Our database now contains whois records of 632 Million (632,443,656) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [632 Million Domains] $10,000 Details

Keyword: SWAMY

Reverse Whois » KEYWORD [swamy ]  { 518 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1swamy.bizNordNet SA24 Jul 201729 Mar 202523 Jul 2025
2swamy.orgGoDaddy.com, LLC27 Mar 201711 May 202527 Mar 2026
3swamy.associatesGo Australia Domains, LLC23 Jul 201423 Jul 201423 Jul 2015
4swamy.clubGoDaddy.com, LLC1 Jul 20191 Jul 20191 Jul 2020
5swamy.xyzGoDaddy.com, LLC25 Jul 20186 Aug 202525 Jul 2026
6swamy.com1&1 Internet AG25 Jan 199822 Mar 201824 Jan 2026
7swamy.guruGoDaddy.com, LLC9 Feb 201426 Mar 20179 Feb 2018
8swamy.onlineGoDaddy.com, LLC27 Jun 201827 Jun 201827 Jun 2019
9swamy.infoGlobal Domains International, Inc. DBA DomainCostC…11 Aug 200325 Sep 202411 Aug 2025
10swamy.netOnlineNIC, Inc.28 May 200124 May 202528 May 2026
11swamy.de--23 Oct 2007-
12swamy.co.uk-6 Aug 200511 Feb 20166 Aug 2019
13swamy.mobiGoDaddy.com, LLC27 Mar 201727 May 201727 Mar 2018
14swamy.instituteGoDaddy.com, LLC4 Jun 201724 May 20184 Jun 2021
15swamy.techGoDaddy.com, LLC23 Apr 201827 May 202523 Apr 2026
16swamy.webcamNimzo 98, LLC25 Nov 201930 Nov 201925 Nov 2020
17swamy.websiteGoDaddy.com, LLC29 Mar 202014 May 202029 Mar 2021
18swamy.downloadDynadot, LLC9 May 202114 May 20219 May 2022
19swamy.designGoDaddy.com, LLC1 Jun 20211 Jun 20211 Jun 2022
20swamy.cloudHostinger, UAB25 Mar 202425 Mar 202525 Mar 2026
21swamy.ccGoDaddy.com, LLC6 Aug 20187 Aug 20246 Aug 2025
22swamy.uk-2 Jan 20233 Sep 20242 Jan 2025
23swamy.lol-6 May 202318 Jul 20246 May 2024
24swamy.globalGoDaddy.com, LLC21 Feb 202414 Sep 202421 Feb 2027
25swamy.ioNameCheap, Inc.4 Jan 202418 Mar 20254 Jan 2025
26swamy.storeHostinger, UAB27 Apr 20249 Apr 202527 Apr 2026
27swamy.funHostinger, UAB18 Jul 202419 Jul 202518 Jul 2026
28swamy.careHostinger, UAB3 Nov 202418 May 20253 Nov 2025
29swamy.oneNameCheap, Inc.3 Dec 20248 Dec 20243 Dec 2025
30swamy.devHosting Concepts B.V. dba Openprovider29 Dec 202412 Jan 202529 Dec 2025
31swamy.lifeGoDaddy.com, LLC15 Mar 202520 Mar 202515 Mar 2026
32swamy.coDynadot, LLC15 Jan 202523 Jan 202515 Jan 2026
33swamydayanandgroupofschools.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2015
34swamyramdevmedicine.comGoDaddy.com, LLC17 Aug 201422 Apr 201517 Aug 2015
35swamytourism.comGoDaddy.com, LLC7 Jul 201129 Jan 20157 Jul 2015
36swamysart.com----
37swamyjagannath.comDropCatch.com 652 LLC23 Jan 201624 Jan 201723 Jan 2018
38swamyoil.netTucows Domains Inc.19 Aug 201421 Jul 201719 Aug 2018
39swamysoftsolutions.comGoDaddy.com, LLC26 Aug 201422 Aug 201626 Aug 2017
40swamydoss-family.comGoDaddy.com, LLC13 Nov 201413 Nov 201413 Nov 2015
41swamysaranam.org-30 Dec 202312 Mar 202530 Dec 2024
42swamytravels.comDropCatch.com 982 LLC17 Feb 202430 Mar 202517 Feb 2025
43swamyfilms.comBigRock Solutions Ltd.10 Feb 201927 Jan 202510 Feb 2029
44swamyvivekanandarschoolelampillai.comGoDaddy.com, LLC7 Oct 20147 Oct 20147 Oct 2015
45swamysnews.comTucows Domains Inc.28 Feb 202128 Feb 202128 Feb 2022
46swamyoilindustries.comTucows Domains Inc.5 Mar 202015 Nov 20245 Mar 2027
47swamyayyappatravels.com1&1 Internet AG29 Nov 201422 Mar 201829 Nov 2025
48swamyayyappatravels.net1&1 Internet AG29 Nov 201414 Dec 201729 Nov 2025
49swamyasso.comPDR Ltd. d/b/a PublicDomainRegistry.com15 May 202416 May 202515 May 2026
50swamygroups.comGandi SAS3 Dec 20143 Dec 20143 Dec 2015
51swamyroadlines.comNet 4 India Limited9 Dec 20149 Dec 20149 Dec 2015
52swamysharanam.comNameCheap, Inc.13 Oct 202224 Nov 202313 Oct 2023
53swamyfilms16.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Jan 20153 Jan 20153 Jan 2016
54swamyjagannath.netGoDaddy.com, LLC7 Jan 20157 Jan 20157 Jan 2016
55swamyisms.comGoDaddy.com, LLC16 Jan 201517 Jan 202516 Jan 2030
56swamyism.comGoDaddy.com, LLC16 Jan 201517 Jan 202516 Jan 2030
57swamyschool.comGoDaddy.com, LLC19 Jan 201519 Jan 201519 Jan 2016
58swamywedsswetha.comBigRock Solutions Ltd.27 Jan 201527 Jan 201527 Jan 2016
59swamycafe.comGoDaddy.com, LLC23 Nov 201623 Nov 201623 Nov 2017
60swamytiffins.comBigRock Solutions Ltd.21 Aug 201522 Jul 201621 Aug 2017
61swamyinfra.comGoDaddy.com, LLC21 Aug 201521 Aug 201521 Aug 2016
62swamyhortitech.comGoDaddy.com, LLC20 Feb 201520 Feb 201520 Feb 2016
63swamyassociatesllc.comGoDaddy.com, LLC6 Mar 20156 Mar 20156 Mar 2018
64swamyniranjandev.comGoDaddy.com, LLC12 Mar 201512 Mar 201512 Mar 2016
65swamysongs.comGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2016
66swamyvivekananda.comTurnCommerce, Inc. DBA NameBright.com17 Jun 201611 Jun 202017 Jun 2026
67swamyindustries.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Mar 201531 Mar 201531 Mar 2016
