Our database now contains whois records of 688 Million (688,282,433) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1596 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [688 Million Domains] $10,000 Details

Keyword: STEPHY

Reverse Whois » KEYWORD [stephy ]  { 996 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1stephy.loveChengdu West Dimension Digital Technology Co., Ltd…31 Jul 2015-31 Jul 2016
2stephy.comDomain.com, LLC15 Dec 199724 Nov 202514 Dec 2026
3stephy.plusGoDaddy.com, LLC6 Jun 20166 Jan 20176 Jun 2018
4stephy.linkGandi SAS11 May 20148 May 201711 May 2018
5stephy.us-1 Sep 20161 Sep 201631 Aug 2017
6stephy.bizGMO Internet Inc.16 Sep 201619 Sep 201615 Sep 2017
7stephy.netDomain.com, LLC14 Dec 199924 Nov 202514 Dec 2026
8stephy.org-23 Jun 202528 Jun 202523 Jun 2026
9stephy.winALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED3 Dec 201620 Oct 20252 Dec 2026
10stephy.kimNameCheap, Inc.24 Mar 201723 May 201724 Mar 2018
11stephy.onlineLimited Liability Company "Registrar of domain nam…10 Feb 202615 Feb 202610 Feb 2027
12stephy.de--10 Apr 2015-
13stephy.infoNameCheap, Inc.5 Feb 202419 Mar 20255 Feb 2025
14stephy.todayeNom, Inc.18 Jan 201819 Jan 202618 Jan 2027
15stephy.wtfGoDaddy.com, LLC2 Jun 20182 Jun 20182 Jun 2019
16stephy.clubNameCheap, Inc.9 Jul 20189 Jul 20189 Jul 2019
17stephy.asiaCrazy Domains FZ-LLC26 Mar 200811 Jan 202626 Mar 2027
18stephy.icuNameCheap, Inc.17 Sep 202017 Sep 202017 Sep 2021
19stephy.coCrazy Domains FZ-LLC22 Apr 201530 Mar 202521 Apr 2029
20stephy.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…18 Mar 202618 Mar 202618 Mar 2027
21stephy.proAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…30 Jan 20262 Mar 202630 Jan 2027
22stephy.app1&1 Internet AG9 Aug 20218 Oct 20259 Aug 2026
23stephy.beOVH sas13 Jun 2019--
24stephy.storeCommuniGal Communication Ltd.12 Apr 202425 May 202512 Apr 2025
25stephy.dev1&1 Internet AG9 Aug 20218 Oct 20259 Aug 2026
26stephy.inGoDaddy.com, LLC14 Apr 201731 May 202514 Apr 2027
27stephy.it-30 Jan 200119 Aug 20253 Aug 2026
28stephy.techNameCheap, Inc.18 Sep 20231 Sep 202518 Sep 2026
29stephy.siteHostinger, UAB21 Dec 20243 Feb 202621 Dec 2025
30stephy.co.uk-2 Mar 20253 Mar 20262 Mar 2027
31stephy.emailDNSPod, Inc.11 May 2025-11 May 2026
32stephy.gay-7 Jul 202512 Jul 20257 Jul 2026
33stephy.caDomain.com, LLC29 Feb 20207 Mar 20261 Mar 2027
34stephy.vipGoDaddy.com, LLC16 Nov 202515 Jan 202616 Nov 2026
35stephy.nl-9 Jan 2026--
36stephy.ru-10 Feb 2026-10 Feb 2027
37stephy.coachGoogle, Inc.23 Mar 202623 Mar 202623 Mar 2027
38stephy.cl-22 Mar 2026-22 Mar 2027
39stephyprod.comGandi SAS16 Jul 199916 Jun 202516 Jul 2026
40stephytracking.com1&1 Internet AG5 May 20107 Feb 20265 May 2026
41stephys-abbigliamento.infoRegister.it SPA20 Oct 2014-20 Oct 2015
42stephytrackingonline.com1&1 Internet AG26 Aug 20117 Feb 202626 Aug 2026
43stephymavididi.com1&1 Internet AG15 May 202426 Jun 202515 May 2025
44stephys.comPorkbun, LLC2 Apr 20262 Apr 20262 Apr 2027
45stephygoldberg.comGoogle, Inc.10 Mar 202521 Apr 202610 Mar 2026
46stephyautos.comTucows Domains Inc.4 Nov 20148 Nov 20154 Nov 2016
47stephyjeff.comName.com, Inc.5 Nov 20145 Nov 20145 Nov 2015
48stephydog.comOnline SAS20 Aug 201420 Aug 201420 Aug 2015
49stephywang.comBeijing Lanhai Jiye Technology Co., Ltd7 Apr 20218 Apr 20237 Apr 2024
50stephybytes.comFastDomain Inc.5 Oct 20166 Nov 20175 Oct 2017
51stephydenk.comGoDaddy.com, LLC15 Aug 201415 Aug 201415 Aug 2016
52stephyssecrets.comOVH sas11 Nov 201411 Nov 201411 Nov 2015
53stephydesigns.comCloudFlare, Inc.23 Jul 20215 Jul 202523 Jul 2026
54stephyscraps.comGoDaddy.com, LLC13 Sep 201413 Sep 201413 Sep 2015
55stephysfashionboutique.comHosting Concepts B.V. dba Openprovider31 Aug 201431 Aug 201431 Aug 2015
56stephyeisley.netNetwork Solutions, LLC15 Sep 201418 Mar 202615 Sep 2027
57stephyeisley.comNetwork Solutions, LLC15 Sep 201418 Mar 202615 Sep 2027
58stephyyates.comDomain.com, LLC27 Dec 20117 Dec 202527 Dec 2026
59stephyrs.comGoDaddy.com, LLC3 Jun 202217 Jun 20243 Jun 2025
60stephymichelle.comLaunchpad, Inc.8 Sep 20148 Sep 20148 Sep 2015
61stephykantu.comWix.com Ltd.5 May 20265 May 20265 May 2027
62stephysboutiquedealquiler.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Sep 201411 Oct 201723 Sep 2018
63stephynutrition.comName.com, Inc.27 Sep 201428 Sep 201427 Sep 2015
64stephybeck.comTucows Domains Inc.24 Sep 20145 Sep 202524 Sep 2027
65stephycloud.comDomain.com, LLC8 Oct 201418 Sep 20258 Oct 2026
66stephycloud.netDomain.com, LLC8 Oct 201418 Sep 20258 Oct 2026
67stephytrackingcloud.comDomain.com, LLC8 Oct 201418 Sep 20258 Oct 2026
68stephytrackingcloud.netDomain.com, LLC8 Oct 201418 Sep 20258 Oct 2026
69stephyjo.comGoDaddy.com, LLC11 May 202321 May 202511 May 2026
70stephyhi.comXin Net Technology Corporation11 Oct 201411 Oct 201411 Oct 2015
71stephyauto.comGoDaddy.com, LLC25 Feb 202526 Feb 202625 Feb 2027
72stephypoppins.comregister.com, Inc.13 Oct 201413 Oct 201413 Oct 2015
73stephysantiagomakeup.comTucows Domains Inc.2 Dec 20146 Dec 20172 Dec 2017
74stephytv.comDropCatch.com 1186 LLC3 Mar 20183 Mar 20183 Mar 2019
75stephyjohnson.comGoDaddy.com, LLC17 Dec 201410 Dec 202517 Dec 2026
76stephygonzales.comXin Net Technology Corporation17 Mar 201817 Mar 201817 Mar 2019
77stephyandkevin.comAscio Technologies, Inc. Danmark - Filial af Ascio…29 Dec 201429 Dec 201429 Dec 2015
78stephycaballero.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2016
79stephymay.comGoDaddy.com, LLC12 Aug 201512 Aug 201512 Aug 2020
80stephyandmatty.comWild West Domains, LLC14 Aug 201514 Aug 201514 Aug 2016
81stephyyue.comHiChina Zhicheng Technology Limited24 Mar 201824 Mar 201824 Mar 2019
82stephyhor96.comeNom, Inc.12 Jan 201512 Jan 201712 Jan 2018
83stephysinparis.comOVH sas20 Jul 201920 Jul 201920 Jul 2020
84stephyyoung.comChengdu West Dimension Digital Technology Co., Ltd…8 Apr 20198 Apr 20198 Apr 2020
85stephysantos.comDropCatch.com 385 LLC21 Jan 201522 Jan 201721 Jan 2018
86stephyin.comGMO Internet Inc.4 Jul 202414 Aug 20254 Jul 2025
87stephyudesign.comeNom, Inc.3 Feb 20153 Feb 20153 Feb 2016
88stephysmodel.comRegister NV dba Register.eu3 Feb 20153 Feb 20153 Feb 2016
89stephys.orgNetwork Solutions, LLC3 Feb 20153 Feb 20153 Feb 2017
90stephyaklin.comDreamHost, LLC5 Feb 20155 Feb 20155 Feb 2016
91stephydrogen-water.netGMO Internet Inc.6 Feb 20156 Feb 20156 Feb 2016
92stephycox.comXin Net Technology Corporation6 May 20186 May 20186 May 2019
93stephykroon.comKey-Systems GmbH14 Feb 201512 Feb 202614 Feb 2026
94stephyxu.comCrazy Domains FZ-LLC17 Feb 201525 Mar 202517 Feb 2030
95stephysweetbakes.comBeijing Lanhai Jiye Technology Co., Ltd22 May 202525 Mar 202622 May 2026
96stephyniabray.comeNom, Inc.23 Feb 201523 Feb 201523 Feb 2016
97stephyfans.comGlamDomains LLC14 Dec 202114 Dec 202114 Dec 2022
98stephy-scott.comHiChina Zhicheng Technology Limited29 Mar 201829 Mar 201829 Mar 2019
99stephyenjthomas3.com----
100stephyniasellshomes.comGoDaddy.com, LLC12 Mar 201512 Mar 201512 Mar 2016
101stephyssweets.comGoDaddy.com, LLC13 Mar 201513 Mar 201513 Mar 2017
102stephyscott.comGoDaddy.com, LLC12 Jan 201213 Jan 202612 Jan 2028
103stephyschuster.comRegistryGate GmbH20 Mar 201521 Mar 202620 Mar 2027
104stephyart.comPSI-USA, Inc. dba Domain Robot30 Mar 201530 Mar 201530 Mar 2016
105stephyprettystyle.comGoDaddy.com, LLC1 Apr 20151 Apr 20151 Apr 2016
106stephyia.com----
107stephysalazar.comGoDaddy.com, LLC2 Sep 20152 Sep 20152 Sep 2016
108stephynails.comeNom, Inc.3 Sep 201529 Aug 20163 Sep 2017
109stephykantumusic.comNetwork Solutions, LLC3 Sep 20153 Sep 20153 Sep 2016
110stephyshouse.comGoDaddy.com, LLC16 Sep 202228 Nov 202316 Sep 2023
111stephygames.net1&1 Internet AG12 Apr 201512 Apr 201512 Apr 2016
112stephydraws.comNetwork Solutions, LLC4 Sep 20154 Sep 20154 Sep 2017
113stephycakes.comGoDaddy.com, LLC2 Mar 20213 Mar 20262 Mar 2027
114stephysstuff.comTucows Domains Inc.20 Apr 201520 Apr 201520 Apr 2017
115stephyt.comGoDaddy.com, LLC24 Apr 201524 Apr 201524 Apr 2016
116stephyngmakeup.comTucows Domains Inc.18 Feb 20183 Feb 202618 Feb 2027
117stephybernstein.comWix.com Ltd.24 Aug 20224 Oct 202524 Aug 2025
118stephyfashionhouse.comBizcn.com, Inc.25 Apr 20142 May 201525 Apr 2016
119stephysstore.comTucows Domains Inc.16 Jan 202220 Jan 202316 Jan 2024
120stephyska.com-13 Sep 201513 Sep 201513 Sep 2017
121stephydrogen-water.infoGMO Internet Inc.29 May 20159 Jul 201729 May 2018
122stephyb.comWix.com Ltd.13 Aug 202413 Aug 202413 Aug 2027
123stephyshaircare.comregister.com, Inc.11 Jun 201511 Jun 201511 Jun 2016
124stephychooi.com! #1 Host China, Inc.27 Nov 201728 Nov 201727 Nov 2018
125stephysplace.com1&1 Internet AG23 Jun 201521 Mar 201823 Jun 2026
126stephydanilo.comTucows Domains Inc.24 Jun 201524 Jun 201524 Jun 2017
