar 201713 Mar 201713 Mar 2019
145tailopezsocialreviews.comGoDaddy.com, LLC13 Mar 201713 Mar 201713 Mar 2018
146tailopezmarketing.comGoDaddy.com, LLC21 Sep 20197 Aug 202321 Sep 2024
147tailopezsuperfan.xyzGoDaddy.com, LLC21 Mar 201721 Mar 201721 Mar 2018
148tailopezisafraud.xyzGoDaddy.com, LLC21 Mar 201725 May 201721 Mar 2018
149tailopeznow.comGoDaddy.com, LLC6 Jul 20206 Jul 20206 Jul 2021
150tailopez67steps.xyzGoDaddy.com, LLC21 Mar 201725 May 201721 Mar 2018
151tailopezmentorprogram.comNameCheap, Inc.15 Apr 201715 Apr 201715 Apr 2018
152tailopezgame.comGoDaddy.com, LLC9 May 20179 May 20179 May 2018
153tailopezcourses.orgGoDaddy.com, LLC9 May 201711 Aug 20239 May 2025
154tailopezprograms.infoGoDaddy.com, LLC9 May 201711 Aug 20239 May 2025
155tailopeztraining.infoGoDaddy.com, LLC9 May 201711 Aug 20239 May 2025
156tailopezprograms.netGoDaddy.com, LLC9 May 20177 Aug 20239 May 2025
157tailopezcourses.infoGoDaddy.com, LLC9 May 201711 Aug 20239 May 2025
158tailopeztraining.comGoDaddy.com, LLC9 May 20177 Aug 20239 May 2025
159tailopezprograms.orgGoDaddy.com, LLC9 May 201711 Aug 20239 May 2025
160tailopeztraining.netGoDaddy.com, LLC9 May 201721 Aug 20239 May 2025
161tailopezcourses.netGoDaddy.com, LLC9 May 20176 Aug 20239 May 2025
162tailopeztraining.orgGoDaddy.com, LLC9 May 201711 Aug 20239 May 2025
163tailopezprograms.comGoDaddy.com, LLC9 May 20177 Aug 20239 May 2025
164tailopezcourses.comGoDaddy.com, LLC9 May 20177 Aug 20239 May 2025
165tailopeznetworth.netPDR Ltd. d/b/a PublicDomainRegistry.com3 Aug 20203 Aug 20203 Aug 2021
166tailopezprogams.comeNom, Inc.25 Jul 201725 Jul 201725 Jul 2018
167tailopezmademerich.comFastDomain Inc.16 Sep 201716 Sep 201716 Sep 2018
168tailopezmentoring.comNetArt Registrar Sp. z o.o.19 Oct 201719 Oct 201719 Oct 2018
169tailopezcoach.comeNom, Inc.29 Oct 201728 Oct 201729 Oct 2018
170tailopezconference.comGoDaddy.com, LLC5 Nov 20177 Aug 20235 Nov 2024
171tailopezconference.netGoDaddy.com, LLC5 Nov 20176 Aug 20235 Nov 2024
172tailopezcon.comNameCheap, Inc.5 Nov 20175 Nov 20175 Nov 2020
173tailopezconference.orgGoDaddy.com, LLC5 Nov 201711 Aug 20235 Nov 2024
174tailopezcon.orgGoDaddy.com, LLC5 Nov 201711 Aug 20235 Nov 2024
175tailopezcon.netGoDaddy.com, LLC5 Nov 20177 Aug 20235 Nov 2024
176tailopezcapital.comGoDaddy.com, LLC6 Nov 201720 Aug 20236 Nov 2024
177tailopezcapital.orgGoDaddy.com, LLC6 Nov 201711 Aug 20236 Nov 2024
178tailopezcapital.netGoDaddy.com, LLC6 Nov 20177 Aug 20236 Nov 2024
179tailopezcoin.comAmazon Registrar, Inc.18 Jul 202120 Jul 202118 Jul 2022
180tailopezclassactionlawsuit.comGoogle, Inc.15 Jan 201815 Jan 201815 Jan 2019
181tailopezbitcoin.comNameCheap, Inc.24 Jan 201825 Jan 201824 Jan 2019
182tailopezcrypto.comAmazon Registrar, Inc.18 Jul 202120 Jul 202118 Jul 2022
183tailopezcertification.comeNom, Inc.28 Jan 201828 Jan 201828 Jan 2019
184tailopeznet.comTucows Domains Inc.3 Feb 20187 Feb 20193 Feb 2019
185tailopezupdate.com1API GmbH16 Feb 201831 Mar 202416 Feb 2024