68swamyvivekananda.net----
69swamymystery.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Sep 20151 Sep 20151 Sep 2016
70swamyfotoanimationstudio.comGoDaddy.com, LLC15 Sep 201815 Sep 201815 Sep 2019
71swamyskitchen.comTucows Domains Inc.16 Apr 20157 May 202516 Apr 2026
72swamymonkey.comGoDaddy.com, LLC6 Sep 20156 Sep 20246 Sep 2025
73swamyramdev.comGoDaddy.com, LLC7 May 20157 May 20157 May 2016
74swamyenggworks.comPDR Ltd. d/b/a PublicDomainRegistry.com9 May 201520 Jun 20179 May 2017
75swamywoodcarving.comMetaregistrar BV Applications17 Sep 202324 Aug 202417 Sep 2026
76swamyengineeringworks.comGoDaddy.com, LLC12 May 20157 Jun 202512 May 2026
77swamysaranam.comTurnCommerce, Inc. DBA NameBright.com20 Aug 20181 Oct 202420 Aug 2024
78swamyservicestation.comNetwork Solutions, LLC6 Jun 20153 Jun 20256 Jun 2026
79swamyvivekanandamission.orgGoDaddy.com, LLC10 Jun 201510 Jun 201510 Jun 2016
80swamysutras.comGoDaddy.com, LLC14 Jun 201514 Jun 201514 Jun 2016
81swamymalai.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Sep 201625 Jun 202527 Sep 2028
82swamygauseva.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Jul 20152 Jul 20152 Jul 2016
83swamytheatre.comGoDaddy.com, LLC26 Sep 201526 Sep 201526 Sep 2016
84swamyonline.comGoDaddy.com, LLC21 Jan 202021 Jan 202021 Jan 2021
85swamyfinancial.comGoDaddy.com, LLC1 Oct 20151 Oct 20241 Oct 2025
86swamyelevators.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Oct 201531 Oct 201612 Oct 2017
87swamysivasuji.comGoDaddy.com, LLC19 Oct 201519 Oct 201519 Oct 2016
88swamyseva.comZNet Technologies Pvt Ltd.24 Oct 201527 Nov 201624 Oct 2017
89swamysfoods.comGoDaddy.com, LLC23 Nov 201523 Nov 201523 Nov 2016
90swamytheistalia.comMelbourne IT, Ltd25 Nov 201525 Nov 201525 Nov 2016
91swamycablenetwork.comGoDaddy.com, LLC27 Nov 201527 Nov 201527 Nov 2016
92swamyamerica.comGoDaddy.com, LLC18 Dec 201518 Dec 201518 Dec 2016
93swamydentalcare.comGoDaddy.com, LLC19 Dec 201520 Sep 202219 Dec 2025
94swamydreams.comPSI-USA, Inc. dba Domain Robot10 Sep 202010 Sep 202010 Sep 2021
95swamyproperty.comGoDaddy.com, LLC30 Dec 201530 Dec 201530 Dec 2016
96swamykr.unoDomainia Inc.29 Dec 201529 Dec 201528 Dec 2016
97swamynaiks.comGoDaddy.com, LLC31 Jan 201631 Jan 201631 Jan 2017
98swamynathan.xyzNameCheap, Inc.2 Feb 201624 Feb 20162 Feb 2017
99swamymalai.xyzNameCheap, Inc.2 Feb 201624 Feb 20162 Feb 2017
100swamysons.netGoDaddy.com, LLC29 Aug 200813 Aug 202429 Aug 2026
101swamyinc.comeNom, Inc.16 Mar 201614 Mar 201716 Mar 2018
102swamyaiyappansangam.comGoDaddy.com, LLC28 Jun 201728 Jun 201728 Jun 2018
103swamyvivekanandaschool.comGoDaddy.com, LLC12 Jun 202512 Jun 202512 Jun 2026
104swamyvasudevastrology.comGoDaddy.com, LLC15 Apr 201615 Apr 201615 Apr 2017
105swamyeyehospital.comGoDaddy.com, LLC19 Jul 202419 Jul 202419 Jul 2027
106swamytechnosystems.comGoDaddy.com, LLC7 May 20164 May 20257 May 2026
107swamypoornananda.orgGoDaddy.com, LLC10 May 201624 Jun 202510 May 2026
108swamybphoto.comGoDaddy.com, LLC12 May 201612 May 201612 May 2019
109swamynathan.comregister.com, Inc.16 May 201616 May 201616 May 2026
110swamyji.comGoDaddy.com, LLC9 Feb 20259 Feb 20259 Feb 2026
111swamyvivekanandaquotes.comGoDaddy.com, LLC6 Jun 20166 Jun 20166 Jun 2017
112swamyrealtor.comNamesilo, LLC17 Jun 201618 Jun 202517 Jun 2026
113swamytutoring.comGoDaddy.com, LLC28 Jun 201628 Jun 201628 Jun 2018
114swamysriharsha.techGoDaddy.com, LLC8 Jun 201610 Jun 20168 Jun 2017
115swamyvivekananda.orgGoDaddy.com, LLC10 Jul 201621 Aug 201710 Jul 2018
116swamyassociates.inGoDaddy.com, LLC1 Aug 202312 Sep 20241 Aug 2024
117swamyayyappa.inNameCheap, Inc.5 Sep 202430 Dec 20245 Sep 2025
118swamysaranam.co.in-1 May 20121 Aug 20171 May 2018
119swamynursery.in-19 Feb 201325 Feb 202519 Feb 2026
120swamysoftsoltions.comGoDaddy.com, LLC18 Jul 201618 Jul 201618 Jul 2017
121swamylicious.comTucows Domains Inc.23 Jul 201627 Jul 201723 Jul 2017
122swamytech.comTurnCommerce, Inc. DBA NameBright.com22 May 202016 May 202122 May 2026
123swamyclinic.socialeNom, Inc.26 Jul 20167 Sep 202426 Jul 2024
124swamysoft.com-14 Aug 201614 Aug 201614 Aug 2018
125swamyfarmproducts.com-16 Aug 201616 Aug 201616 Aug 2017
126swamysvisualmedia.com-22 Aug 201622 Aug 201622 Aug 2017
127swamyayyappaseva.com-18 Sep 201618 Sep 201618 Sep 2017
128swamyconstructions.comDropCatch.com 1071 LLC7 Dec 20187 Dec 20187 Dec 2019
129swamychettan.com-22 Sep 201622 Sep 201622 Sep 2017
130swamyconstruction.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Sep 201627 Nov 201627 Sep 2019
131swamybalaji.comDomainshype.com, Inc.30 Sep 201610 Oct 201730 Sep 2018
132swamysschool.comNameCheap, Inc.27 Apr 201024 Jan 202524 Jan 2035