127stephysplace.org1&1 Internet AG23 Jun 20157 Aug 202523 Jun 2026
128stephysteffi.comeNom, Inc.26 Jun 201529 Jun 201726 Jun 2017
129stephyourgameup.comGoDaddy.com, LLC3 Nov 201815 Jan 20253 Nov 2024
130stephyu.comGoDaddy.com, LLC23 Sep 201510 Nov 202523 Sep 2026
131stephyindustries.comHosting Concepts B.V. dba Openprovider19 Dec 201719 Dec 201719 Dec 2018
132stephysjourney.comGoDaddy.com, LLC2 Jul 20152 Jul 20152 Jul 2016
133stephyandvic.comeNom, Inc.25 Sep 201525 Sep 201525 Sep 2016
134stephysmaids.comTucows Domains Inc.7 Jul 20157 Jul 20157 Jul 2017
135stephyprice.comGoDaddy.com, LLC17 Jul 201518 Jul 202517 Jul 2026
136stephyonthego.comWild West Domains, LLC17 Jul 201517 Jul 201517 Jul 2016
137stephyjpeg.comGoDaddy.com, LLC20 Jul 201520 Jul 201520 Jul 2018
138stephylyncoaching.comGoDaddy.com, LLC29 Jul 201529 Jul 201929 Jul 2021
139stephygirlmusic.comGoogle, Inc.1 Oct 20151 Oct 20161 Oct 2017
140stephyprofitt.comDomain.com, LLC12 Jan 201713 Jan 201812 Jan 2019
141stephymathew.comGoDaddy.com, LLC2 Oct 20153 Oct 20252 Oct 2027
142stephyleebakes.comTucows Domains Inc.6 Oct 201510 Oct 20176 Oct 2017
143stephyshouse.orgGoDaddy.com, LLC18 Oct 20152 Dec 202518 Oct 2026
144stephyhome.comBeijing Lanhai Jiye Technology Co., Ltd19 Oct 20153 Mar 202619 Oct 2026
145stephyourchef.comGoDaddy.com, LLC19 Oct 201530 Nov 202519 Oct 2025
146stephybigi.comTucows Domains Inc.23 Oct 201522 Oct 202523 Oct 2026
147stephykeung.comGoDaddy.com, LLC27 Oct 201527 Oct 201527 Oct 2017
148stephywrites4u.xyzHostinger, UAB27 Oct 201527 Oct 201527 Oct 2016
149stephysride.comGoDaddy.com, LLC2 Nov 20152 Nov 20152 Nov 2016
150stephycavalcanti.comFree Dive Domains, LLC22 Nov 201922 Nov 201922 Nov 2020
151stephyscreations.comGoDaddy.com, LLC21 May 202421 May 202521 May 2026
152stephywong.comGoDaddy.com, LLC19 Nov 201519 Nov 202519 Nov 2027
153stephywongphotography.comGoDaddy.com, LLC20 Nov 201520 Nov 202520 Nov 2027
154stephyselect.comGoDaddy.com, LLC23 Nov 201523 Nov 201523 Nov 2020
155stephyoscar.comGoDaddy.com, LLC27 Nov 201527 Nov 201527 Nov 2016
156stephys3dlashes.comGoDaddy.com, LLC2 Dec 20152 Dec 20152 Dec 2016
157stephystrange.comGoDaddy.com, LLC5 Dec 20155 Dec 20155 Dec 2017
158stephycreation.comTucows Domains Inc.2 Dec 20096 Dec 20152 Dec 2016
159stephyxv.com1API GmbH18 Oct 20157 Dec 201518 Oct 2017
160stephyphilipp.comGoDaddy.com, LLC16 Dec 201516 Dec 201516 Dec 2016
161stephym.comWebfusion Ltd.30 May 201731 May 202530 May 2027
162stephylife-here.comNamesilo, LLC11 Jan 201619 Aug 201711 Jan 2018
163stephyourface.comNameCheap, Inc.17 Jan 201917 Jan 201917 Jan 2020
164stephymodel.comGoDaddy.com, LLC18 Jan 201618 Jan 201618 Jan 2017
165stephyscope.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Jan 201619 Jan 201619 Jan 2017
166stephyharmononline.comGoDaddy.com, LLC19 Jan 201619 Jan 201619 Jan 2017
167stephy111.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Jan 201627 Jan 201627 Jan 2017
168stephyperea.comTucows Domains Inc.29 Jan 201631 Jan 202629 Jan 2027
169stephyeverafter.comWild West Domains, LLC3 Feb 20164 Jan 20263 Feb 2027
170stephyknx.comGandi SAS3 Feb 20163 Feb 20163 Feb 2017
171stephyslothsells.infoGoDaddy.com, LLC7 Feb 2016-7 Feb 2017
172stephymagney.comAscio Technologies, Inc. Danmark - Filial af Ascio…11 Feb 201621 Jun 201711 Feb 2018
173stephy-mike.comNeubox Internet S.A. de C.V.15 Feb 201615 Feb 201615 Feb 2017
174stephydeecouture.comNetwork Solutions, LLC16 Sep 202329 Oct 202416 Sep 2024
175stephybeecreativesweets.comTucows Domains Inc.11 Mar 201214 Mar 201610 Mar 2017
176stephyscolaro.comeNom, Inc.20 Mar 201620 Mar 201620 Mar 2017
177stephyyycreations.comFetch Registrar, LLC13 Jun 201714 Jun 201713 Jun 2018
178stephyrland.comregister.com, Inc.27 Mar 201627 Mar 201627 Mar 2017
179stephylately.comNameCheap, Inc.2 Sep 202512 Sep 20252 Sep 2026
180stephycalderon.comTucows Domains Inc.7 Apr 201611 Apr 20187 Apr 2018
181stephyharmonim.comGoDaddy.com, LLC9 Apr 20169 Apr 20169 Apr 2018
182stephyryanwedding.comTucows Domains Inc.10 Apr 201621 Jun 202310 Apr 2023
183stephygetsudolled.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Apr 201610 Apr 201610 Apr 2017
184stephybakes.comGoDaddy.com, LLC18 Jul 202322 Jul 202518 Jul 2026
185stephyblog.comKey-Systems GmbH5 May 20165 May 20165 May 2017
186stephykk.comTucows Domains Inc.29 Sep 20229 Nov 202329 Sep 2023
187stephysart.netGoDaddy.com, LLC2 Jun 20162 Jun 20162 Jun 2017
188stephysart.infoGoDaddy.com, LLC2 Jun 20162 Jun 20162 Jun 2017
189stephysart.comGoDaddy.com, LLC2 Jun 20162 Jun 20162 Jun 2017
190stephythomas.comSquarespace Domains LLC9 Mar 20269 Mar 20269 Mar 2027
191stephysbags.comNetwork Solutions, LLC22 Jun 201620 Jun 201722 Jun 2018
192stephyorke.com-6 Jul 20166 Jul 20166 Jul 2017
193stephygalvani.comTucows Domains Inc.6 Jul 20161 Feb 20266 Jul 2026
194stephybeautybyyounique.comGoDaddy.com, LLC14 Jul 201614 Jul 201614 Jul 2017
195stephyc.comGMO Internet Inc.7 Mar 20267 Mar 20267 Mar 2027
196stephybharmon.com-8 Aug 20168 Aug 20168 Aug 2017
197stephysstoryinc.com-8 Aug 20168 Aug 20168 Aug 2017
198stephysstoryinc.orgGoDaddy.com, LLC8 Aug 201619 Sep 20178 Aug 2018
199stephymakepretty.com-9 Aug 20169 Aug 20169 Aug 2017
200stephyjoy.comGoDaddy.com, LLC11 Jul 202422 Aug 202511 Jul 2025
201stephysea.comTucows Domains Inc.29 Jul 20212 Aug 202229 Jul 2022
202stephyjdesigns.com-28 Aug 201628 Aug 201628 Aug 2017
203stephyjscrubs.com-28 Aug 201628 Aug 201628 Aug 2017
204stephyandrichgethitched.comeNom, Inc.29 Aug 201611 Oct 201729 Aug 2017
205stephyexotichome.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Sep 201625 Oct 201713 Sep 2017
206stephycheung.comDreamHost, LLC17 Sep 201630 Oct 201717 Sep 2017
207stephyrottyhome.us-15 Sep 201615 Sep 201614 Sep 2017
208stephy-express.comOVH sas26 Sep 201627 Sep 201726 Sep 2018
209stephyx.comBeijing Lanhai Jiye Technology Co., Ltd9 Jul 202123 Mar 20269 Jul 2026
210stephydoll.comHongkong Domain Name Information Management Co., L…4 Nov 202214 Jan 20244 Nov 2023
211stephymillerphotography.comGoDaddy.com, LLC28 Sep 201617 Apr 202428 Sep 2026
212stephykuo.comGoDaddy.com, LLC14 Jul 201014 Jul 201614 Jul 2019
213stephyma.comDomain.com, LLC30 May 201212 Jul 202530 May 2026
214stephyunju.comGoDaddy.com, LLC20 Dec 201024 Dec 201520 Dec 2017
215stephysnaps.com1API GmbH14 Apr 201419 Apr 202614 Apr 2027
216stephypotatoes.comTucows Domains Inc.18 Mar 200822 Mar 201818 Mar 2018
217stephyharrison.comNameCheap, Inc.12 Apr 20128 Apr 202512 Apr 2026
218stephytravel.comGMO Internet Inc.16 Nov 202328 Dec 202416 Nov 2024
219stephyk.comNameCheap, Inc.12 Aug 200730 Aug 202312 Aug 2029
220stephyonline.comGoDaddy.com, LLC6 Sep 202118 Oct 20236 Sep 2023
221stephy-und-markus.comGoDaddy.com, LLC15 Jun 201215 Jun 201215 Jun 2017
222stephyericksonfitness.comGoDaddy.com, LLC19 Mar 201420 Mar 202619 Mar 2027
223stephyso.comNamesilo, LLC6 Nov 20207 Nov 20206 Nov 2021
224stephya.comGandi SAS27 Mar 20006 Mar 202627 Mar 2029
225stephysorganic.comGoDaddy.com, LLC19 Sep 201320 Sep 202519 Sep 2028
226stephyfreight.com1&1 Internet AG15 Nov 200821 Mar 201815 Nov 2026
227stephydanger.comGoDaddy.com, LLC4 Feb 20126 Feb 20154 Feb 2017
228stephylicious.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jan 20082 Mar 201723 Jan 2018
229stephysteve.comKey-Systems GmbH31 Oct 201230 Oct 201731 Oct 2018
230stephylee.com-8 Sep 202310 Oct 20248 Sep 2024
231stephytao.comChengdu West Dimension Digital Technology Co., Ltd…19 Nov 201819 Nov 201819 Nov 2019
232stephyland.comOnline SAS20 Jul 200921 Apr 202520 Jul 2026
233stephytang.comGoDaddy.com, LLC17 Jun 200218 Jun 202517 Jun 2026
234stephy-washington.comKey-Systems GmbH6 May 20216 May 20216 May 2022
235stephysobossy.comName.com, Inc.21 Dec 201317 Nov 201521 Dec 2016
236stephyw.comCloud System, LLC24 Jun 201924 Jun 201924 Jun 2020
237stephyhaik.comOVH sas7 Oct 20042 Oct 20237 Oct 2026
238stephystyle.comGoDaddy.com, LLC7 Jan 20134 Dec 202523 Nov 2027
239stephylewis.comTucows Domains Inc.12 Sep 201016 Sep 201812 Sep 2018
240stephycloset.comGoDaddy.com, LLC29 Apr 201330 Apr 201629 Apr 2019
241stephymauer.comGoDaddy.com, LLC11 Dec 200912 Dec 202511 Dec 2027
242stephyoungdesign.comGoDaddy.com, LLC11 Nov 201312 Nov 202511 Nov 2026
243stephylove.comShinjiru MSC Sdn Bhd9 Aug 200714 Sep 20249 Aug 2027
244stephynow.comXin Net Technology Corporation23 Jan 202623 Jan 202623 Jan 2027
245stephymoody.comMelbourne IT, Ltd27 Feb 201423 Feb 202627 Feb 2027
246stephybishop.comWild West Domains, LLC19 Oct 202019 Oct 202019 Oct 2021
247stephysfabrics.comFastDomain Inc.25 Mar 20118 May 201725 Mar 2017
248stephyeager.comTucows Domains Inc.5 Dec 201720 Nov 20255 Dec 2026
249stephyourself.comTucows Domains Inc.5 Aug 20149 Aug 20185 Aug 2018