186tailopez10x.comNamesilo, LLC27 Feb 201828 Feb 201827 Feb 2019
187tailopez-official.comeNom, Inc.6 Feb 201828 Feb 20186 Feb 2019
188tailopezz.infoNameCheap, Inc.10 Apr 201810 Apr 201810 Apr 2019
189tailopez-builderall.comNameCheap, Inc.12 Apr 201812 Apr 201812 Apr 2019
190tailopezprogramreview.comTucows Domains Inc.15 Apr 201819 Apr 202115 Apr 2021
191tailopezprogramsreview.comGoDaddy.com, LLC15 Apr 201829 Apr 202415 Apr 2025
192tailopezestate.comNameCheap, Inc.4 May 20184 May 20184 May 2019
193tailopezfreetraining.comGoDaddy.com, LLC29 May 201829 May 201829 May 2019
194tailopezmasterminds.comeNom, Inc.5 Jun 20185 Jun 20185 Jun 2019
195tailopezcourse.comTucows Domains Inc.26 May 20226 Aug 202326 May 2023
196tailopezs.comGoDaddy.com, LLC22 Jun 201822 Jun 201822 Jun 2019
197tailopezproducts.comGoDaddy.com, LLC2 Apr 20206 Aug 20232 Apr 2025
198tailopez67stepstosuccess.comeNom, Inc.23 Jul 201823 Jul 201823 Jul 2019
199tailopezinsider.comGoDaddy.com, LLC23 Apr 202023 Apr 202023 Apr 2021
200tailopezbookstore.comDomeneshop AS dba domainnameshop.com30 Jul 201830 Jul 201830 Jul 2019
201tailopezquiz.comGoDaddy.com, LLC20 Aug 201820 Aug 201820 Aug 2019
202tailopezvideolibrary.comGoogle, Inc.25 Aug 201825 Aug 201825 Aug 2019
203tailopezjobs.comeNom, Inc.17 Sep 201817 Sep 201817 Sep 2019
204tailopezscumadvisory.comDomain.com, LLC4 Nov 20184 Nov 20184 Nov 2019
205tailopezscamadvisory.comDomain.com, LLC21 Nov 201821 Nov 201821 Nov 2019
206tailopezlive.comDynadot, LLC3 Dec 20183 Dec 20183 Dec 2019
207tailopezondemand.comGoDaddy.com, LLC11 Dec 201811 Dec 201811 Dec 2019
208tailopezad.comNameCheap, Inc.15 Dec 201815 Nov 202315 Dec 2024
209tailopezage.comGoDaddy.com, LLC17 Dec 20187 Aug 202317 Dec 2024
210tailopezreviewed.comNameCheap, Inc.8 Feb 20198 Feb 20198 Feb 2020
211tailopezfreemoney.comGoDaddy.com, LLC13 Feb 201926 Apr 202413 Feb 2024
212tailopezinfluencer.comOne.com A/S21 Feb 201922 Feb 201921 Feb 2020
213tailopezsale.comeNom, Inc.1 Jun 20191 Jun 20191 Jun 2020
214tailopezprodigy.clubGoDaddy.com, LLC18 Jun 201918 Jun 201918 Jun 2020
215tailopezprodigy.comGoDaddy.com, LLC18 Jun 201918 Jun 201918 Jun 2020
216tailopezcashflowsystem.comName.com, Inc.23 Jun 201923 Jun 201923 Jun 2020
217tailopezespanol.comGoogle, Inc.24 Jun 201924 Jun 201924 Jun 2020
218tailopezcashflowsystemreview.comGoogle, Inc.24 Jun 201925 Jul 202024 Jun 2020
219tailopezbusinesspartners.comNameCheap, Inc.25 Jun 2019-25 Jun 2020
220tailopezmethod.comNameCheap, Inc.2 Jul 2019-2 Jul 2020
221tailopezsecrets.comNameCheap, Inc.9 Jul 2019-9 Jul 2020
222tailopezmoneymethods.comGoDaddy.com, LLC14 Jul 201914 Jul 201914 Jul 2020
223tailopezcashfloww.comNameCheap, Inc.17 Jul 2019-17 Jul 2020
224tailopezaffiliate.comNameCheap, Inc.17 Jul 2019-17 Jul 2020
225tailopezcashflow.comNameCheap, Inc.29 Jul 2019-29 Jul 2020
226tailopezads.comInstra Corporation Pty Ltd.27 Aug 201927 Aug 201926 Aug 2020
227tailopezcapitalgroup.comGoDaddy.com, LLC8 Sep 20197 Aug 20238 Sep 2024