133swamyarmy.comRealtime Register B.V.20 Oct 202419 Dec 202420 Oct 2025
134swamyayyappa.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Sep 200113 Sep 202414 Sep 2025
135swamyengineering.comTucows Domains Inc.22 Feb 202513 Mar 202522 Feb 2027
136swamybusiness.comTucows Domains Inc.4 Mar 201014 Apr 20234 Mar 2023
137swamya.comGoDaddy.com, LLC2 Nov 20242 Nov 20242 Nov 2025
138swamyads.comGoDaddy.com, LLC8 May 20131 May 20258 May 2026
139swamybuilders.comTurnCommerce, Inc. DBA NameBright.com18 Oct 202027 Nov 202418 Oct 2024
140swamyz.comGoogle, Inc.22 May 202022 May 202022 May 2021
141swamylogistics.com-5 May 20103 May 20255 May 2026
142swamyconsulting.comGoDaddy.com, LLC26 Jan 201330 Apr 201526 Jan 2017
143swamydiabetescentre.comFastDomain Inc.17 Dec 201223 Dec 201317 Dec 2016
144swamystreet.comGoDaddy.com, LLC6 Jan 201228 Apr 20156 Jan 2017
145swamysound.comDROPCATCH.COM 839 LLC27 Apr 202228 Apr 202327 Apr 2023
146swamynathandiamonds.comeNom, Inc.18 Nov 200912 Sep 202318 Nov 2025
147swamysvaasthushastra.comGoDaddy.com, LLC26 Feb 20072 May 201526 Feb 2018
148swamypublishers.comBigRock Solutions Ltd.18 Jun 200520 May 202518 Jun 2028
149swamybabu.comeNom666, Inc.23 Nov 201624 Nov 201623 Nov 2017
150swamyinternational.comGoDaddy.com, LLC19 Sep 200931 Oct 202419 Sep 2024
151swamysweets.comGoDaddy.com, LLC26 Nov 201110 May 202526 Nov 2025
152swamy-cine.comGoDaddy.com, LLC23 Jun 201126 Jun 202423 Jun 2026
153swamynath.comPDR Ltd. d/b/a PublicDomainRegistry.com7 May 20008 Apr 20257 May 2026
154swamyg.comNameCheap, Inc.24 Jan 200810 Jan 201924 Jan 2026
155swamyartgallery.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Feb 20175 Jan 201813 Feb 2018
156swamychhabra.comNetwork Solutions, LLC23 Dec 200830 Dec 202423 Dec 2025
157swamy-associates.comGoDaddy.com, LLC21 Dec 201020 Dec 202321 Dec 2025
158swamy39.comCloudFlare, Inc.8 May 20132 Jun 20258 May 2026
159swamyayyappan.comNameCheap, Inc.28 Feb 20081 Feb 202528 Feb 2026
160swamypubllishers.comNameKing.com Inc.28 Aug 201027 Sep 201628 Aug 2016
161swamyeyeclinic.comRealtime Register B.V.23 May 202424 May 202523 May 2026
162swamyenterprises.comGoDaddy.com, LLC22 Dec 200330 Dec 202422 Dec 2025
163swamyspecialitychemicals.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Mar 201220 Feb 201613 Mar 2017
164swamys.comTurnCommerce, Inc. DBA NameBright.com14 Oct 20171 Feb 202314 Oct 2025
165swamynursery.comGoDaddy.com, LLC4 Oct 20234 Oct 20234 Oct 2028
166swamyclinic.comeNom, Inc.9 Aug 200530 Nov 20179 Aug 2025
167swamyandswamy.comTucows Domains Inc.17 Oct 20093 Oct 202417 Oct 2025
168swamysbooks.com-9 Aug 202210 Aug 20239 Aug 2024
169swamyvivekanandanagar.comGoDaddy.com, LLC14 Oct 201329 Oct 201514 Oct 2016
170swamyresortshirdi.comGoDaddy.com, LLC27 Sep 20232 Nov 202327 Sep 2028
171swamyfamily.comeNom, Inc.25 Jan 200817 Aug 201625 Jan 2017
172swamyoil.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Feb 20117 Jun 202418 Feb 2028
173swamyrelaxparadise.comDomainshype.com, Inc.4 Aug 201415 Sep 20164 Aug 2016
174swamyfoundation.comGoDaddy.com, LLC21 Aug 20114 Aug 201621 Aug 2017
175swamykrishna.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Nov 201112 Apr 202514 Nov 2028
176swamyplastics.comWild West Domains, LLC19 Mar 200515 Mar 202519 Mar 2026
177swamysons.comGoDaddy.com, LLC6 Aug 20226 Aug 20256 Aug 2026
178swamylawhouse.comGoDaddy.com, LLC11 Oct 200910 Dec 202411 Oct 2025
179swamybattachariya.comGood Domain Registry Pvt Ltd.18 Feb 201216 Feb 201818 Feb 2019
180swamycorporation.comGoDaddy.com, LLC13 Dec 201114 Nov 201513 Dec 2016
181swamydayananda.orgGoDaddy.com, LLC5 Oct 201616 Nov 20175 Oct 2018
182swamyclinic.netTucows Domains Inc.4 Dec 20128 Dec 20164 Dec 2016
183swamynursery.netGoDaddy.com, LLC28 Mar 20129 May 201628 Mar 2017
184swamyinternational.netGoDaddy.com, LLC28 Dec 20118 Jan 201628 Dec 2016
185swamytemple.comGoDaddy.com, LLC2 Mar 202312 Feb 20252 Mar 2026
186swamysharanam.orgTucows Domains Inc.21 Mar 200722 Mar 202521 Mar 2026
187swamy-ranjani.orgGoDaddy.com, LLC18 Jul 201215 Jul 201618 Jul 2017
188swamysamartha.orgGoDaddy.com, LLC9 Feb 200911 Feb 20179 Feb 2018
189swamyvivekanandha.orgPDR Ltd. d/b/a PublicDomainRegistry.com29 Mar 200713 May 202529 Mar 2026
190swamycrackers.comAscio Technologies, Inc. Danmark - Filial af Ascio…25 Oct 201626 Oct 201725 Oct 2018
191swamynarasimhalawn.com-28 Oct 201628 Oct 201628 Oct 2017
192swamycare.comGoDaddy.com, LLC14 Oct 202414 Oct 202414 Oct 2027
193swamyandsons.comGoDaddy.com, LLC6 Dec 20166 Dec 20166 Dec 2017
194swamypublisher.comGoDaddy.com, LLC6 Dec 20166 Dec 20166 Dec 2017
195swamydevikananda.comGoDaddy.com, LLC7 Dec 20167 Dec 20167 Dec 2018
196swamysaiindustries.comGoDaddy.com, LLC30 Dec 201630 Dec 201630 Dec 2017