250stephycyn.comGoDaddy.com, LLC16 Nov 201316 Nov 202516 Nov 2026
251stephyamey.comTucows Domains Inc.1 Feb 201331 Jan 20261 Feb 2027
252stephys-abbigliamento.comRegister.it SPA20 Oct 201420 Sep 201520 Oct 2016
253stephysparkles.comNetwork Solutions, LLC28 Oct 202313 Oct 202528 Oct 2026
254stephyoungmc.comGoDaddy.com, LLC6 Apr 20186 Apr 20266 Apr 2027
255stephyoga.comFastDomain Inc.27 Aug 201712 Aug 202527 Aug 2026
256stephysez.comGoDaddy.com, LLC20 Sep 201323 Jul 201520 Sep 2017
257stephye.comTurnCommerce, Inc. DBA NameBright.com13 Dec 201311 Nov 202513 Dec 2026
258stephybeauty.comOVH sas8 Jun 20131 Jun 20248 Jun 2025
259stephyds.comFree Dive Domains, LLC23 Dec 20227 Mar 202423 Dec 2023
260stephybeans.comGoDaddy.com, LLC19 Jan 20119 Jan 202619 Jan 2027
261stephyslashes.comGoDaddy.com, LLC30 May 20148 Mar 201630 May 2017
262stephycrespo.comLaunchpad, Inc.26 Feb 200811 Feb 202626 Feb 2027
263stephyang.com1&1 Internet AG21 Apr 201116 Apr 202621 Apr 2027
264stephybb.com1API GmbH5 Aug 20205 Aug 20205 Aug 2021
265stephycom.comOnline SAS23 Sep 20119 Feb 202623 Sep 2027
266stephykim.comGoDaddy.com, LLC1 Aug 20091 Aug 20241 Aug 2026
267stephybaby.comBeijing Lanhai Jiye Technology Co., Ltd16 Apr 201024 Apr 202616 Apr 2027
268stephyjeffy.comGoDaddy.com, LLC3 Jul 20083 Jul 20163 Jul 2017
269stephyho.comGoDaddy.com, LLC7 Mar 20127 Mar 20127 Mar 2017
270stephyoushouldknow.comDynadot, LLC9 Jul 20199 Jul 20199 Jul 2020
271stephygee.comTucows Domains Inc.17 Aug 200419 Jul 202517 Aug 2026
272stephyoung.comFastDomain Inc.10 Apr 200926 Mar 202610 Apr 2027
273stephyg.comGoDaddy.com, LLC23 Apr 202225 May 202423 Apr 2024
274stephyfurniture.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Feb 202417 Feb 202611 Feb 2027
275stephysy.comHangzhou Dianshang Internet Technology Co., Ltd26 Feb 20224 May 202326 Feb 2023
276stephyinkspetportraits.comregister.com, Inc.20 Jun 20125 Jun 201620 Jun 2018
277stephysicians.comNetwork Solutions, LLC10 Mar 20109 Jan 202610 Mar 2031
278stephycat.comCloudFlare, Inc.4 Aug 201111 Jul 20254 Aug 2026
279stephychung.comSquarespace Domains LLC26 Jun 202411 Jun 202526 Jun 2026
280stephysite.comTucows Domains Inc.19 Mar 200418 Feb 202619 Mar 2027
281stephyescort.comRegister.it SPA26 Mar 201625 Mar 201621 Apr 2017
282stephyiu.comDreamHost, LLC22 Sep 200822 Aug 202522 Sep 2026
283stephybriot.com1&1 Internet AG20 Sep 20011 Oct 201620 Sep 2017
284stephybytes.orgFastDomain Inc.5 Oct 20165 Oct 20175 Oct 2018
285stephyliu.infoFastDomain Inc.27 Mar 201327 Mar 201627 Mar 2017
286stephymbrown.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Oct 201624 Nov 201713 Oct 2017
287stephye.neteNom, Inc.19 Jan 201714 Jan 201819 Jan 2018
288stephytrackingonline.net1&1 Internet AG26 Aug 201126 Aug 202526 Aug 2026
289stephystyle.netGoDaddy.com, LLC7 Jan 20133 Dec 201523 Nov 2020
290stephytracking.net1&1 Internet AG5 May 20106 May 20255 May 2026
291stephyfreight.net1&1 Internet AG15 Nov 200814 Dec 201715 Nov 2026
292stephye.orgeNom, Inc.19 Jan 201721 Mar 201719 Jan 2018
293stephycosta.com-26 Oct 201626 Oct 201626 Oct 2018
294stephysmadeleines.comOnline SAS26 Oct 201618 Sep 201726 Oct 2018
295stephyprod.fr-26 Jun 200610 Oct 2016-
296stephyharmon.websiteNameCheap, Inc.4 Nov 20164 Nov 20164 Nov 2017
297stephyray.comGoDaddy.com, LLC7 Nov 20167 Nov 20167 Nov 2018
298stephyfaces.comGoDaddy.com, LLC8 Nov 20168 Nov 20168 Nov 2018
299stephysfaces.comGoDaddy.com, LLC8 Nov 20168 Nov 20168 Nov 2018
300stephyedisonwed.comNetwork Solutions, LLC11 Nov 20169 Nov 201711 Nov 2018
301stephyoungauthor.comFastDomain Inc.14 Nov 201630 Oct 202514 Nov 2026
302stephyoungbooks.comFastDomain Inc.14 Nov 201616 Dec 201714 Nov 2017
303stephyandkeith.comeNom, Inc.15 Nov 201618 Nov 201715 Nov 2017
304stephyxmasrotty.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Dec 20165 Dec 20175 Dec 2017
305stephyrios.comTucows Domains Inc.6 Dec 201610 Dec 20246 Dec 2025
306stephyari.comNetwork Solutions, LLC8 Dec 20168 Dec 20178 Dec 2018
307stephystyles.comGoDaddy.com, LLC10 Dec 201610 Dec 201610 Dec 2017
308stephysvanity.comGoDaddy.com, LLC19 Dec 201619 Dec 201619 Dec 2017
309stephychica.comGoDaddy.com, LLC5 Sep 201916 Sep 20255 Sep 2026
310stephyrottypups.com1API GmbH21 Mar 201821 Mar 201821 Mar 2019
311stephyclark.comGoDaddy.com, LLC5 Jan 20175 Jan 20175 Jan 2019
312stephyfede.comGoDaddy.com, LLC11 Jan 201711 Jan 201711 Jan 2018
313stephysonline.comeNom, Inc.16 Jan 20176 Jan 201816 Jan 2019
314stephyskitchen.comGoDaddy.com, LLC4 Jan 20245 Jan 20264 Jan 2027
315stephypeterson.comregister.com, Inc.7 Feb 20177 Feb 20177 Feb 2019
316stephypaige.comGoDaddy.com, LLC30 Oct 202314 Oct 202530 Oct 2026
317stephypaigeweb.comGoDaddy.com, LLC9 Feb 20179 Feb 20179 Feb 2018
318stephyloves.comTucows Domains Inc.16 Feb 201720 Feb 202016 Feb 2020
319stephy1312888.comeName Technology Co., Ltd.21 Feb 201721 Feb 201721 Feb 2018
320stephyblondie.com1&1 Internet AG4 Mar 20174 Mar 20174 Mar 2018
321stephydance.comTucows Domains Inc.15 Mar 201728 Feb 202615 Mar 2027
322stephyun.comNameCheap, Inc.18 Mar 201718 Mar 201718 Mar 2018
323stephyandaxel.comGoDaddy.com, LLC24 Mar 201724 Mar 201724 Mar 2018
324stephyjoe.comGoDaddy.com, LLC11 Aug 202021 Aug 202411 Aug 2027
325stephyvette.comGoDaddy.com, LLC1 Apr 20171 Apr 20171 Apr 2018
326stephytian.comNetwork Solutions, LLC12 Apr 201714 Apr 202612 Apr 2027
327stephygraph.fr-2 Jul 201518 Jul 20167 Feb 2017
328stephylionne.comXin Net Technology Corporation20 Jul 201828 Apr 202120 Jul 2021
329stephyost.comTucows Domains Inc.4 May 201731 Jan 20264 May 2026
330stephyluky.comeNom, Inc.7 May 20176 May 20177 May 2018
331stephynessy.comTucows Domains Inc.7 May 201731 Jul 20257 May 2026
332stephystardust.comTucows Domains Inc.10 May 201731 Jan 202610 May 2026
333stephyro.orgNetwork Solutions, LLC16 May 201716 Jul 201716 May 2018
334stephynoblesbeans.orgGoDaddy.com, LLC22 May 201722 Jul 201722 May 2018
335stephynoblesbeans.comGoDaddy.com, LLC22 May 201729 Apr 202522 May 2026
336stephythelegend.comGoDaddy.com, LLC25 May 201725 May 202525 May 2026
337stephysrants.comGoDaddy.com, LLC1 Feb 202314 Mar 20241 Feb 2024
338stephy-mike.partyPDR Ltd. d/b/a PublicDomainRegistry.com8 Jun 201723 Oct 20178 Jun 2018
339stephymineur.comTucows Domains Inc.15 Jun 201719 Jun 201815 Jun 2018
340stephyminceur.comTucows Domains Inc.18 Jun 201722 Jun 201818 Jun 2018
341stephymurphy.comNameCheap, Inc.5 Jul 20175 Jul 20175 Jul 2018
342stephyandandy.comeNom, Inc.23 Jul 201723 Jul 201723 Jul 2018
343stephy-deco.com1&1 Internet AG7 Aug 20178 Aug 20187 Aug 2019
344stephykalach.comGoDaddy.com, LLC28 Nov 201928 Nov 201928 Nov 2020
345stephyjayneuk.comLaunchpad, Inc.18 Aug 201720 Aug 202518 Aug 2026
346stephylovesgin.comAutomattic Inc.21 Aug 201721 Aug 201721 Aug 2018
347stephyeleon.comName.com, Inc.25 Aug 201725 Aug 201725 Aug 2018
348stephysbees.comAutomattic Inc.12 Sep 201712 Sep 201712 Sep 2018
349stephysun.comHefei Juming Network Technology Co., Ltd29 Nov 202130 Nov 202329 Nov 2024
350stephycross.comNameCheap, Inc.25 Sep 201725 Sep 201725 Sep 2019
351stephymaturan.infoGoDaddy.com, LLC15 Oct 201715 Oct 201715 Oct 2018
352stephyaolong.comNameCheap, Inc.1 Apr 20242 Mar 20261 Apr 2027
353stephyap.comTPP Wholesale Pty Ltd.9 Nov 20179 Nov 20179 Nov 2018
354stephyluxx.comNetwork Solutions, LLC28 Nov 201728 Nov 201728 Nov 2018
355stephyatv.comGandi SAS14 Dec 201731 Dec 201714 Dec 2020
356stephyborges.comWix.com Ltd.15 Apr 202516 Mar 202615 Apr 2027
357stephyardley.comAutomattic Inc.1 Jan 201812 Dec 20251 Jan 2027
358stephydown.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…9 Aug 20052 Aug 20179 Aug 2018
359stephyscakes.co.ukReserved15 Apr 201415 May 201615 Apr 2018
360stephyholland.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…23 Mar 201516 Mar 201723 Mar 2019
361stephysfaces.co.uk-8 Nov 20168 Nov 20168 Nov 2018
362stephyweb.co.uk-11 Sep 200628 Aug 201711 Sep 2018
363stephywinn.co.uk-29 Apr 201630 Apr 202529 Apr 2028
364stephyfaces.co.uk-8 Nov 20168 Nov 20168 Nov 2018
365stephys.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…7 Jun 201131 May 20177 Jun 2019
366stephyshipley.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…5 Jan 201229 Dec 20175 Jan 2020
367stephymarie.co.uk-14 Apr 201315 Apr 202514 Apr 2028
368stephycrayons.co.uk-7 Jan 20146 Apr 20167 Jan 2018
369stephym.co.uk-30 May 201716 May 202530 May 2026
370stephyangel.comSquarespace Domains LLC5 Oct 20225 Dec 20235 Oct 2023
371stephyyenrique.comeNom, Inc.26 Jan 201826 Jan 201826 Jan 2019
372stephyates.comTucows Domains Inc.29 Jan 201831 Jan 202629 Jan 2027
373stephys-beauty-shop.comTucows Domains Inc.2 Feb 20186 Feb 20192 Feb 2019
374stephygraphe.com1&1 Internet AG3 Feb 20183 Feb 20183 Feb 2019