228tailopezblueprint.comeNom, Inc.13 Sep 201913 Sep 201913 Sep 2020
229tailopezcreative.netNameCheap, Inc.21 Sep 2019-21 Sep 2020
230tailopezmedia.comGoDaddy.com, LLC21 Sep 20197 Aug 202321 Sep 2024
231tailopezagency.netNameCheap, Inc.21 Sep 2019-21 Sep 2020
232tailopezmedia.netNameCheap, Inc.21 Sep 2019-21 Sep 2020
233tailopezmarketing.netNameCheap, Inc.21 Sep 2019-21 Sep 2020
234tailopezsuccess.comGoDaddy.com, LLC10 Oct 201911 Oct 202310 Oct 2024
235tailopezthegoodlife.comGoDaddy.com, LLC13 Oct 201913 Oct 201913 Oct 2020
236tailopezmentorship.com1API GmbH14 Aug 202114 Aug 202114 Aug 2022
237tailopezgraduate.comGoDaddy.com, LLC12 Nov 201912 Nov 201912 Nov 2020
238tailopezgraduate.netGoDaddy.com, LLC12 Nov 201912 Nov 201912 Nov 2020
239tailopeztrainer.comGoDaddy.com, LLC1 Dec 20192 Dec 20231 Dec 2024
240tailopezcreatingwealth.comGoDaddy.com, LLC11 Dec 20191 Nov 202211 Dec 2024
241tailopezonyourteam.comGoDaddy.com, LLC23 Dec 201923 Dec 201923 Dec 2020
242tailopeze-commerceblueprint.comNameCheap, Inc.24 Dec 2019-24 Dec 2020
243tailopezwealth.comNameCheap, Inc.29 Dec 2019-29 Dec 2020
244tailopezresources.comNameCheap, Inc.31 Dec 2019-31 Dec 2020
245tailopezpr.comWix.com Ltd.31 Dec 201931 Dec 201931 Dec 2020
246tailopezmenu.comGoDaddy.com, LLC23 Jan 202023 Jan 202023 Jan 2021
247tailopezsecrets.biz1API GmbH9 Feb 202016 Mar 20249 Feb 2024
248tailopezpaacoursereview.comGoogle, Inc.20 Mar 202020 Mar 202020 Mar 2021
249tailopezpaareview.comGoogle, Inc.20 Mar 202020 Mar 202020 Mar 2021
250tailopezpaacourse.comGoogle, Inc.20 Mar 202020 Mar 202020 Mar 2021
251tailopezweb.comDomainstreetdirect.com LLC11 Feb 202111 Feb 202111 Feb 2022
252tailopezwisdom.comGoDaddy.com, LLC1 Apr 20201 Apr 20201 Apr 2021
253tailopezproduct.comGoDaddy.com, LLC2 Apr 20207 Aug 20232 Apr 2025
254tailopezcoursesreview.comNameCheap, Inc.12 Apr 2020-12 Apr 2021
255tailopezfans.comGoDaddy.com, LLC24 Apr 202024 Apr 202024 Apr 2021
256tailopezecommercecertifiedspecialistcoursereview.comGoogle, Inc.30 Apr 202030 Apr 202030 Apr 2021
257tailopez-bmn.comNameCheap, Inc.5 May 2020-5 May 2021
258tailopezdreamteam.comGoDaddy.com, LLC8 May 20208 May 20208 May 2021
259tailopez-course.comeNom, Inc.14 May 202014 May 202014 May 2021
260tailopezessentials.comGoDaddy.com, LLC14 May 202014 May 202014 May 2021
261tailopezcourse.netGoogle, Inc.18 May 202018 May 202018 May 2021
262tailopezedu.comCrazy Domains FZ-LLC25 May 202025 May 202025 May 2021
263tailopezsecrettraining.comDomain.com, LLC1 Jun 20201 Jun 20201 Jun 2021
264tailopezart.comGoDaddy.com, LLC5 Jun 20205 Jun 20205 Jun 2021
265tailopeztv.comDynadot, LLC24 Nov 20224 Jan 202424 Nov 2023
266tailopezaffiliates.comGoDaddy.com, LLC19 Jun 202020 Jun 202319 Jun 2024
267tailopeztranscript.comGoDaddy.com, LLC19 Jun 202019 Jun 202019 Jun 2021
268tailopezaffiliates.netGoDaddy.com, LLC19 Jun 202019 Jun 202019 Jun 2021
269tailopezbusiness.comTucows Domains Inc.25 Jun 20205 Sep 202325 Jun 2023