197swamyvivekanandatrust.comGoDaddy.com, LLC2 Jan 20172 Jan 20172 Jan 2018
198swamyandfriends.comGoogle, Inc.30 Mar 202115 Mar 202530 Mar 2026
199swamyandfriends.orgGoogle, Inc.30 Mar 202117 Jul 202530 Mar 2026
200swamyinstituteofmaths.comGoDaddy.com, LLC16 Jan 201716 Jan 201716 Jan 2019
201swamyengineering.co.in-27 Nov 201627 Nov 201727 Nov 2018
202swamysvaasthu.comGoogle, Inc.20 Jan 20175 Jan 202520 Jan 2026
203swamylab.comTucows Domains Inc.5 Feb 201730 Apr 20255 Feb 2026
204swamygenpact.comGoDaddy.com, LLC6 Feb 20176 Feb 20176 Feb 2018
205swamydarshanam.comGoDaddy.com, LLC12 Feb 201718 Feb 202512 Feb 2026
206swamyscafe.comGoDaddy.com, LLC15 Feb 201715 Feb 201715 Feb 2018
207swamyrara.comBigRock Solutions Ltd.8 Mar 20178 May 20178 Mar 2020
208swamyrealty.comGoDaddy.com, LLC16 Mar 201727 May 202516 Mar 2025
209swamysriharsha.comGoDaddy.com, LLC17 Mar 201714 Jun 201717 Mar 2019
210swamyvivekanandabadmintonclub.xyzGoDaddy.com, LLC24 Mar 201724 Mar 201724 Mar 2018
211swamytutorialskalaburgi.comGoDaddy.com, LLC28 Mar 201728 Mar 201728 Mar 2018
212swamytourism.in-26 Aug 20138 Nov 202426 Aug 2025
213swamyinfotech.comDynadot, LLC21 Feb 202010 Feb 202521 Feb 2026
214swamysteelbuilders.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Apr 201721 Jun 201721 Apr 2018
215swamyayyappaspeedparcelservice.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Apr 201722 Jun 201722 Apr 2018
216swamyvivekanandainternationalpublicschool.comGoDaddy.com, LLC11 May 201711 May 201711 May 2018
217swamyslangs.comDomain.com, LLC16 May 201716 May 201716 May 2018
218swamyideals.winNameCheap, Inc.24 May 20177 Sep 201724 May 2018
219swamysiddha.comHostinger, UAB26 Feb 202026 Feb 202026 Feb 2021
220swamynetcafe.comGoDaddy.com, LLC3 Jun 20173 Jun 20173 Jun 2018
221swamyevents.comGoDaddy.com, LLC14 Jun 201714 Jun 201714 Jun 2019
222swamyassociate.comGoDaddy.com, LLC9 Jan 20249 Jan 20249 Jan 2027
223swamymovies.comGoDaddy.com, LLC25 Jun 201725 Jun 201725 Jun 2018
224swamytravels.infoGoDaddy.com, LLC25 Jul 201725 Jul 201725 Jul 2018
225swamysschool.orgPDR Ltd. d/b/a PublicDomainRegistry.com23 Aug 201725 May 202123 Aug 2027
226swamymalaierp.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Dec 201713 Feb 202522 Dec 2025
227swamymovies.co.uk-25 Jun 201424 Jun 201725 Jun 2020
228swamybuilders.in-9 Jun 20178 Aug 20179 Jun 2019
229swamygst.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Apr 201814 Apr 201814 Apr 2019
230swamynurseryandflorist.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Apr 201819 Apr 201819 Apr 2019
231swamynathan.infoNet 4 India Limited24 May 2018-24 May 2019
232swamyfinance.comOne.com A/S10 Jun 201810 Jun 201810 Jun 2019
233swamyenfix.racingNameCheap, Inc.17 Jul 201817 Jul 201817 Jul 2019
234swamyvivekanandarelampillai.comGoDaddy.com, LLC7 Aug 20187 Aug 20187 Aug 2019
235swamytv.comHosting Concepts B.V. dba Openprovider3 May 20213 May 20213 May 2022
236swamybookcenter.comGoogle, Inc.6 Sep 20216 Sep 20216 Sep 2022
237swamyramanandji.comGoDaddy.com, LLC19 Sep 201816 Oct 202219 Sep 2027
238swamygroup.comNamesilo, LLC20 Sep 201820 Apr 202520 Sep 2025
239swamysiri.comGoogle, Inc.5 Oct 201830 Sep 20245 Oct 2025
240swamys-kitchen.comNameCheap, Inc.26 Dec 20227 Mar 202426 Dec 2023
241swamykannanbattachariya.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Oct 201821 Oct 201821 Oct 2019
242swamyweb.comGoDaddy.com, LLC31 Oct 20188 Nov 202431 Oct 2025
243swamyimpex.comGoDaddy.com, LLC12 Nov 201812 Nov 201812 Nov 2019
244swamysurfaces.comGoDaddy.com, LLC15 Nov 201816 Nov 202415 Nov 2025
245swamyschoolcbse.comGood Domain Registry Pvt Ltd.24 Nov 201824 Nov 201824 Nov 2019
246swamyherbalayurveda.comGoDaddy.com, LLC28 Nov 201828 Nov 201828 Nov 2019
247swamyacoustic.comGoDaddy.com, LLC11 Dec 201812 Dec 202411 Dec 2025
248swamynco.comTucows Domains Inc.12 Dec 20185 Dec 202412 Dec 2025
249swamyviv.comHostinger, UAB2 Apr 20252 Apr 20252 Apr 2026
250swamybv.comGoDaddy.com, LLC5 Jan 20195 Jan 20195 Jan 2021
251swamydharisanam.comTucows Domains Inc.27 Aug 202412 Jun 202527 Aug 2025
252swamyensterprises.comNameCheap, Inc.30 Jan 201930 Jan 201930 Jan 2020
253swamyaccounting.comGoogle, Inc.6 Feb 20196 Feb 20196 Feb 2020
254swamysystems.comBigRock Solutions Ltd.8 Feb 201910 Feb 20258 Feb 2026
255swamyvasudev.comGoDaddy.com, LLC18 Feb 201918 Feb 201918 Feb 2021
256swamykitchen.comGoDaddy.com, LLC5 Mar 20196 Mar 20245 Mar 2029
257swamyandco.comGoDaddy.com, LLC20 Jun 202520 Jun 202520 Jun 2028
258swamybandamidilawyer.comGoDaddy.com, LLC27 Apr 201927 Apr 201927 Apr 2020
259swamyvidyalaya.comWild West Domains, LLC7 May 20197 May 20197 May 2020
260swamyvivekanandaschools.comBigRock Solutions Ltd.18 May 201920 May 201918 May 2020