375stephyhime.comSquarespace Domains LLC10 Jul 202510 Jul 202510 Jul 2026
376stephyjeansings.comNetwork Solutions, LLC14 Feb 201814 Feb 201814 Feb 2020
377stephyspetstore.comTucows Domains Inc.22 Feb 201826 Feb 201922 Feb 2019
378stephylowndes.comDomain.com, LLC3 Mar 20185 Mar 20263 Mar 2027
379stephyvictor.comNetwork Solutions, LLC11 Mar 201811 Mar 201811 Mar 2019
380stephypets.comFastDomain Inc.15 Mar 201817 Mar 202415 Mar 2025
381stephynie.com-24 Jun 202322 Jan 202624 Jun 2026
382stephyshop.com1&1 Internet AG23 Feb 202323 Feb 202323 Feb 2027
383stephymario.comGoDaddy.com, LLC12 Nov 202012 Nov 202012 Nov 2021
384stephysboutique.comHosting Concepts B.V. dba Openprovider8 Jan 202517 Feb 20268 Jan 2026
385stephyjose.comNetwork Solutions, LLC8 Apr 20188 Apr 20188 Apr 2019
386stephysclothes.comTucows Domains Inc.11 Apr 201815 Apr 201911 Apr 2019
387stephyface.comNetwork Solutions, LLC20 Apr 201820 Apr 201820 Apr 2019
388stephykong.comTucows Domains Inc.21 Apr 20186 Apr 202621 Apr 2027
389stephyharmon.com1&1 Internet AG24 Apr 201824 Apr 201824 Apr 2019
390stephy-r.comNetwork Solutions, LLC24 Apr 201824 Apr 201824 Apr 2019
391stephydiaz.comTucows Domains Inc.9 May 201820 Jul 20239 May 2023
392stephyx.co.uk-8 May 201810 May 20188 May 2019
393stephytefisdagupanmilkfish.comLaunchpad, Inc.30 May 201830 May 201830 May 2019
394stephyschon.comGoDaddy.com, LLC1 Jun 20181 Jun 20181 Jun 2019
395stephyrottypuppies.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Jun 201819 Jul 20207 Jun 2020
396stephyscloset.comGoDaddy.com, LLC8 Jun 20188 Jun 20188 Jun 2019
397stephysellshomes.comGoDaddy.com, LLC25 Jun 201829 Jun 202425 Jun 2026
398stephyetannyboutique.comTucows Domains Inc.6 Jul 201810 Jul 20196 Jul 2019
399stephyfromtexas.comGoogle, Inc.10 Jul 201810 Jul 201810 Jul 2019
400stephykay.comWeb Commerce Communications Limited dba WebNic.cc1 Mar 202210 Apr 20251 Mar 2025
401stephyintheworld.comTucows Domains Inc.13 Nov 202324 Dec 202413 Nov 2024
402stephymakeup.comGoDaddy.com, LLC18 Jul 201818 Jul 201818 Jul 2019
403stephyscakery.comGoDaddy.com, LLC27 Oct 202127 Mar 202627 Oct 2026
404stephynaturals.comTucows Domains Inc.6 Aug 201817 Oct 20236 Aug 2023
405stephyny.comEUTurbo.com LLC27 Mar 202230 Mar 202327 Mar 2024
406stephykenzie.comBeijing Lanhai Jiye Technology Co., Ltd11 Nov 202213 Jan 202511 Nov 2024
407stephybbs.comNordreg AB26 Oct 202516 Mar 202626 Oct 2026
408stephyspixeldesigns.comZhengzhou Century Connect Electronic Technology De…10 Apr 202010 Apr 202010 Apr 2021
409stephysays.comNamesilo, LLC27 Nov 202230 Jan 202427 Nov 2023
410stephyleighgriffin.comWix.com Ltd.11 Sep 201813 Aug 202511 Sep 2026
411stephyee.comNameCheap, Inc.14 Sep 201814 Sep 201814 Sep 2019
412stephy-and-ryan.comeNom, Inc.15 Sep 201815 Sep 201815 Sep 2020
413stephypenny.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED25 Sep 201825 Sep 201825 Sep 2019
414stephyr-renovation.comOVH sas12 Oct 201813 Oct 202412 Oct 2026
415stephysweats.comNetwork Solutions, LLC17 Oct 201817 Oct 201817 Oct 2019
416stephyne.comUniregistrar Corp18 Oct 201830 Dec 202418 Oct 2024
417stephybee.comGoDaddy.com, LLC4 Jan 202315 Feb 20254 Jan 2025
418stephyiovescu.comTucows Domains Inc.12 Jun 202310 Jun 202512 Jun 2026
419stephyfarah.comGoDaddy.com, LLC26 Dec 202426 Dec 202426 Dec 2034
420stephyky.comNetwork Solutions, LLC30 Nov 201830 Nov 201830 Nov 2021
421stephybeck-akademie.comTucows Domains Inc.5 Dec 201820 Nov 20255 Dec 2026
422stephysanchezmakeup.comGoDaddy.com, LLC7 Dec 20187 Dec 20187 Dec 2020
423stephyjulien.comWild West Domains, LLC7 Dec 20187 Dec 20187 Dec 2019
424stephyjohnelle.comGoDaddy.com, LLC10 Dec 201810 Dec 201810 Dec 2020
425stephytaylor.comDOMAIN NAME NETWORK PTY LTD15 May 202427 Jul 202515 May 2025
426stephysshop.com1&1 Internet AG1 Jan 20191 Jan 20191 Jan 2020
427stephyfashion.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Mar 202111 Mar 202110 Mar 2022
428stephyndaniel.comGoDaddy.com, LLC9 Jan 20199 Jan 20199 Jan 2020
429stephywray.comSquarespace Domains LLC22 Jul 20218 Jul 202522 Jul 2026
430stephyhomemaker.comFastDomain Inc.1 Feb 20197 Mar 20221 Feb 2023
431stephyandmatt.comGoDaddy.com, LLC10 Feb 201910 Feb 201910 Feb 2020
432stephymendez.comeNom, Inc.12 Feb 201912 Feb 201912 Feb 2020
433stephyglambeauty.comOVH sas21 Feb 201921 Feb 201921 Feb 2020
434stephyoungmakeup.comGoDaddy.com, LLC22 Feb 20196 Mar 202622 Feb 2027
435stephybuandtbone.comTucows Domains Inc.23 Feb 20195 Apr 202523 Feb 2025
436stephyandbecca.comEuroDNS S.A.24 Feb 201924 Feb 201923 Feb 2020
437stephytoons.comNetwork Solutions, LLC16 Mar 201916 Mar 201916 Mar 2021
438stephysjewelry.comTucows Domains Inc.18 Mar 20194 Mar 202618 Mar 2027
439stephynxmode.comFastDomain Inc.17 Aug 202029 Sep 202417 Aug 2024
440stephykphotography.comGoDaddy.com, LLC25 Mar 201926 Mar 202525 Mar 2027
441stephyruben.comGoDaddy.com, LLC25 Mar 201925 Mar 201925 Mar 2020
442stephyandjoetietheknot.comeNom, Inc.27 Mar 201926 Mar 201927 Mar 2020
443stephyhair.com1&1 Internet AG11 Apr 201911 Apr 201911 Apr 2020
444stephyreads.comGoogle, Inc.12 Apr 201912 Apr 201912 Apr 2020
445stephyshanti.comSquarespace Domains LLC19 Jan 202619 Jan 202619 Jan 2029
446stephypet.comTucows Domains Inc.2 May 20196 May 20212 May 2021
447stephynicole.comGoDaddy.com, LLC3 May 20193 May 20193 May 2020
448stephythenerd.comGoogle, Inc.4 May 20194 May 20194 May 2020
449stephybarron.comGoDaddy.com, LLC7 May 20197 May 20197 May 2020
450stephyfromtheblock.comGoDaddy.com, LLC10 May 201910 May 201910 May 2020
451stephybizz.comGoDaddy.com, LLC23 May 201923 May 201923 May 2020
452stephy-shanti.comTucows Domains Inc.30 May 20195 Sep 202530 May 2026
453stephyrobertson.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Jun 20191 Jun 20191 Jun 2020
454stephywachter.netGoDaddy.com, LLC1 Jun 20191 Jun 20191 Jun 2021
455stephywachter.comGoDaddy.com, LLC1 Jun 201913 Aug 20251 Jun 2025
456stephyluis.comeNom, Inc.24 Jun 20196 Aug 202024 Jun 2020
457stephymarkets.comNameCheap, Inc.9 Jul 2019-9 Jul 2020
458stephyoung4staterep.comRealtime Register B.V.20 Oct 202123 Oct 202120 Oct 2022
459stephyjorge.comGoDaddy.com, LLC18 Jul 201918 Jul 201918 Jul 2020
460stephy-shop.com1&1 Internet AG20 Jul 201920 Jul 201920 Jul 2020
461stephywild.comWebfusion Ltd.26 Jul 201926 Jul 201926 Jul 2020
462stephydvoiceovers.comFastDomain Inc.5 Aug 20195 Aug 20195 Aug 2020
463stephy-b.com1&1 Internet AG7 Aug 20197 Aug 20197 Aug 2020
464stephyinthesun.comGoDaddy.com, LLC9 Nov 20209 Nov 20209 Nov 2021
465stephysanchez.comHostinger, UAB14 Aug 201915 Aug 201914 Aug 2020
466stephytruffles.comTucows Domains Inc.16 Aug 201920 Aug 202016 Aug 2020
467stephyip.bidPDR Ltd. d/b/a PublicDomainRegistry.com28 Aug 201928 Aug 201928 Aug 2020
468stephysworld.comNetwork Solutions, LLC11 Sep 201911 Sep 201911 Sep 2021
469stephyb-websolutions.com1&1 Internet AG11 Sep 201911 Sep 201911 Sep 2020
470stephycn.comDynadot, LLC26 Nov 202127 Nov 202126 Nov 2022
471stephyetjm.comGoDaddy.com, LLC29 Sep 201929 Sep 201929 Sep 2020
472stephytree.comFastDomain Inc.10 Oct 20197 Jan 202010 Oct 2020
473stephylmt.com1&1 Internet AG12 Oct 201912 Oct 201912 Oct 2020
474stephydrogen.comDropCatch.com 912 LLC21 Oct 202522 Oct 202521 Oct 2026
475stephymania.comBeijing Lanhai Jiye Technology Co., Ltd21 May 202524 Mar 202621 May 2026
476stephysthisandthat.comTucows Domains Inc.18 Oct 201922 Oct 202118 Oct 2021
477stephycejas.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Oct 201924 Oct 201924 Oct 2020
478stephyork.comFastDomain Inc.31 Oct 201931 Oct 201931 Oct 2020
479stephyseng.comNameCheap, Inc.1 Nov 2019-1 Nov 2020
480stephydiego.comWix.com Ltd.2 Nov 20193 Oct 20252 Nov 2026
481stephytbridgecityrealestate.comGoDaddy.com, LLC4 Nov 20194 Nov 20194 Nov 2021
482stephy-fansclub.comeName Technology Co., Ltd.17 Nov 201917 Nov 201917 Nov 2020
483stephyhuang.comHiChina Zhicheng Technology Limited8 Nov 201920 Nov 20198 Nov 2020
484stephycapuci.comGoDaddy.com, LLC30 Nov 201930 Nov 201930 Nov 2021
485stephycherng.comWix.com Ltd.3 Dec 20199 Nov 20253 Dec 2027
486stephyfashions.comNameCheap, Inc.5 Dec 2019-5 Dec 2020
487stephyteachesmusic.comTucows Domains Inc.9 Dec 201913 Dec 20219 Dec 2021
488stephyhaven.comNameCheap, Inc.2 Jul 2021-2 Jul 2022
489stephydeez.comKey-Systems GmbH20 Dec 201919 Dec 202520 Dec 2026
490stephycontreras.comGoDaddy.com, LLC3 Jan 202015 Mar 20243 Jan 2024
491stephyanais.comSquarespace Domains LLC5 Jan 202021 Dec 20255 Jan 2027
492stephybloom.comGoDaddy.com, LLC21 Jan 202022 Jan 202621 Jan 2027
493stephy-style.comTucows Domains Inc.23 Jan 202027 Jan 202123 Jan 2021
494stephyfitness.comGoDaddy.com, LLC28 Jan 202028 Jan 202028 Jan 2021
495stephystars.comGoDaddy.com, LLC28 Jan 202028 Jan 202028 Jan 2021
