Our database now contains whois records of 728 Million (728,063,694) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1596 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
5000 WHOIS Lookup API Queries $10 Details
5000 WHOIS History API Queries $25 Details
5000 Reverse WHOIS API Queries $50 Details
Newly Registered Domains Database $495 Details
Whois Database [728 Million Domains] $10,000 Details

Keyword: SWITECH

Reverse Whois » KEYWORD [switech ]  { 55 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1switech.bizNamesilo, LLC23 May 202423 May 202623 May 2026
2switech.comMegazone Corp., dba HOSTING.KR16 Oct 20083 Feb 202616 Oct 2026
3switech.netXin Net Technology Corporation8 Apr 200317 Jun 20258 Apr 2031
4switech.in-15 Dec 201426 Jan 201815 Dec 2018
5switech.co.uk-7 Mar 20256 Mar 20267 Mar 2027
6switech.uk-26 Nov 201626 Nov 201626 Nov 2018
7switech.xyzGoDaddy.com, LLC30 May 20257 Jun 202630 May 2027
8switech.cloudNameCheap, Inc.27 Mar 202211 Apr 202327 Mar 2023
9switech.ma-5 Jun 20234 Jul 20245 Jun 2024
10switech.onlinePDR Ltd. d/b/a PublicDomainRegistry.com22 Sep 2022-22 Sep 2023
11switech.net.cn-11 Jun 2008-11 Jun 2027
12switech.it-15 May 200930 Mar 202614 Mar 2027
13switech.storeAbove.com Pty Ltd.13 Apr 202529 May 202613 Apr 2027
14switech.com.au--15 Aug 2026-
15switech.com.cn-18 Apr 2014-18 Apr 2029
16switech.siteHostinger, UAB13 Sep 202426 Nov 202513 Sep 2025
17switech.de--6 Nov 2022-
18switech.se-30 Dec 202518 May 202630 Dec 2029
19switech.eu----
20switech.cn????????????31 Jul 2026-31 Jul 2027
21switechgroup.comRealtime Register B.V.24 May 202425 May 202524 May 2026
22switechs.comHiChina Zhicheng Technology Limited7 May 201522 Apr 20267 May 2027
23switech-hk.comHiChina Zhicheng Technology Limited9 Aug 201526 Apr 20179 Aug 2018
24switech-hk.netTucows Domains Inc.4 Mar 20266 Mar 20264 Mar 2027
25switechnology.comGoDaddy.com, LLC14 Feb 201215 Feb 202414 Feb 2029
26switechro.comregister.com, Inc.29 Oct 201021 Oct 201329 Oct 2017
27switechindia.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Jan 20088 Apr 202630 Jan 2027
28switechnic.comGoDaddy.com, LLC26 Jun 201115 May 201426 Jun 2017
29switechnologies.comGoDaddy.com, LLC7 Feb 201121 Feb 20267 Feb 2027
30switechnik.de--9 Dec 2009-
31switechproductions.comGoDaddy.com, LLC28 Nov 201610 Dec 202528 Nov 2026
32switechmall.comHiChina Zhicheng Technology Limited8 Apr 201727 Apr 20178 Apr 2018
33switechmall.netHiChina Zhicheng Technology Limited8 Apr 201713 Apr 20178 Apr 2018
34switech-consulting.comGoDaddy.com, LLC3 Sep 202018 Sep 20253 Sep 2026
35switech-bf.comAscio Technologies, Inc. Danmark - Filial af Ascio…6 Nov 20206 Nov 20206 Nov 2021
36switechcoating.comXin Net Technology Corporation16 Dec 202016 Dec 202016 Dec 2030
37switechindustry.comLimited Liability Company "Registrar of domain nam…8 Jan 20218 Jan 20218 Jan 2023
38switechintegratedltd.comNamesilo, LLC31 Mar 20214 Jun 202331 Mar 2023
39switechgroup.siteregister.com, Inc.11 Apr 202111 Apr 202111 Apr 2022
40switech-china.comeNom, Inc.23 Jul 20213 Sep 202523 Jul 2025
41switechbf.comHosting Concepts B.V. dba Openprovider29 Jul 20218 Sep 202429 Jul 2024
42switechventures.comNameCheap, Inc.6 Oct 202218 Dec 20236 Oct 2023
43switechsystemsmarketingpteltd.comNameCheap, Inc.12 Oct 202223 Nov 202312 Oct 2023
44switechchina.comGoDaddy.com, LLC19 Nov 20226 Nov 202519 Nov 2026
45switech1978.comXin Net Technology Corporation1 Jul 20199 Apr 20241 Jul 2031
46switechco.com1API GmbH17 Nov 202329 Apr 202617 Nov 2026
47switechu.comCrazy Domains FZ-LLC20 Nov 20233 Jan 202520 Nov 2024
48switech-filtrations.comWix.com Ltd.26 Sep 20246 Nov 202526 Sep 2025
49switech-solutions.comWix.com Ltd.26 Sep 20246 Nov 202526 Sep 2025
50switechai.comCloudFlare, Inc.14 Nov 202412 Apr 202614 Nov 2026
51switechglobal.comCrazy Domains FZ-LLC2 Jun 202510 Mar 20262 Jun 2028
52switechpulsefr.comDynadot, LLC18 Aug 202519 Aug 202618 Aug 2027
53switechnology.xyzGMO Internet Inc.28 Sep 20253 Oct 202528 Sep 2026
54switech-solution.comGoogle, Inc.25 Feb 202611 Mar 202625 Feb 2027
55switechindia.coHosting Concepts B.V. dba Openprovider4 Jul 20269 Jul 20264 Jul 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=switech

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
5,000 Reverse Whois API Queries 5,000 $50 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now