261swamyvivekanandamatricschool.comGoDaddy.com, LLC22 May 201921 May 202522 May 2026
262swamymm.comFastDomain Inc.3 Jun 20193 Jun 20193 Jun 2020
263swamystock.comGoogle, Inc.6 Jun 201918 Jul 20256 Jun 2025
264swamysolutions.comGoogle, Inc.10 Jun 201927 May 202510 Jun 2026
265swamyhousekeepingservicesmumbai.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Jun 20191 Aug 202020 Jun 2020
266swamysudupiagraharam.comPSI-USA, Inc. dba Domain Robot28 Jun 201928 Aug 202428 Jun 2024
267swamytax.com-10 Oct 202111 Oct 202310 Oct 2024
268swamyslicpremiumpoint.comCrazy Domains FZ-LLC23 Aug 201923 Aug 201923 Aug 2020
269swamytraders.comHostinger, UAB17 Apr 202417 Apr 202417 Apr 2026
270swamybakery.comGoogle, Inc.22 Sep 201922 Sep 201922 Sep 2020
271swamyagency.comTucows Domains Inc.4 Oct 20194 Jun 20254 Oct 2025
272swamymahesh.comGoDaddy.com, LLC12 Oct 201912 Oct 201912 Oct 2020
273swamysbusiness.comGoDaddy.com, LLC13 Oct 201913 Oct 201913 Oct 2021
274swamybankers.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Oct 201923 Oct 201923 Oct 2020
275swamybuildingconstructions.comGoDaddy.com, LLC28 Oct 201928 Oct 201928 Oct 2020
276swamycreativephotostudio.comGoDaddy.com, LLC14 Nov 201914 Nov 201914 Nov 2020
277swamycompany.comGoogle, Inc.23 Nov 201923 Nov 201923 Nov 2020
278swamycreations.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Nov 201930 Nov 202230 Nov 2022
279swamytenthouse.comGoDaddy.com, LLC21 Dec 201921 Dec 201921 Dec 2020
280swamyexports.comGoogle, Inc.11 Mar 202424 Feb 202511 Mar 2026
281swamysmakeover.comGoDaddy.com, LLC27 Aug 202427 Aug 202427 Aug 2025
282swamysamarth.comGoDaddy.com, LLC15 Feb 202028 Apr 202415 Feb 2024
283swamysinsurancepoint.comHostinger, UAB17 Feb 202017 Feb 202017 Feb 2021
284swamywedding.comeNom, Inc.29 Feb 202029 Feb 202028 Feb 2021
285swamynarayanatheerth.comNameCheap, Inc.1 Mar 2020-1 Mar 2021
286swamysales.comGoDaddy.com, LLC16 Mar 202016 Mar 202016 Mar 2022
287swamyscales.comGoogle, Inc.30 Nov 202211 Jan 202530 Nov 2024
288swamynirgunachaitanya-natural-self-understanding.comWild West Domains, LLC25 Mar 20206 May 202325 Mar 2023
289swamydevikanand.comGoDaddy.com, LLC25 Mar 202025 Mar 202025 Mar 2022
290swamy-tv.comGoDaddy.com, LLC1 Apr 20201 Apr 20201 Apr 2021
291swamybami.comNameCheap, Inc.19 Apr 2020-19 Apr 2021
292swamyvivekanandayogawellnesscenter.comPDR Ltd. d/b/a PublicDomainRegistry.com11 May 202011 May 202011 May 2021
293swamyatom.comLaunchpad, Inc.23 May 202023 May 202023 May 2021
294swamyexpo.comGoDaddy.com, LLC2 Jun 202014 Jul 20252 Jun 2025
295swamysrinivasanursey.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Jun 202018 Jun 202018 Jun 2021
296swamyvilas.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Jun 202023 Jun 202525 Jun 2026
297swamysgroup.comGoDaddy.com, LLC29 Jun 202029 Jun 202029 Jun 2021
298swamycoir.comNameCheap, Inc.22 Dec 20232 Feb 202522 Dec 2024
299swamymedicalcourses.comWild West Domains, LLC14 Jul 202014 Jul 202014 Jul 2021
300swamyayyappaenterprises.comGoDaddy.com, LLC28 Jul 20208 Sep 202328 Jul 2023
301swamyluxuryrealty.comGoDaddy.com, LLC10 Aug 202017 Aug 202310 Aug 2025
302swamyfans.comGoDaddy.com, LLC12 Aug 202024 Oct 202312 Aug 2023
303swamycoconut.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Aug 202031 Aug 202031 Aug 2021
304swamysamartha.comDomainshype.com, Inc.5 Sep 20205 Sep 20205 Sep 2021
305swamyvideos.comGoDaddy.com, LLC7 Sep 20207 Sep 20207 Sep 2021
306swamysez.comChengdu West Dimension Digital Technology Co., Ltd…25 Sep 202025 Sep 202025 Sep 2021
307swamydeeksha.comGoDaddy.com, LLC29 Sep 202029 Sep 202029 Sep 2022
308swamytutor.comGoDaddy.com, LLC27 Oct 20208 Jan 202527 Oct 2024
309swamycbseschool.comGoogle, Inc.5 Nov 20205 Nov 20205 Nov 2021
310swamyribas.comGoDaddy.com, LLC8 Nov 20208 Nov 20208 Nov 2021
311swamy-musings.comFastDomain Inc.8 Nov 20208 Nov 20208 Nov 2021
312swamyssons.comInterNetworX Ltd. & Co. KG14 Mar 20251 Apr 202514 Mar 2028
313swamytanjorearts.comGoDaddy.com, LLC4 Dec 20204 Dec 20204 Dec 2022
314swamysays.com-24 Feb 202327 Apr 202424 Feb 2024
315swamydj.comGoDaddy.com, LLC28 Dec 202029 Dec 202428 Dec 2025
316swamyks.siteHostinger, UAB13 Jan 202113 Jan 202113 Jan 2022
317swamyaramjan.worldNimzo 98, LLC18 Jan 202118 Jan 202118 Jan 2022
318swamydthservices.comGoDaddy.com, LLC1 Feb 20211 Feb 20211 Feb 2022
319swamypoojastore.comGoDaddy.com, LLC27 Mar 20218 Apr 202327 Mar 2024
320swamyshop.comGoDaddy.com, LLC28 Mar 202129 Mar 202528 Mar 2027
321swamyrealitydevelopers.comGoDaddy.com, LLC14 Jul 20249 Jun 202514 Jul 2026
322swamydineshanand.comGoDaddy.com, LLC21 May 202122 May 202521 May 2026
323swamyvivekanandavidyamandir.infoGoogle, Inc.24 May 202124 May 202124 May 2022