496stephyfung.comGoDaddy.com, LLC3 Feb 20204 Feb 20263 Feb 2028
497stephyjake.comWild West Domains, LLC4 Feb 20204 Feb 20204 Feb 2021
498stephyglow.comInfomaniak Network SA20 Feb 20204 Apr 202520 Feb 2025
499stephyblessing.comNameCheap, Inc.24 Feb 2020-24 Feb 2021
500stephysommerfeld.comNetwork Solutions, LLC28 Feb 202012 Apr 202328 Feb 2023
501stephystar.comGoDaddy.com, LLC19 Mar 202019 Mar 202019 Mar 2021
502stephywatkins.comNameCheap, Inc.20 Mar 20201 Jul 202020 Mar 2030
503stephyjofashions.com1API GmbH21 Mar 20205 May 202421 Mar 2024
504stephypinkstore.comGoogle, Inc.28 Mar 202018 Apr 202628 Mar 2027
505stephyshim.comWeb Commerce Communications Limited dba WebNic.cc16 Apr 202018 Apr 202616 Apr 2027
506stephybeck.netNameCheap, Inc.16 Apr 202017 Mar 202616 Apr 2027
507stephywachter.infoGoDaddy.com, LLC1 Jun 20191 Aug 20191 Jun 2021
508stephygracebooks.comTucows Domains Inc.20 Apr 20205 Apr 202620 Apr 2027
509stephyoungphoto.comGoDaddy.com, LLC26 Aug 202526 Aug 202526 Aug 2028
510stephysantander.comNetwork Solutions, LLC26 Apr 20209 Jul 202426 Apr 2024
511stephysergio.comGoDaddy.com, LLC26 Apr 20207 Jul 202426 Apr 2024
512stephyshuen.comTucows Domains Inc.30 Apr 20204 May 202230 Apr 2022
513stephylifey.comAutomattic Inc.3 May 20203 May 20203 May 2021
514stephya.proGandi SAS19 Dec 201717 Dec 201919 Dec 2020
515stephyawa.comGoDaddy.com, LLC13 May 202013 May 202013 May 2021
516stephytom2020.comGoogle, Inc.16 May 20201 May 202516 May 2026
517stephyutique.comWild West Domains, LLC20 May 202024 May 202420 May 2026
518stephytsprinkles.comGoDaddy.com, LLC21 May 202021 May 202021 May 2021
519stephyvonneames.comAutomattic Inc.21 May 202023 Nov 202521 May 2026
520stephyradio.comPDR Ltd. d/b/a PublicDomainRegistry.com31 May 202031 May 202031 May 2021
521stephysboutiqueoc.comGoDaddy.com, LLC15 Jun 202015 Jun 202015 Jun 2021
522stephyartsdesign.comOnline SAS18 Jun 202017 Aug 202318 Jun 2023
523stephysycho.comDomain.com, LLC21 Jun 202021 Jun 202021 Jun 2021
524stephypublishers.comWild West Domains, LLC2 Jul 202010 Mar 20262 Jul 2027
525stephyblogs.comGoDaddy.com, LLC14 Jul 202014 Jul 202014 Jul 2021
526stephyleo.comDattatec.com SRL17 Jul 202017 Jul 202017 Jul 2021
527stephyj.comSquarespace Domains LLC11 Jul 202422 Aug 202511 Jul 2025
528stephysbling.comTucows Domains Inc.23 Jul 202027 Jul 202223 Jul 2022
529stephymisscurvy.comGoDaddy.com, LLC27 Jul 202028 Jul 202427 Jul 2026
530stephyogaandwellness.comGoogle, Inc.3 Aug 20204 Aug 20233 Aug 2024
531stephystephsteph.comDreamHost, LLC4 Aug 20204 Aug 20204 Aug 2021
532stephyeck.comGoDaddy.com, LLC19 Sep 202219 Sep 202219 Sep 2023
533stephyalex.comGoDaddy.com, LLC13 Aug 202413 Aug 202413 Aug 2027
534stephyraw.comTucows Domains Inc.23 Aug 202027 Aug 202223 Aug 2022
535stephywil.comGoDaddy.com, LLC23 Aug 20204 Nov 202323 Aug 2023
536stephyssmartlist.infoNetwork Solutions, LLC19 Sep 202019 Sep 202019 Sep 2021
537stephypublishers.groupHostinger, UAB21 Sep 2020--
538stephysabrina.comGoDaddy.com, LLC8 Oct 20209 Oct 20258 Oct 2026
539stephysdivaboutique.comTucows Domains Inc.13 Oct 202017 Oct 202113 Oct 2021
540stephylouphotography.comAutomattic Inc.14 Oct 202014 Oct 202014 Oct 2021
541stephygraph.comCNOBIN INFORMATION TECHNOLOGY LIMITED29 Dec 202129 Dec 202129 Dec 2022
542stephychihuahuapups.comNameCheap, Inc.21 Oct 2020-21 Oct 2021
543stephysfitness.comGoogle, Inc.30 Oct 202030 Oct 202030 Oct 2021
544stephypublisher.onlineHostinger, UAB1 Nov 20202 Nov 20251 Nov 2026
545stephystandard-vn.comGoDaddy.com, LLC3 Nov 202013 Sep 20253 Nov 2025
546stephy0684.companyName.com, Inc.7 Nov 20207 Nov 20207 Nov 2021
547stephydash.comFastDomain Inc.8 Nov 20208 Nov 20208 Nov 2021
548stephyglez.comFastDomain Inc.8 Nov 202020 Jan 20248 Nov 2023
549stephysdesigns.comGoogle, Inc.17 Aug 20209 Nov 202017 Aug 2021
550stephysdeals.comGoDaddy.com, LLC15 Nov 202015 Nov 202015 Nov 2021
551stephy-miguel.comTucows Domains Inc.27 Nov 20201 Dec 202127 Nov 2021
552stephychoo.comTucows Domains Inc.1 Dec 20205 Dec 20211 Dec 2021
553stephynatural.siteHosting Concepts B.V. dba Openprovider1 May 20208 Jul 20201 May 2021
554stephyogafusion.comSquarespace Domains LLC18 Dec 202029 Jan 202518 Dec 2024
555stephyssugarshack.comNameCheap, Inc.18 Dec 2020-18 Dec 2021
556stephyjcreations.comTucows Domains Inc.10 Jan 202114 Jan 202210 Jan 2022
557stephyn.com-1 Mar 20251 Mar 20251 Mar 2027
558stephyourrealtor.comGoDaddy.com, LLC18 Jan 20211 Mar 202618 Jan 2026
559stephyservices.comRegister.it SPA21 Jan 202121 Jan 202121 Jan 2022
560stephypublishing.onlineHostinger, UAB21 Sep 202022 Sep 202521 Sep 2026
561stephycommunitymanager.comAutomattic Inc.2 Feb 20212 Feb 20212 Feb 2022
562stephyfoundations.comHosting Concepts B.V. dba Openprovider2 Feb 20212 Feb 20212 Feb 2022
563stephy7685.comAscio Technologies, Inc. Danmark - Filial af Ascio…5 Feb 20215 Feb 20215 Feb 2022
564stephyoungreads.comNameCheap, Inc.5 Feb 20216 Jan 20265 Feb 2027
565stephybates.comHosting Concepts B.V. dba Openprovider9 Feb 20219 Feb 20219 Feb 2022
566stephyweiss.comTucows Domains Inc.23 Feb 202129 Jan 202623 Feb 2027
567stephysvault.comGoDaddy.com, LLC4 Mar 202116 May 20254 Mar 2025
568stephythepickle.comGoogle, Inc.3 Mar 202115 May 20253 Mar 2025
569stephyjmoore.mediaGoDaddy.com, LLC4 Mar 202118 Apr 20254 Mar 2027
570stephyhohoho.comGoDaddy.com, LLC5 Mar 202116 Apr 20235 Mar 2023
571stephyfm.comAutomattic Inc.8 Mar 202116 Feb 20268 Mar 2027
572stephypublishers.onlineHostinger, UAB14 Sep 202019 Sep 202514 Sep 2026
573stephyshoping.comNameCheap, Inc.10 Mar 2021-10 Mar 2022
574stephyphotographie.comGandi SAS26 Mar 20219 May 202426 Mar 2024
575stephyfabulousjewels.comregister.com, Inc.28 Mar 202110 May 202428 Mar 2024
576stephyjones.comGoDaddy.com, LLC5 Apr 20215 Apr 20215 Apr 2022
577stephysmacaronsandsweets.comDomain.com, LLC5 Apr 20217 Apr 20265 Apr 2027
578stephytan.comGoDaddy.com, LLC15 Apr 202115 Apr 202115 Apr 2022
579stephycheng.comGoogle, Inc.21 Apr 20216 Apr 202621 Apr 2027
580stephyourazagent.comGoDaddy.com, LLC21 Apr 20212 Jun 202421 Apr 2024
581stephymcmullan.netGoDaddy.com, LLC22 Apr 20214 May 202322 Apr 2024
582stephymcmullan.comGoDaddy.com, LLC22 Apr 20214 May 202322 Apr 2024
583stephycalligraphy.com1&1 Internet AG26 Apr 202126 Apr 202126 Apr 2022
584stephyangwrites.comregister.com, Inc.3 May 202115 Jun 20253 May 2025
585stephyleemusic.comNameCheap, Inc.10 May 2021-10 May 2022
586stephyasar.comGenious Communications SARL/AU17 May 202127 Jul 202517 May 2025
587stephyjamz.comWild West Domains, LLC11 May 202112 May 202411 May 2027
588stephyhugoboda.comNeubox Internet S.A. de C.V.15 Jun 202115 Jun 202115 Jun 2022
589stephydachshundpuppieshome.comWix.com Ltd.30 May 202130 May 202130 May 2022
590stephyjavier.com1&1 Internet AG28 Jun 20218 Jul 202528 Jun 2026
591stephytracking.online1&1 Internet AG30 Jun 202122 Sep 202530 Jun 2026
592stephysprinkles.comNameCheap, Inc.6 Jul 2021-6 Jul 2022
593stephyang.xyzGoDaddy.com, LLC17 Jul 202124 Sep 202517 Jul 2027
594stephychihuahua.comNameCheap, Inc.20 Jul 2021-20 Jul 2022
595stephyjmoore.comTucows Domains Inc.25 Jul 202129 Jul 202525 Jul 2026
596stephyscrafts.comGoDaddy.com, LLC30 Jul 20219 Sep 202430 Jul 2024
597stephysbakehouse.comGoDaddy.com, LLC9 Aug 202121 Oct 20239 Aug 2023
598stephydewar.comAutomattic Inc.18 Aug 202123 Nov 202518 Aug 2026
599stephyandrobert.comeNom, Inc.8 Sep 20218 Sep 20218 Sep 2022
600stephyssecret.comNameCheap, Inc.11 Sep 202112 Aug 202511 Sep 2026
601stephyshanti.netGoogle, Inc.24 Sep 20219 Sep 202524 Sep 2026
602stephygiene.comGoDaddy.com, LLC27 Sep 20216 Oct 202527 Sep 2026
603stephyluxe.com-18 Oct 202119 Oct 202518 Oct 2026
604stephylawyer.comBeijing Lanhai Jiye Technology Co., Ltd16 Aug 202324 Mar 202616 Aug 2026
605stephyng.comNameCheap, Inc.1 Nov 2021-1 Nov 2022
606stephys-wee-ones-daycare.comDomainPeople, Inc.8 Nov 202121 Dec 20238 Nov 2023
607stephyloren.comPorkbun, LLC22 Jun 202522 Jun 202522 Jun 2026
608stephyliu.comGoogle, Inc.11 Nov 202111 Nov 202311 Nov 2024
609stephystudiolashes.comregister.com, Inc.11 Nov 202111 Nov 202111 Nov 2022
610stephyrafa.comHosting Concepts B.V. dba Openprovider17 Nov 202122 Oct 202317 Nov 2023
611stephyabraham.comeNom, Inc.18 Nov 202131 Jan 202418 Nov 2023
612stephyfa.comGoogle, Inc.22 Nov 202122 Nov 202122 Nov 2022
613stephyssmellswears.comGoogle, Inc.16 Dec 202116 Dec 202116 Dec 2022
614stephy143.netGoogle, Inc.20 Dec 202120 Dec 202120 Dec 2022
615stephyhugo.comGoDaddy.com, LLC21 Dec 20211 Feb 202621 Dec 2025
616stephyunlimited.comAutomattic Inc.27 Dec 202127 Dec 202127 Dec 2022
617stephym1.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jan 202211 Jan 202211 Jan 2023
618stephysfakecakebake.comLaunchpad, Inc.27 Jan 202210 Mar 202427 Jan 2024