270tailopezecommspecialist.comNameCheap, Inc.4 Jul 2020-4 Jul 2021
271tailopezcollege.comGoDaddy.com, LLC13 Jul 202013 Jul 202013 Jul 2021
272tailopezuniversity.comGoDaddy.com, LLC13 Jul 202013 Jul 202013 Jul 2021
273tailopezschool.comGoDaddy.com, LLC5 Sep 20205 Sep 20205 Sep 2021
274tailopezarmy.comGoDaddy.com, LLC14 Sep 202014 Sep 202014 Sep 2021
275tailopeztopcourses.comNameCheap, Inc.5 Nov 2020-5 Nov 2021
276tailopezfan.clubNameCheap, Inc.20 Jan 20214 Feb 202220 Jan 2022
277tailopezandmehrfilms.comNom-iq Ltd. dba COM LAUDE6 Jun 20214 Dec 20236 Jun 2024
278tailopezfilm.comGoDaddy.com, LLC6 Jun 20217 Aug 20236 Jun 2025
279tailopezfilms.comGoDaddy.com, LLC6 Jun 20217 Aug 20236 Jun 2025
280tailopez-nft.comNamesilo, LLC9 Feb 202210 Feb 20229 Feb 2023
281tailopezalpha.xyzNameCheap, Inc.5 Mar 202216 Apr 20235 Mar 2023
282tailopezmfers.comName.com, Inc.5 Mar 20222 Feb 20245 Mar 2025
283tailopezgarage.comDomain.com, LLC15 Jun 202231 May 202315 Jun 2024
284tailopezbb.comNameCheap, Inc.5 Aug 20225 Aug 20225 Aug 2023
285tailopezbodybuilding.comGoDaddy.com, LLC27 Aug 202227 Aug 202227 Aug 2023
286tailopezerc.orgNameCheap, Inc.6 Feb 202312 Jan 20246 Feb 2025
287tailopezerc.comNameCheap, Inc.6 Feb 20236 Feb 20236 Feb 2025
288tailopezerc.netNameCheap, Inc.6 Feb 20237 Jan 20246 Feb 2025
289tailopezfilmography.comGoDaddy.com, LLC7 Feb 20238 Feb 20247 Feb 2025
290tailopezmastermind.comDynadot, LLC6 Feb 201817 Mar 20246 Feb 2024
291tailopezinterview.comGoDaddy.com, LLC12 Mar 201813 Mar 202412 Mar 2025
292tailopezcreative.comGoDaddy.com, LLC21 Sep 20197 Aug 202321 Sep 2024
293tailopeznft.comGoDaddy.com, LLC30 Mar 202131 Mar 202430 Mar 2025
294tailopezdao.comGoDaddy.com, LLC9 Mar 202221 May 20239 Mar 2023
295tailopeztop10.comGoDaddy.com, LLC27 Apr 202228 Apr 202427 Apr 2025
296tailopezovernight.comGoDaddy.com, LLC10 May 202229 Sep 202210 May 2024
297tailopezog-mint.liveNameCheap, Inc.21 Mar 20225 Apr 202321 Mar 2024
298tailopezage.netGoDaddy.com, LLC16 Dec 20186 Aug 202316 Dec 2024
299tailopezage.orgGoDaddy.com, LLC17 Dec 201811 Aug 202317 Dec 2024
300tailopezmarketing.uk-6 Jun 20236 Jun 20236 Jun 2024
301tailopeztraining.uk-10 Jul 202310 Jul 202310 Jul 2024
302tailopezcorp.comGoogle, Inc.9 Aug 20239 Aug 20239 Aug 2024
303tailopezinc.comGoogle, Inc.9 Aug 20239 Aug 20239 Aug 2024
304tailopezllc.comGoogle, Inc.9 Aug 20239 Aug 20239 Aug 2024
305tailopeznew.comGoogle, Inc.9 Aug 20239 Aug 20239 Aug 2024
306tailopezorg.comGoogle, Inc.9 Aug 20239 Aug 20239 Aug 2024
307tailopezpro.comGoogle, Inc.9 Aug 20239 Aug 20239 Aug 2024
308tailopezgo.comGoogle, Inc.9 Aug 20239 Aug 20239 Aug 2024
309tailopezbrands.comGoDaddy.com, LLC2 Sep 20238 Sep 20232 Sep 2024
310tailopezoffer.comNameCheap, Inc.6 Feb 20246 Feb 20246 Feb 2025
311tailopezsol.comNameCheap, Inc.12 Mar 202412 Mar 202412 Mar 2025

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=tailopez

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now