324swamyr.infoGoDaddy.com, LLC13 Jun 202113 Jun 202113 Jun 2022
325swamyassociates.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Jul 200417 Jul 202119 Jul 2030
326swamyvivekanandaschool.netGoogle, Inc.19 Jun 202119 Jun 202119 Jun 2022
327swamys.netAmazon Registrar, Inc.22 Jun 202118 May 202522 Jun 2026
328swamydappu.comGoDaddy.com, LLC17 Jul 202117 Jul 202117 Jul 2022
329swamytimes.comXin Net Technology Corporation15 Oct 202319 Oct 202415 Oct 2025
330swamygardening.comGoDaddy.com, LLC31 Jul 202131 Jul 202131 Jul 2022
331swamyfilaments.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Aug 202119 Sep 20248 Aug 2024
332swamydraws.comNameCheap, Inc.9 Aug 202121 Oct 20239 Aug 2023
333swamyconsultants.comGoogle, Inc.13 Aug 202114 Aug 202313 Aug 2024
334swamyelectricals.comNameCheap, Inc.13 Aug 2021-13 Aug 2022
335swamyrajendersuritrust.comGoDaddy.com, LLC25 Aug 202125 Aug 202125 Aug 2022
336swamynursery.xyzNameCheap, Inc.8 Oct 20218 Oct 20218 Oct 2022
337swamyrajonlaw.comGoogle, Inc.25 Oct 202125 Oct 202125 Oct 2022
338swamycashflows.comHosting Concepts B.V. dba Openprovider28 Nov 202128 Nov 202128 Nov 2022
339swamyvijay.comGoDaddy.com, LLC10 Dec 202110 Dec 202110 Dec 2022
340swamyjiastro.comCrazy Domains FZ-LLC9 Dec 20217 Jan 20249 Dec 2023
341swamyworld.comNamesilo, LLC16 Dec 202117 Dec 202116 Dec 2022
342swamyandkumar.comDomainshype.com, Inc.14 Jan 202225 Feb 202514 Jan 2025
343swamyastrovastu.comGoDaddy.com, LLC16 Jan 20222 Apr 202516 Jan 2026
344swamytutorials.comGoDaddy.com, LLC24 Jan 20226 Apr 202424 Jan 2024
345swamyvadhuvara.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Mar 202224 Mar 202524 Mar 2026
346swamymedicalandgeneralstores.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Apr 20226 Jun 202325 Apr 2023
347swamyvivekanandacoph.comNameCheap, Inc.28 Apr 202229 Apr 202428 Apr 2025
348swamyvivekanandasonsg.comNameCheap, Inc.28 Apr 202229 Apr 202428 Apr 2025
349swamysconsultancyservices.comregister.com, Inc.30 Apr 202212 Jun 202430 Apr 2024
350swamyrecording.comGoogle, Inc.6 May 20227 May 20236 May 2024
351swamyguru.comGoDaddy.com, LLC3 Jun 202215 Aug 20233 Jun 2023
352swamypillai.comGoDaddy.com, LLC5 May 20231 May 20255 May 2026
353swamys.in-4 Jun 20156 Jun 20244 Jun 2027
354swamyfood.comGoDaddy.com, LLC23 Aug 201729 Aug 202423 Aug 2025
355swamyvivekanandasociety.orgGoDaddy.com, LLC29 Jun 202210 Aug 202429 Jun 2024
356swamyjewellery.comGoDaddy.com, LLC21 Apr 202118 Apr 202521 Apr 2026
357swamymatrimony.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Jul 202214 Jul 202214 Jul 2023
358swamyfoods.comGoDaddy.com, LLC17 Jul 202218 Jul 202517 Jul 2026
359swamykoragajjaaadisthalakuthar.comRealtime Register B.V.25 Jul 202229 Jun 202525 Jul 2026
360swamygarden.comGoDaddy.com, LLC3 Aug 202215 Oct 20233 Aug 2023
361swamyshree.comGoogle, Inc.9 Aug 20228 Aug 20249 Aug 2025
362swamyiyer.comGoDaddy.com, LLC9 Aug 202210 Aug 20249 Aug 2026
363swamyveekeyen.comGoDaddy.com, LLC23 Aug 20224 Oct 202423 Aug 2024
364swamyanna.xyzGoDaddy.com, LLC3 Sep 202214 Nov 20233 Sep 2023
365swamysaranamayyappa.netAmazon Registrar, Inc.4 Sep 20221 Aug 20244 Sep 2025
366swamyveera.comNameCheap, Inc.8 Sep 202220 Nov 20238 Sep 2023
367swamydata.comTucows Domains Inc.15 Sep 202019 Sep 202215 Sep 2023
368swamykoragajjaaadisthalakuthar.orgHosting Concepts B.V. dba Openprovider21 Sep 202210 Jul 202521 Sep 2025
369swamycaffe.comWix.com Ltd.6 Oct 202010 Oct 20226 Oct 2022
370swamypro.xyzGoDaddy.com, LLC26 Nov 202227 Nov 202326 Nov 2024
371swamylogistic.comAbove.com Pty Ltd.25 Nov 20224 Feb 202425 Nov 2023
372swamyarts.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Dec 20229 Jan 20254 Dec 2025
373swamymarketing.comGoDaddy.com, LLC10 Dec 202221 Feb 202510 Dec 2024
374swamysquare.comGoDaddy.com, LLC12 Jan 202326 Mar 202512 Jan 2025
375swamydosa.comGoDaddy.com, LLC23 Jan 20234 Mar 202423 Jan 2024
376swamykrishna.inGoDaddy.com, LLC17 Jun 20221 Jun 202517 Jun 2027
377swamy2024.comGoDaddy.com, LLC24 Feb 20237 May 202424 Feb 2024
378swamyhomes.comNamesilo, LLC30 Oct 201731 Oct 202430 Oct 2025
379swamyrealtygroup.comNamesilo, LLC30 Oct 201731 Oct 202430 Oct 2025
380swamyandassociates.comGoDaddy.com, LLC24 Jan 202225 Jan 202224 Jan 2023
381swamyramanandaji.comDynadot, LLC3 Mar 20234 Mar 20253 Mar 2026
382swamystores.comGoDaddy.com, LLC4 Jan 201815 Feb 20234 Jan 2023
383swamysynthetics.comWild West Domains, LLC22 Jan 20183 Feb 202522 Jan 2026
384swamyenterprise.comGoDaddy.com, LLC1 May 201829 Apr 20241 May 2026
385swamycoinfo.comGoogle, Inc.13 Mar 202314 Mar 202413 Mar 2025
386swamynarayan.infoGoDaddy.com, LLC19 Mar 202330 Apr 202419 Mar 2024
387swamynarayan.onlineGoDaddy.com, LLC19 Mar 202330 Apr 202419 Mar 2024