619stephydoesyoga.comAmazon Registrar, Inc.28 Jan 202224 Dec 202528 Jan 2027
620stephymiehle.comPorkbun, LLC28 Jan 202226 Oct 202528 Jan 2028
621stephydcroz.artHosting Concepts B.V. dba Openprovider6 Feb 20226 Feb 20226 Feb 2023
622stephysbindery.comGoDaddy.com, LLC8 Feb 202228 Jan 20268 Feb 2027
623stephystitchwitch.comTucows Domains Inc.7 Aug 202211 Aug 20257 Aug 2026
624stephytphotography.comTucows Domains Inc.10 Feb 202223 Mar 202510 Feb 2025
625stephyspeaks.comSquarespace Domains LLC25 Mar 202625 Mar 202625 Mar 2029
626stephyasmr.comName.com, Inc.20 Feb 20225 Apr 202520 Feb 2025
627stephyymario.comeNom, Inc.21 Feb 20225 Apr 202321 Feb 2023
628stephydaniel.comGoDaddy.com, LLC10 Mar 202220 Apr 202310 Mar 2023
629stephyfarah.artGoDaddy.com, LLC15 Mar 202226 May 202315 Mar 2023
630stephycode.comNameCheap, Inc.31 Mar 202231 Mar 202431 Mar 2025
631stephykaytarot.comGoDaddy.com, LLC7 Dec 202318 Jan 20257 Dec 2024
632stephyoungforstaterep.comNameCheap, Inc.22 Apr 202223 Mar 202422 Apr 2025
633stephyshealthandwellness.comAutomattic Inc.27 Apr 202210 Jul 202427 Apr 2024
634stephyleewesternwear.comTucows Domains Inc.27 Apr 20228 Jul 202327 Apr 2023
635stephysiberiankittens.comGoDaddy.com, LLC14 May 202226 Jul 202314 May 2023
636stephysweets.comWix.com Ltd.30 May 20203 Jun 202230 May 2022
637stephysantana.com1&1 Internet AG10 Jun 202223 Aug 202310 Jun 2023
638stephyblooms.comHostinger, UAB28 Nov 20171 Nov 202528 Nov 2026
639stephymens.comBeijing Lanhai Jiye Technology Co., Ltd26 Dec 201727 Feb 202426 Dec 2023
640stephyhealthcare.websiteNameCheap, Inc.12 Jul 202231 Aug 202312 Jul 2023
641stephysinternational.comGoDaddy.com, LLC13 Jul 202224 Aug 202313 Jul 2023
642stephyjisu.comNameCheap, Inc.8 Jul 2022-8 Jul 2023
643stephyperodua.comGoogle, Inc.19 Jul 202220 Jul 202319 Jul 2024
644stephygnails.comGoDaddy.com, LLC25 Jul 202226 Jul 202425 Jul 2026
645stephyen.orgNameCheap, Inc.28 Jul 202212 Aug 202328 Jul 2024
646stephyglowshop.comWix.com Ltd.25 Jul 202129 Jul 202225 Jul 2023
647stephycyllawyer.comNet-Chinese Co., Ltd.10 Aug 202210 Aug 202210 Aug 2029
648stephyy.comCloudFlare, Inc.2 Jul 20252 Jul 20252 Jul 2026
649stephyevans.comSquarespace Domains LLC18 Aug 20223 Aug 202518 Aug 2026
650stephytambonjarras.comGoogle, Inc.19 Aug 202219 Aug 202219 Aug 2023
651stephyxnails.comTucows Domains Inc.25 Aug 20225 Nov 202325 Aug 2023
652stephyomar.comWix.com Ltd.22 Aug 202026 Aug 202222 Aug 2022
653stephyoungtherapy.comGoDaddy.com, LLC1 Sep 20222 Sep 20251 Sep 2026
654stephyp.comGoDaddy.com, LLC3 Sep 202215 Nov 20233 Sep 2023
655stephyalan.comGoDaddy.com, LLC6 Sep 202217 Oct 20236 Sep 2023
656stephymedia.comNameCheap, Inc.10 Sep 202211 Aug 202510 Sep 2026
657stephylife.comXin Net Technology Corporation28 Sep 202228 Nov 202328 Sep 2023
658stephysbooks.comCloudFlare, Inc.28 Sep 202229 Sep 202528 Sep 2026
659stephyourgameup.netGoDaddy.com, LLC5 Oct 202210 Oct 20255 Oct 2026
660stephyourlifecoach.comAutomattic Inc.7 Oct 202223 Nov 20257 Oct 2026
661stephyssweetshop.comGoogle, Inc.7 Oct 202222 Sep 20257 Oct 2026
662stephysbrideguide.comGoDaddy.com, LLC22 Sep 201722 Sep 202522 Sep 2026
663stephygiene.de--13 Feb 2012-
664stephysebas.comGoDaddy.com, LLC31 Oct 202212 Jan 202431 Oct 2023
665stephymacphoto.comWix.com Ltd.27 Oct 202031 Oct 202227 Oct 2022
666stephyandsal.co.uk-6 Nov 202216 Jul 20246 Nov 2024
667stephygstudio.co.uk-9 Nov 20229 Nov 20239 Nov 2024
668stephyogabristol.co.uk-17 Nov 202212 Feb 202517 Nov 2024
669stephywaist.comGoDaddy.com, LLC23 Nov 20223 Jan 202523 Nov 2024
670stephyware.comOurdomains Limited15 Sep 202515 Sep 202515 Sep 2026
671stephywear.comNameCheap, Inc.9 Jul 20259 Jul 20259 Jul 2030
672stephyrodoswedding.comNeubox Internet S.A. de C.V.24 Nov 20223 Jan 202424 Nov 2023
673stephycarlos.comWild West Domains, LLC30 Nov 202211 Feb 202430 Nov 2023
674stephyspace.comNameCheap, Inc.4 Dec 20227 Dec 20234 Dec 2024
675stephytracking.dev1&1 Internet AG30 Jun 20219 Oct 202530 Jun 2026
676stephyrodriguez.comAscio Technologies, Inc. Danmark - Filial af Ascio…9 Dec 202210 Dec 20259 Dec 2026
677stephygstudio.comWix.com Ltd.8 Dec 202112 Dec 20228 Dec 2022
678stephycogreen.comNameCheap, Inc.21 Dec 20223 Mar 202421 Dec 2023
679stephysio.comWix.com Ltd.11 Sep 202411 Sep 202411 Sep 2026
680stephyfoodandlove.comWix.com Ltd.23 Dec 202027 Dec 202223 Dec 2022
681stephycarl.camAC Webconnecting N.V.30 Dec 20226 Dec 202530 Dec 2026
682stephysattic.comGoDaddy.com, LLC31 Dec 202231 Dec 202431 Dec 2026
683stephyaz.comGoogle, Inc.31 Dec 202216 Dec 202531 Dec 2026
684stephykayessentials.comregister.com, Inc.2 Jan 202317 Mar 20252 Jan 2025
685stephyandco.comGoDaddy.com, LLC3 Jan 202312 Nov 20253 Jan 2026
686stephysmarket.comGoDaddy.com, LLC3 Jan 202313 Nov 20253 Jan 2026
687stephysbarandgrill.comDomain.com, LLC5 Jan 202318 Feb 20255 Jan 2025
688stephyoungyoga.comNameCheap, Inc.6 Jan 202316 Jan 20266 Jan 2027
689stephyglow.blogAutomattic Inc.1 Feb 202230 Mar 20221 Feb 2023
690stephyan.comGoDaddy.com, LLC15 Jan 202326 Feb 202515 Jan 2025
691stephytracking.app1&1 Internet AG9 Jun 202110 Oct 20259 Jun 2026
692stephytrackingonline.app1&1 Internet AG9 Jun 20218 Oct 20259 Jun 2026
693stephyjay.blogAutomattic Inc.22 Nov 201621 Nov 202522 Nov 2026
694stephywray.blogAutomattic Inc.29 Sep 201821 Nov 202529 Sep 2026
695stephyroseboutique.comGoDaddy.com, LLC25 Jan 20238 Mar 202525 Jan 2025
696stephyauto.ca-26 Sep 201410 Nov 202526 Sep 2026
697stephydaily.comAmazon Registrar, Inc.5 Mar 202418 Apr 20265 Mar 2026
698stephyttravels.comGoDaddy.com, LLC12 Sep 201724 Nov 202512 Sep 2025
699stephymiller.comLiquidNet Ltd.8 Jan 20139 Jan 20258 Jan 2025
700stephyniemalik.comGoDaddy.com, LLC13 Mar 201814 Mar 202513 Mar 2027
701stephysanacion.comWix.com Ltd.14 Feb 202327 Mar 202514 Feb 2025
702stephyong.comGoDaddy.com, LLC13 Sep 201714 Sep 202313 Sep 2024
703stephymakdad.comGoDaddy.com, LLC24 Jul 20174 Sep 202424 Jul 2024
704stephys-giftshop.be-18 Nov 2022--
705stephycarrillom.comGoDaddy.com, LLC4 Mar 201711 Mar 20264 Mar 2027
706stephyjosh.tvDynadot, LLC27 Nov 202227 Nov 202427 Nov 2024
707stephysimplified.comGoDaddy.com, LLC30 Jan 202231 Jan 202630 Jan 2028
708stephydavid.comGoDaddy.com, LLC21 Feb 20234 Apr 202521 Feb 2025
709stephymacphotography.comGoDaddy.com, LLC1 Sep 20171 Sep 20251 Sep 2026
710stephymac.comGoDaddy.com, LLC1 Sep 20171 Sep 20251 Sep 2026
711stephypnose.comNetwork Solutions, LLC2 Aug 20173 Jul 20252 Aug 2026
712stephyaglowup.comGoDaddy.com, LLC28 Feb 202312 May 202528 Feb 2025
713stephyourgoalsup.comGoDaddy.com, LLC6 Jan 20186 Jan 20266 Jan 2027
714stephyveedesigns.onlineSynergy Wholesale Pty Ltd10 Mar 202320 May 202410 Mar 2024
715stephyhilmerphotography.comNamesilo, LLC5 Mar 20186 Mar 20265 Mar 2027
716stephydelarosa.comGoDaddy.com, LLC19 May 201831 Jul 202319 May 2023
717stephydesignhk.comHiChina Zhicheng Technology Limited25 Mar 202025 Jan 202425 Mar 2027
718stephydesign.comNameCheap, Inc.8 Jun 20202 Jun 20238 Jun 2026
719stephyschofield.comAutomattic Inc.18 Mar 202318 Mar 202318 Mar 2024
720stephyogaandhealing.comWix.com Ltd.4 Aug 202014 Oct 20244 Aug 2024
721stephymaes.comWix.com Ltd.5 Sep 20206 Aug 20235 Sep 2026
722stephybeck-academy.comNameCheap, Inc.20 Sep 202021 Aug 202520 Sep 2026
723stephypethome.comNamesilo, LLC20 Mar 202325 May 202420 Mar 2024
724stephyphotography.comWix.com Ltd.8 Dec 20208 Dec 20258 Dec 2026
725stephylechat.comWix.com Ltd.17 Dec 20206 Dec 202417 Dec 2026
726stephyhogan.comTucows Domains Inc.3 Jan 202119 Dec 20253 Jan 2027
727stephybrian2021.comNameCheap, Inc.13 Mar 202125 May 202313 Mar 2023
728stephysketch.comWix.com Ltd.28 Mar 202128 Feb 202428 Mar 2027
729stephyhou.comGoDaddy.com, LLC1 Apr 20212 Apr 20261 Apr 2027
730stephywhefy.comGoDaddy.com, LLC20 May 202121 May 202520 May 2027
731stephypk.comGoDaddy.com, LLC25 May 20216 Aug 202425 May 2024
732stephyleonfilm.comGoDaddy.com, LLC19 Jun 202131 Aug 202319 Jun 2023
733stephyale.comGoDaddy.com, LLC29 Jun 202110 Sep 202329 Jun 2023
734stephyphilip.comGoDaddy.com, LLC31 Mar 202312 May 202431 Mar 2024
735stephynoblesbeanscommunity.comOmnis Network, LLC1 Apr 20231 Apr 20261 Apr 2027
736stephyoon.com-22 Oct 20256 Mar 202622 Oct 2026
737stephyhengrealtor.comGoDaddy.com, LLC29 Sep 20214 Oct 202429 Sep 2025
738stephyjaneboutique.comWix.com Ltd.12 Oct 202122 Dec 202312 Oct 2023
739stephycopy.comNameCheap, Inc.4 Apr 202316 May 20244 Apr 2024
740stephyaglow.comGoDaddy.com, LLC25 Oct 20216 Jan 202425 Oct 2023
741stephysvnchez.comGoDaddy.com, LLC28 Oct 20219 Dec 202428 Oct 2024
742stephybethcreative.comSquarespace Domains LLC29 Nov 202129 Jan 202429 Nov 2023
743stephyjinesh.comGoDaddy.com, LLC9 Dec 202120 Feb 20249 Dec 2023
744stephysgiftshop.be-23 Aug 2022--
745stephyspinoso.com1API GmbH6 Apr 202311 Apr 20266 Apr 2027
746stephyleeofficial.comKey-Systems GmbH18 Mar 202518 Mar 202618 Mar 2027
747stephygreensffl.comWix.com Ltd.22 Dec 20212 Mar 202422 Dec 2023
748stephystreats.comSquarespace Domains LLC31 Dec 202126 Dec 202531 Dec 2026
749stephyrealtor.comGoDaddy.com, LLC4 Feb 20225 Feb 20264 Feb 2027
750stephyseduction.comFastDomain Inc.30 Aug 202312 Oct 202430 Aug 2024
751stephyoga91.comWix.com Ltd.15 Feb 202228 Mar 202515 Feb 2025
752stephyeignacio.comEstrategias WebSite S.L.17 Mar 202227 Apr 202317 Mar 2023
753stephyandvarun.comGoDaddy.com, LLC29 Mar 202210 Jun 202429 Mar 2024
754stephyandcasey.comWix.com Ltd.2 Apr 20226 Apr 20242 Apr 2025
755stephy520.comGoDaddy.com, LLC16 May 202227 Jun 202416 May 2024
756stephymassagetherapist.comGoDaddy.com, LLC29 May 202210 Jul 202329 May 2023
757stephysbusybeeboxes.comWix.com Ltd.3 Jun 202213 Aug 20243 Jun 2024
758stephysaysshop.comTucows Domains Inc.10 Jun 202221 Jul 202310 Jun 2023
759stephystuff.comGoDaddy.com, LLC18 Jun 202230 Aug 202318 Jun 2023
760stephytrinh.comGoogle, Inc.28 Jun 202213 Jun 202528 Jun 2026
761stephyjos.comGoogle, Inc.3 Jul 20221 Sep 20243 Jul 2024
762stephyjavi.comGoDaddy.com, LLC7 Jul 202218 Sep 20237 Jul 2023
763stephytrackingonline.dev1&1 Internet AG30 Jun 20218 Oct 202530 Jun 2026
764stephyleecutting.comGoDaddy.com, LLC15 Apr 202316 Apr 202615 Apr 2027
765stephys-abbigliamento.it-28 Oct 201310 Dec 202510 Dec 2026
766stephyandmanik.comSquarespace Domains LLC20 Apr 20236 Apr 202620 Apr 2027
767stephysijojohn.comWix.com Ltd.20 Apr 202331 May 202520 Apr 2025
768stephybrackel.nl-16 Jun 202214 Jun 2023-
769stephyandblesson.comWix.com Ltd.24 Apr 20234 Jun 202424 Apr 2024
770stephyeatsfood.nlMijn InternetOplossing B.V.10 Oct 20169 Jan 2023-
771stephycoaching.nl-17 Apr 20242 Jul 2024-
772stephyingling.comGoDaddy.com, LLC26 Apr 202326 Apr 202326 Apr 2024
773stephyhansen.comWix.com Ltd.26 Apr 202327 Mar 202526 Apr 2027
774stephybeach32lifesabeach.comFastDomain Inc.29 Apr 202311 Jun 202429 Apr 2024
775stephyz.shopNameCheap, Inc.15 Aug 202329 Jan 202415 Aug 2024
776stephymariana.comNeubox Internet S.A. de C.V.3 May 20234 May 20243 May 2025
777stephyshouseofcraft.co.uk-12 Nov 202026 Jul 202312 Nov 2023
778stephyhugo.weddingGoDaddy.com, LLC21 Dec 20211 Feb 202621 Dec 2025
779stephyoliveros.comGoDaddy.com, LLC12 May 202316 May 202512 May 2026
780stephykiss.comGoDaddy.com, LLC17 May 202328 Jul 202417 May 2024
781stephyharmon.proPorkbun, LLC21 May 20232 Jul 202421 May 2024
782stephyjayy.orgWild West Domains, LLC6 Jun 202318 Jun 20246 Jun 2025
783stephytrackingonline.us1&1 Internet AG26 Aug 201110 Oct 202525 Aug 2026
784stephyscosmetixs.comTucows Domains Inc.13 Jun 202324 Aug 202413 Jun 2024
785stephyyorkies.comLaunchpad, Inc.20 Jun 202320 Aug 202320 Jun 2024
786stephythegr8.comDROPCATCH.COM 844 LLC29 Jun 202320 Dec 202529 Jun 2026
787stephyounique.co.uk-1 Jun 20196 Jun 20231 Jun 2023
788stephypesolutions.comPromo People inc.1 Jul 202324 Jun 20251 Jul 2026
789stephystreet.comregister.com, Inc.3 Jul 202315 Aug 20243 Jul 2024
790stephygerwedding.comNameCheap, Inc.4 Jul 20235 Jul 20244 Jul 2025
791stephypublisher.comGoDaddy.com, LLC4 Jul 202315 Aug 20244 Jul 2024
792stephyfit.comGoogle, Inc.5 Jul 202321 Jun 20255 Jul 2026
793stephytravel-tourism.comPSI-USA, Inc. dba Domain Robot12 Jul 202326 Sep 202512 Jul 2026
794stephykitchen.comAmazon Registrar, Inc.13 Jul 20238 Jun 202513 Jul 2026
795stephyluislaboda.comWix.com Ltd.17 Jul 202317 Jun 202517 Jul 2026
796stephyen.infoNameCheap, Inc.19 Jul 202330 Aug 202419 Jul 2024
797stephysicans.comGoDaddy.com, LLC20 Jul 202320 Jul 202320 Jul 2024
798stephypeq.linkDynadot, LLC26 Jul 20234 Sep 202426 Jul 2024
799stephynaturopathe.com1&1 Internet AG29 Jul 202311 Oct 202429 Jul 2024
800stephy-naturopathe.com1&1 Internet AG29 Jul 202311 Oct 202429 Jul 2024
801stephy-naturopathie.com1&1 Internet AG29 Jul 20238 Aug 202529 Jul 2026
802stephynaturopathie.com1&1 Internet AG29 Jul 202311 Oct 202429 Jul 2024
803stephybeesanchez.storeTucows Domains Inc.4 Aug 202314 Oct 20244 Aug 2024
804stephypicks.comGoDaddy.com, LLC8 Aug 202313 Aug 20258 Aug 2026
805stephyom.comGandi SAS19 Jul 202520 Jul 202520 Jul 2026
806stephydesir.comNameCheap, Inc.13 Aug 202325 Oct 202413 Aug 2024
807stephychen.comGoDaddy.com, LLC18 Oct 202419 Oct 202518 Oct 2026
808stephycgreen.comGoogle, Inc.18 Aug 20233 Aug 202518 Aug 2026
809stephyblissfulincome.comGoDaddy.com, LLC18 Aug 202329 Sep 202418 Aug 2024
810stephyhertin.comWix.com Ltd.23 Aug 20233 Oct 202423 Aug 2024
811stephytangy.comGoDaddy.com, LLC25 Aug 202326 Aug 202525 Aug 2027
812stephyjoydesign.comSquarespace Domains LLC18 Sep 202330 Oct 202518 Sep 2025
813stephytech.comNameCheap, Inc.18 Sep 202319 Aug 202518 Sep 2026
814stephyshells.comGoDaddy.com, LLC20 Sep 20231 Nov 202420 Sep 2024
815stephydiaries.comGoDaddy.com, LLC19 Sep 202319 Sep 202319 Sep 2026
816stephyrojaphotography.com1&1 Internet AG15 Oct 202320 Dec 202515 Oct 2025
817stephystexastreasures.comWix.com Ltd.15 Oct 202320 Sep 202515 Oct 2027
818stephyshady.onlineHostinger, UAB20 Oct 20233 Dec 202420 Oct 2024
819stephysolutions.comGoDaddy.com, LLC20 Oct 202318 Nov 202420 Oct 2024
820stephytheaffiliate.comNameCheap, Inc.28 Oct 20239 Jan 202528 Oct 2024
821stephytrentoncleaning.comGoDaddy.com, LLC29 Oct 20239 Dec 202429 Oct 2024
822stephyhartmann.comHello Internet Corp.3 Nov 202313 Jan 20253 Nov 2024
823stephyintheworld.onlineGoDaddy.com, LLC10 Nov 202322 Dec 202410 Nov 2024
824stephyanns.comTucows Domains Inc.21 Nov 20231 Jan 202521 Nov 2024
825stephyintheworld.buzzPorkbun, LLC14 Dec 202327 Jan 202514 Dec 2024
826stephyintheworld.digitalPorkbun, LLC14 Dec 202326 Feb 202514 Dec 2024
827stephycole.comeNom, Inc.16 Dec 202327 Feb 202516 Dec 2024
828stephystylebeauty.comGoDaddy.com, LLC21 Dec 202321 Dec 202321 Dec 2026
829stephybeautybar.comTucows Domains Inc.22 Dec 202326 Dec 202422 Dec 2025
830stephyselection.comGoDaddy.com, LLC28 Dec 202311 Mar 202528 Dec 2024
831stephysselection.comGoDaddy.com, LLC28 Dec 202311 Mar 202528 Dec 2024
832stephybush.comSquarespace Domains LLC5 Jan 202416 Feb 20255 Jan 2025
833stephyas-coaching.comWix.com Ltd.8 Jan 202418 Feb 20268 Jan 2026
834stephylernerlcsw.comEpik Inc.11 Jan 202412 Jan 202611 Jan 2025
835stephyschreiber.comWix.com Ltd.26 Jan 202430 Jan 202526 Jan 2026
836stephyoungren.comSquarespace Domains LLC2 Feb 202418 Jan 20262 Feb 2027
837stephyandmesut.comWix.com Ltd.9 Feb 202422 Mar 20259 Feb 2025
838stephyveedesigns.au--19 Feb 2026-
839stephycreations.comTucows Domains Inc.11 Feb 202424 Mar 202511 Feb 2025
840stephychow.proNameCheap, Inc.25 Feb 202426 Jan 2025-
841stephysfashion.comTucows Domains Inc.9 Mar 202423 Feb 20269 Mar 2027
842stephydiverssarl.comLigne Web Services SARL5 Mar 20245 Mar 20245 Mar 2025
843stephyjayenergy.comGoDaddy.com, LLC7 Mar 202417 Apr 20257 Mar 2025
844stephystickys.comSquarespace Domains LLC9 Mar 202422 Feb 20269 Mar 2027
845stephysstickies.comSquarespace Domains LLC9 Mar 202422 Feb 20269 Mar 2027
846stephymahoney.comGoDaddy.com, LLC13 Mar 202425 Mar 202613 Mar 2027
847stephynabello.comWix.com Ltd.14 Mar 202424 Apr 202614 Mar 2026
848stephyinez.comName.com, Inc.17 Mar 202412 Apr 202617 Mar 2026
849stephysketches.comSquarespace Domains LLC26 Mar 202410 Aug 202426 Mar 2028
850stephygerardo.comNeubox Internet S.A. de C.V.6 Apr 202416 Jun 20256 Apr 2025
851stephytoh.comWix.com Ltd.11 Apr 202415 Apr 202511 Apr 2026
852stephyscissorhands.comPorkbun, LLC17 Apr 202416 Apr 202617 Apr 2027
853stephycastrillon.comGoDaddy.com, LLC17 Apr 202418 Apr 202617 Apr 2027
854stephynialimongello.comHostinger, UAB20 Apr 202420 Apr 202420 Apr 2027
855stephyabrahamwedding.comGoDaddy.com, LLC22 Apr 20243 Jun 202522 Apr 2025
856stephypink.comGoDaddy.com, LLC25 Apr 202425 Apr 202425 Apr 2025
857stephyscups.comGoDaddy.com, LLC26 Apr 202426 Apr 202526 Apr 2026
858stephystumblers.comGoDaddy.com, LLC26 Apr 20246 Jun 202526 Apr 2025
859stephysmugs.comGoDaddy.com, LLC26 Apr 20246 Jun 202526 Apr 2025
860stephy-moeller.de--25 Nov 2025-
861stephyswelt.de--21 Apr 2023-
862stephyalain.comHostinger, UAB3 May 20246 Apr 20253 May 2026
863stephynia.comHostinger, UAB8 May 20248 May 20248 May 2027
864stephythedoula.comCloudFlare, Inc.20 May 202426 Sep 202520 May 2026
865stephykayaks.co.uk-24 May 202423 Apr 202524 May 2026
866stephycrafts.comGoDaddy.com, LLC29 May 20247 Jul 202529 May 2026
867stephysphotography.comGoDaddy.com, LLC1 Jun 20241 Jun 20241 Jun 2026
868stephyai.comTucows Domains Inc.31 May 202419 Jul 202531 May 2026
869stephydandrobg.weddingeNom, Inc.1 Jun 202414 Oct 20251 Jun 2026
870stephymusic.comWix.com Ltd.4 Jun 20245 May 20254 Jun 2026
871stephycreations.storeTucows Domains Inc.7 Jun 202418 Jul 20257 Jun 2025