388swamynarayan.comGoDaddy.com, LLC19 Mar 202319 Mar 202319 Mar 2026
389swamyshoppe.comGoDaddy.com, LLC28 Mar 202129 Mar 202528 Mar 2027
390swamydeveloper.comName.com, Inc.28 Mar 202325 Feb 202528 Mar 2026
391swamytravel.comGoDaddy.com, LLC28 Mar 202331 Mar 202428 Mar 2026
392swamyjagilinki.comGoDaddy.com, LLC29 Mar 202310 May 202429 Mar 2024
393swamychikkudu.clickMat Bao Trading & Service Company Limited d/b/a Ma…2 Apr 202313 May 20242 Apr 2024
394swamysilkhouse.comGoDaddy.com, LLC2 Apr 20232 Apr 20232 Apr 2026
395swamygliders.comName.com, Inc.9 Apr 202329 Apr 20259 Apr 2026
396swamysagro.comGoDaddy.com, LLC15 Feb 202228 Apr 202415 Feb 2024
397swamysriperumbudur.orgGoogle, Inc.12 Apr 202312 Apr 202412 Apr 2025
398swamysriperumbudur.comGoogle, Inc.12 Apr 202312 Apr 202412 Apr 2025
399swamyvivekanandaconsg.comNameCheap, Inc.28 Apr 20225 Jun 202528 Apr 2026
400swamybhai.comGoDaddy.com, LLC23 May 20223 Jul 202423 May 2024
401swamydayanandschools.comGoDaddy.com, LLC4 Jun 202216 Jul 20244 Jun 2024
402swamybooks.comGoDaddy.com, LLC13 Jun 202214 Sep 202213 Jun 2027
403swamyslecturesonlaw.comWix.com Ltd.20 Jun 202222 May 202520 Jun 2026
404swamyanalysis.comGoDaddy.com, LLC25 Jun 20226 Sep 202325 Jun 2023
405swamyvenkateswara.comGoDaddy.com, LLC29 Jun 202210 Sep 202329 Jun 2023
406swamybatteries.comWild West Domains, LLC7 Jul 202218 Sep 20237 Jul 2023
407swamyaddala.comGoogle, Inc.16 Jul 202216 Jul 202516 Jul 2026
408swamyoil.in-6 Sep 201114 Feb 20246 Sep 2027
409swamyayyappatravels.inGoDaddy.com, LLC13 Mar 20181 Jun 202513 Mar 2026
410swamysaranam.inAscio Technologies, Inc. Danmark - Filial af Ascio…6 Apr 201729 May 20256 Apr 2026
411swamys.co.in-30 Nov 20246 Jun 202530 Nov 2025
412swamykoragajja.comHostinger, UAB16 Apr 202317 Apr 202416 Apr 2025
413swamyschool.in-31 Mar 20112 Mar 202531 Mar 2031
414swamynirgunachaitanya-natural-self-understanding.in-25 Mar 20203 Jun 202525 Mar 2025
415swamyworld.inTucows Domains Inc.17 Dec 202115 Dec 202417 Dec 2025
416swamykennel.it-6 Sep 201222 Sep 20246 Sep 2025
417swamyadvertisement.comGoDaddy.com, LLC11 Jul 202416 Jul 202511 Jul 2026
418swamys.orgGoogle, Inc.2 Apr 202117 Jul 20252 Apr 2026
419swamysmatric.orgPDR Ltd. d/b/a PublicDomainRegistry.com13 Mar 201824 Apr 202313 Mar 2023
420swamysamarthamaharajdubaka.orgNetwork Solutions, LLC17 Sep 202017 Sep 202417 Sep 2026
421swamyvivekanandayoga.orgGoDaddy.com, LLC20 Oct 202031 Dec 202320 Oct 2023
422swamystrust.orgPDR Ltd. d/b/a PublicDomainRegistry.com19 Jan 202128 May 202119 Jan 2026
423swamyyoganandha.orgGoDaddy.com, LLC28 Jul 20212 Aug 202528 Jul 2026
424swamyandswamy.orgWild West Domains, LLC7 Aug 20217 Dec 20247 Aug 2025
425swamycloudsolution.co.uk-12 Nov 202013 Nov 202412 Nov 2026
426swamyfilmzs.comGoDaddy.com, LLC10 Jul 202321 Sep 202410 Jul 2024
427swamycateringandtours.comGoDaddy.com, LLC20 Jul 202331 Aug 202420 Jul 2024
428swamyra.comDynadot, LLC18 Aug 202328 Oct 202418 Aug 2024
429swamyvaleti.onlineNameCheap, Inc.18 Aug 202329 Oct 202418 Aug 2024
430swamyzelar.storeNameCheap, Inc.18 Aug 202329 Oct 202418 Aug 2024
431swamyforpres.comGoDaddy.com, LLC19 Aug 202331 Oct 202419 Aug 2024
432swamyforpresident.comGoDaddy.com, LLC19 Aug 202331 Oct 202419 Aug 2024
433swamyforprez.comGoDaddy.com, LLC19 Aug 202331 Oct 202419 Aug 2024
434swamy47.comGoDaddy.com, LLC23 Aug 202324 Aug 202423 Aug 2025
435swamy24.comGoDaddy.com, LLC23 Aug 202324 Aug 202423 Aug 2025
436swamysays2024.comGoDaddy.com, LLC25 Aug 20234 Sep 202425 Aug 2025
437swamysays24.comGoDaddy.com, LLC25 Aug 20234 Sep 202425 Aug 2025
438swamyrajvibhu.comGoDaddy.com, LLC27 Aug 202327 Aug 202327 Aug 2028
439swamydevops.onlineHostinger, UAB9 Sep 202323 Oct 20249 Sep 2024
440swamyshotfoods.com1API GmbH10 Sep 202324 Nov 202410 Sep 2024
441swamytherealtor.comGoDaddy.com, LLC11 Feb 202511 Feb 202511 Feb 2026
442swamyopticians.comAutomattic Inc.21 Oct 20233 Dec 202421 Oct 2024
443swamygpt.comPorkbun, LLC23 Nov 202323 Nov 202423 Nov 2025
444swamyandkumarlaw.comGoDaddy.com, LLC22 Jan 20245 Mar 202522 Jan 2025
445swamydevops.cloudHostinger, UAB25 Jan 20249 Mar 202525 Jan 2025
446swamysschool.in-23 Aug 201712 Jan 202223 Aug 2027
447swamysons.inGoDaddy.com, LLC23 Oct 20202 Jun 202523 Oct 2025
448swamydiet.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Mar 202417 Apr 20256 Mar 2025
449swamyfurnitureenterprisesmobiles.orgPDR Ltd. d/b/a PublicDomainRegistry.com7 Mar 202418 Apr 20257 Mar 2025
450swamychaiwala.comName.com, Inc.7 Mar 202419 Apr 20257 Mar 2025
451swamyvivekanandafoundationtrust.comGoDaddy.com, LLC19 Mar 202430 Apr 202519 Mar 2025
452swamyonlinematka.onlineHostinger, UAB22 Mar 20245 May 202522 Mar 2025
453swamypodila.inTucows Domains Inc.25 Oct 20186 Jun 202525 Oct 2025