872stephyscreation.comGoogle, Inc.7 Jun 202423 May 20257 Jun 2026
873stephyfintige.comGoDaddy.com, LLC12 Jun 202424 Jul 202512 Jun 2025
874stephylou.comTucows Domains Inc.29 Jun 20243 Jul 202529 Jun 2026
875stephygirl.comGoDaddy.com, LLC12 Jul 202414 Jul 202512 Jul 2026
876stephysunique.comGoDaddy.com, LLC25 Jul 202425 Jul 202425 Jul 2027
877stephyschiller.comSquarespace Domains LLC28 Jul 202413 Jul 202528 Jul 2026
878stephyin.meNameCheap, Inc.7 Aug 201921 Sep 20257 Aug 2026
879stephyounkin.artPorkbun, LLC31 Jul 202412 Aug 202531 Jul 2026
880stephynsolking.onlineHostinger, UAB2 Aug 20243 Aug 20252 Aug 2026
881stephysgstore.comTucows Domains Inc.5 Aug 20249 Aug 20255 Aug 2026
882stephypanizo.comGoDaddy.com, LLC12 Aug 202413 Aug 202512 Aug 2026
883stephyhector.comSquarespace Domains LLC13 Aug 202425 Oct 202513 Aug 2025
884stephyoga.co.uk-4 Sep 20244 Sep 20244 Sep 2026
885stephylewtiffybear.comCloudFlare, Inc.14 Sep 202424 Oct 202514 Sep 2025
886stephyspixellab.comTucows Domains Inc.15 Sep 202426 Oct 202515 Sep 2025
887stephyystyles.comregister.com, Inc.19 Sep 20241 Nov 202519 Sep 2025
888stephytracking.email1&1 Internet AG23 Sep 20247 Nov 202523 Sep 2026
889stephy-rodriguez.com-24 Sep 202424 Sep 202524 Sep 2026
890stephycamacho.comGoDaddy.com, LLC24 Sep 20246 Oct 202524 Sep 2026
891stephyanntomystore.comTucows Domains Inc.1 Oct 20245 Oct 20251 Oct 2026
892stephyshauls.comWild West Domains, LLC8 Oct 20248 Oct 20258 Oct 2026
893stephytayo.clickAmazon Registrar, Inc.11 Oct 202424 Dec 202511 Oct 2025
894stephylovisolo.comGoDaddy.com, LLC11 Oct 202412 Oct 202511 Oct 2026
895stephyscleaning.comGoogle, Inc.15 Oct 202430 Sep 202515 Oct 2026
896stephytony.comName.com, Inc.18 Oct 20241 Dec 202518 Oct 2025
897stephysoulyoga.comSquarespace Domains LLC8 Nov 20243 Nov 20258 Nov 2026
898stephyi.storeDOTSERVE INC.24 Nov 202430 Jan 202624 Nov 2025
899stephykatzsensoryplay.comTucows Domains Inc.30 Nov 202418 Nov 202530 Nov 2026
900stephyourhomegirl.comGoDaddy.com, LLC9 Dec 202420 Feb 20269 Dec 2025
901stephyra-home.ovhOVH sas15 Dec 20249 Feb 202615 Dec 2026
902stephymaussant.comAutomattic Inc.16 Dec 202426 Nov 202516 Dec 2026
903stephypaul.comHostinger, UAB3 Jan 202515 Feb 20263 Jan 2026
904stephybussiness.storeDOTSERVE INC.7 Jan 202513 Feb 20267 Jan 2026
905stephylv.comHosting Concepts B.V. dba Openprovider15 Jan 202527 Jan 202615 Jan 2027
906stephyhayco.comCloudFlare, Inc.16 Jan 202517 Dec 202516 Jan 2027
907stephymaddymusic.comNamesilo, LLC16 Jan 202528 Mar 202616 Jan 2026
908stephyslegacy.comGoDaddy.com, LLC17 Jan 202527 Jun 202517 Jan 2026
909stephype.comDropCatch.com 1130 LLC12 Apr 202612 Apr 202612 Apr 2027
910stephybodysculpting.comGoDaddy.com, LLC26 Jan 202526 Jan 202526 Jan 2028
911stephyue.comNameCheap, Inc.30 Jan 202530 Jan 202530 Jan 2030
912stephyu.devNameCheap, Inc.8 Jan 202517 Dec 2025-
913stephyo.clickTucows Domains Inc.4 Feb 202513 Jan 20264 Feb 2027
914stephymaddymerch.comregister.com, Inc.8 Feb 202525 Jan 20268 Feb 2027
915stephylouconsulting.comGoDaddy.com, LLC16 Feb 202521 Feb 202616 Feb 2027
916stephymathew.co.uk-17 Feb 202514 Feb 202617 Feb 2027
917stephyatthriftalicious.orgGoDaddy.com, LLC28 Feb 202512 Mar 202628 Feb 2027
918stephypublishers.infoNameCheap, Inc.12 Mar 2025--
919stephypublishers.orgNameCheap, Inc.12 Mar 202512 Mar 202612 Mar 2027
920stephyandjhuva.comNameCheap, Inc.17 Mar 202517 Mar 202617 Mar 2026
921stephycouture.comTucows Domains Inc.21 Mar 202514 Mar 202621 Mar 2027
922stephyaffiliate.comGoDaddy.com, LLC4 Apr 20255 Apr 20264 Apr 2027
923stephymome.comGoDaddy.com, LLC18 Apr 202525 Apr 202618 Apr 2027
924stephytrendy.storeNetwork Solutions, LLC26 Apr 20251 May 202526 Apr 2026
925stephygirl.storeName.com, Inc.28 Apr 20251 Jun 202528 Apr 2026
926stephyscorner.comTucows Domains Inc.8 May 20252 Sep 20258 May 2026
927stephyscosmetiqueboutique.comTucows Domains Inc.13 May 202513 May 202513 May 2026
928stephygraves.comGoDaddy.com, LLC20 May 202520 May 202520 May 2026
929stephyb-coiffure.frRealtime Register B.V.7 Sep 202316 Aug 20257 Sep 2026
930stephysbeauty-shop.comLigne Web Services SARL22 May 202523 May 202522 May 2026
931stephytreras.spaceNameCheap, Inc.24 May 20251 Jun 202524 May 2026
932stephydilu.comGoDaddy.com, LLC3 Jun 20253 Jun 20253 Jun 2028
933stephychris.comGoDaddy.com, LLC18 Jun 202518 Jun 202518 Jun 2026
934stephystechshop.storeDOTSERVE INC.29 Jun 20251 Aug 202529 Jun 2026
935stephyd123.contactAutomattic Inc.3 Jul 202527 Nov 20253 Jul 2026
936stephyddesignsco.comGoDaddy.com, LLC10 Jul 202510 Jul 202510 Jul 2027
937stephychenaffiliatemarketing.comNordreg AB20 Jul 202520 Jul 202520 Jul 2026
938stephybytheshore.comNameCheap, Inc.24 Jul 202524 Jul 202524 Jul 2026
939stephyaldanaperiodismodigital.comHostinger, UAB27 Jul 202527 Jul 202527 Jul 2026
940stephyforum.cn-11 Jul 2025-11 Jul 2026
941stephyoungcoach.comGoDaddy.com, LLC4 Aug 20254 Aug 20254 Aug 2028
942stephyshop.onlineGoDaddy.com, LLC5 Aug 202519 Mar 20265 Aug 2026
943stephytfrancies.comGoDaddy.com, LLC5 Aug 20255 Aug 20255 Aug 2026
944stephyjarrin.comGoDaddy.com, LLC12 Aug 202512 Aug 202512 Aug 2026
945stephyj.neteNom, Inc.22 Aug 20257 Mar 202622 Aug 2026
946stephyjayy.comWild West Domains, LLC11 Sep 202511 Sep 202511 Sep 2026
947stephyao.comPorkbun, LLC16 Sep 202516 Sep 202516 Sep 2026
948stephyonpurpose.comHostinger, UAB16 Sep 202516 Sep 202516 Sep 2026
949stephyfunding.comNameCheap, Inc.18 Sep 202518 Sep 202518 Sep 2026
950stephydigital.comGoDaddy.com, LLC21 Sep 202521 Sep 202521 Sep 2026
951stephylongueira.comGoDaddy.com, LLC22 Sep 202522 Sep 202522 Sep 2028
952stephyfunds.comNameCheap, Inc.26 Sep 202526 Sep 202526 Sep 2028
953stephyna.comInterNetworX Ltd. & Co. KG3 Oct 202516 Dec 20253 Oct 2026
954stephyz.linkPorkbun, LLC5 Oct 202510 Oct 20255 Oct 2026
955stephyskraftattic.comTucows Domains Inc.7 Oct 20256 Jan 20267 Oct 2026
956stephyxo.linkPorkbun, LLC21 Oct 20254 Nov 202521 Oct 2026
957stephyfitx.comWix.com Ltd.23 Oct 202523 Oct 202523 Oct 2026
958stephyinzhao.comCloudFlare, Inc.31 Oct 20257 Nov 202531 Oct 2026
959stephyrul.de--28 Oct 2025-
960stephyocean.comGoDaddy.com, LLC5 Nov 202516 Nov 20255 Nov 2026
961stephy-braiding.comWild West Domains, LLC5 Nov 20255 Nov 20255 Nov 2026
962stephynours.comAutomattic Inc.12 Nov 202523 Nov 202512 Nov 2026
963stephypnosis.storeGoDaddy.com, LLC14 Nov 202524 Dec 202514 Nov 2026
964stephypnosis.infoGoDaddy.com, LLC14 Nov 202519 Nov 202514 Nov 2026
965stephypnosis.comGoDaddy.com, LLC14 Nov 202514 Nov 202514 Nov 2028
966stephypnosisart.comGoDaddy.com, LLC14 Nov 202514 Nov 202514 Nov 2028
967stephypnosis.netGoDaddy.com, LLC14 Nov 202514 Nov 202514 Nov 2026
968stephyester.comSquarespace Domains LLC15 Nov 202515 Nov 202515 Nov 2028
969stephyuen.comGoogle, Inc.2 Dec 202517 Dec 20252 Dec 2026
970stephy100.comHostinger, UAB5 Dec 20255 Jan 20265 Dec 2027
971stephypesneakers.storeHostinger, UAB22 Dec 202527 Dec 202522 Dec 2026
972stephybraidinghouse.hair-29 Dec 20253 Feb 202629 Dec 2026
973stephykitchen237.comTucows Domains Inc.31 Dec 202531 Dec 202531 Dec 2026
974stephyborgesbooks.comName.com, Inc.5 Jan 20265 Jan 20265 Jan 2027
975stephysfloralsandgifts.comAutomattic Inc.6 Jan 20266 Jan 20266 Jan 2027
976stephychavez.comGoogle, Inc.7 Jan 20267 Jan 20267 Jan 2027
977stephystreat.comGoDaddy.com, LLC14 Jan 202614 Jan 202614 Jan 2027
978stephychendemo.comGoDaddy.com, LLC17 Jan 202617 Jan 202617 Jan 2027
979stephysio.fitGoDaddy.com, LLC22 Jan 202623 Mar 202622 Jan 2027
980stephy-wong.comHostinger, UAB27 Jan 202627 Jan 202627 Jan 2027
981stephyskitchen.storeNameCheap, Inc.3 Feb 20261 Mar 20263 Feb 2027
982stephyweb.comHostinger, UAB3 Feb 20263 Feb 20263 Feb 2027
983stephysanti.comPorkbun, LLC3 Feb 20263 Feb 20263 Feb 2027
984stephys1107.comName.com, Inc.4 Feb 20264 Feb 20264 Feb 2027
985stephyrose.comGoogle, Inc.6 Feb 20266 Feb 20266 Feb 2027
986stephyromestudio.comGoDaddy.com, LLC13 Feb 202613 Feb 202613 Feb 2027
987stephygabi.com1&1 Internet AG14 Mar 202614 Mar 202614 Mar 2027
988stephygabi.info1&1 Internet AG14 Mar 202614 Mar 202614 Mar 2027
989stephygabi.store1&1 Internet AG14 Mar 202614 Mar 202614 Mar 2027
990stephyforum.comDOMAIN ORIENTAL LIMITED27 Mar 202627 Mar 202627 Mar 2027
991stephyjin.comNamesilo, LLC30 Mar 202630 Mar 202630 Mar 2029
992stephyannstylist.comMelbourne IT, Ltd2 Apr 20262 Apr 20262 Apr 2028
993stephyqueenie.comCloudFlare, Inc.22 Apr 202622 Apr 202622 Apr 2027
994stephyqueen.comCloudFlare, Inc.28 Apr 202628 Apr 202628 Apr 2027
995stephyvalenzuelaportfolio.comHosting Concepts B.V. dba Openprovider30 Apr 202630 Apr 202630 Apr 2027
996stephyhsu.spaceNameCheap, Inc.2 May 20262 May 20262 May 2031

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=stephy

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now