454swamyayyapahardware.shopHostinger, UAB1 Nov 202315 Dec 20241 Nov 2024
455swamyengineering.inGoDaddy.com, LLC19 Aug 20212 Jun 202519 Aug 2025
456swamyskycleaning.comWix.com Ltd.12 Apr 202414 Apr 202412 Apr 2026
457swamydental.comHostinger, UAB16 Apr 202430 May 202516 Apr 2025
458swamytherealtor.netGoDaddy.com, LLC19 Apr 202419 Apr 202419 Apr 2029
459swamynune.comCloudFlare, Inc.2 May 20242 May 20252 May 2025
460swamypackaging.comHostinger, UAB10 May 202423 Jun 202510 May 2025
461swamys.schoolNameCheap, Inc.18 May 20241 Apr 202518 May 2030
462swamysriirajvibhu.comGoDaddy.com, LLC27 May 202419 Aug 202427 May 2027
463swamyadvocates.comGoDaddy.com, LLC30 May 202430 May 202430 May 2027
464swamynathanrk.comWix.com Ltd.30 May 20241 May 202530 May 2026
465swamyexport.comGoogle, Inc.1 Jun 202413 Jul 20251 Jun 2025
466swamyvivekanandahighschool.comInterNetworX Ltd. & Co. KG5 Jun 202420 Jun 20255 Jun 2025
467swamyprecision.comBigRock Solutions Ltd.14 Jun 202414 Jun 202414 Jun 2034
468swamywellpharma.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Jun 202430 Jul 202518 Jun 2025
469swamyacademy.comGoDaddy.com, LLC18 Jun 202411 Jun 202518 Jun 2026
470swamy2028.comGoDaddy.com, LLC3 Jul 20244 Jul 20253 Jul 2026
471swamyshadow.comHostinger, UAB29 Jul 202418 May 202529 Jul 2026
472swamylaw.comHostinger, UAB3 Aug 20243 Oct 20243 Aug 2025
473swamytamilictaurid.sbsNameCheap, Inc.8 Oct 20244 Jul 20258 Oct 2025
474swamyfamily.ca-29 Feb 201615 Apr 20251 Mar 2026
475swamyvisasolutions.comWix.com Ltd.8 Oct 20248 Oct 20248 Oct 2025
476swamycares.comGoDaddy.com, LLC14 Oct 202414 Oct 202414 Oct 2027
477swamytalkeetapul.sbsNameCheap, Inc.21 Oct 202429 Jan 202521 Oct 2025
478swamymudigacloud.meNameCheap, Inc.25 Oct 202430 Oct 202425 Oct 2025
479swamysutram.comGoDaddy.com, LLC6 Nov 20246 Nov 20246 Nov 2027
480swamyvivekanandhaschool.comNameCheap, Inc.13 Nov 202413 Nov 202413 Nov 2025
481swamyandcompany.comGoDaddy.com, LLC18 Nov 202418 Nov 202418 Nov 2029
482swamyamvarmarriagebureau.comGoDaddy.com, LLC18 Nov 202418 Nov 202418 Nov 2025
483swamyrealestate.comGoDaddy.com, LLC20 Nov 202420 Nov 202420 Nov 2025
484swamyswarmytarre.artNameCheap, Inc.29 Nov 20246 Dec 202429 Nov 2025
485swamyayyappan.orgGoDaddy.com, LLC30 Nov 20245 Dec 202430 Nov 2025
486swamystudios.comGoDaddy.com, LLC16 Dec 202416 Dec 202416 Dec 2034
487swamyfleet.comGoDaddy.com, LLC16 Dec 202416 Dec 202416 Dec 2027
488swamymarmo.comGoDaddy.com, LLC28 Dec 202428 Dec 202428 Dec 2027
489swamydigital.in-31 Dec 202429 May 202531 Dec 2025
490swamysidlitiffin.comGoDaddy.com, LLC5 Jan 202520 Jun 20255 Jan 2027
491swamyy.devHosting Concepts B.V. dba Openprovider22 Dec 202410 Jan 202522 Dec 2025
492swamyrobleto.siteGoDaddy.com, LLC8 Jan 202521 Feb 20258 Jan 2026
493swamyambulancehassan.inHostinger, UAB23 Feb 202511 Mar 202523 Feb 2026
494swamymurugappa.comInterNetworX Ltd. & Co. KG7 Mar 20251 Apr 20257 Mar 2027
495swamyvivekanandacollege.comInterNetworX Ltd. & Co. KG11 Mar 20251 Apr 202511 Mar 2026
496swamyvivekanandainstitute.comInterNetworX Ltd. & Co. KG11 Mar 20251 Apr 202511 Mar 2026
497swamycharitabletrust.orgTucows Domains Inc.12 Apr 202517 Apr 202512 Apr 2026
498swamydigitalconsulting.comGoDaddy.com, LLC18 Apr 202518 Apr 202518 Apr 2028
499swamyas.comHostinger, UAB19 Apr 202516 May 202519 Apr 2026
500swamykamaleshmaharaj.comGoDaddy.com, LLC19 Apr 202519 Apr 202519 Apr 2026
501swamylytics.comGoDaddy.com, LLC23 Apr 202523 Apr 202523 Apr 2028
502swamygroceries.comGoDaddy.com, LLC28 Apr 202528 Apr 202528 Apr 2026
503swamyoverhaulings.comGoogle, Inc.5 May 20256 May 20255 May 2026
504swamyinfo.xyzGoDaddy.com, LLC6 May 202524 Jun 20256 May 2026
505swamyas.xyzHostinger, UAB15 May 202520 May 202515 May 2026
506swamykorma.comURL Solutions, Inc.16 May 202516 May 202516 May 2026
507swamyinteriorshyd.comHostinger, UAB17 May 202517 Jul 202517 May 2026
508swamyk.xyzNameCheap, Inc.27 May 20251 Jul 202527 May 2026
509swamyvarialayam.orgHostinger, UAB5 Jun 202510 Jun 20255 Jun 2026
510swamyacademy.infoGoDaddy.com, LLC11 Jun 202511 Jun 202511 Jun 2026
511swamycomputer.xyzHostinger, UAB14 Jun 202514 Jun 202514 Jun 2026
512swamy-p.xyzNameCheap, Inc.21 Jun 202521 Jun 202521 Jun 2026
513swamyventures.comGoDaddy.com, LLC27 Jun 202527 Jun 202527 Jun 2026
514swamy2book.comNordreg AB30 Jun 202530 Jun 202530 Jun 2026
515swamy4book.comHostinger, UAB30 Jun 202530 Jun 202530 Jun 2026
516swamymart.comGoDaddy.com, LLC16 Jul 202516 Jul 202516 Jul 2026
517swamyvivekanandapms.comGoDaddy.com, LLC31 Jul 202531 Jul 202531 Jul 2026
518swamyni.comHostinger, UAB8 Aug 20258 Aug 20258 Aug 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=swamy

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now