With support for 
Keyword: STEAMVALLEY
Reverse Whois » KEYWORD [steamvalley ] { 21 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | steamvalley.net | Network Solutions, LLC | 23 May 2011 | 10 Feb 2025 | 23 May 2025 |
| 2 | steamvalley.fr | - | 23 Nov 2019 | 4 Feb 2021 | 23 Nov 2022 |
| 3 | steamvalley.com | Naugus Limited LLC | 18 May 1999 | 1 Apr 2025 | 18 May 2025 |
| 4 | steamvalley.org | Network Solutions, LLC | 22 Jan 2022 | 5 Mar 2024 | 22 Jan 2024 |
| 5 | steamvalley.coffee | 1&1 Internet AG | 12 Jul 2023 | 12 Jul 2024 | 12 Jul 2025 |
| 6 | steamvalley.co.uk | - | 12 Jul 2023 | 27 May 2024 | 12 Jul 2024 |
| 7 | steamvalley.cl | - | 27 Aug 2019 | - | 27 Aug 2026 |
| 8 | steamvalley.us | Domain.com, LLC | 8 Apr 2021 | 24 May 2023 | 8 Apr 2026 |
| 9 | steamvalleysoaps.com | eNom, Inc. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 10 | steamvalleyfarms.com | Launchpad, Inc. | 12 Jul 2016 | 27 Jun 2024 | 12 Jul 2025 |
| 11 | steamvalleyfiber.com | GoDaddy.com, LLC | 20 Jul 2000 | 26 Apr 2023 | 20 Jul 2025 |
| 12 | steamvalleybiblechurch.com | Namesilo, LLC | 8 Mar 2012 | 15 Jan 2025 | 8 Mar 2026 |
| 13 | steamvalleyproductions.com | Realtime Register B.V. | 15 Feb 2017 | 22 Jan 2025 | 15 Feb 2026 |
| 14 | steamvalleycarpetcleaning.com | Tucows Domains Inc. | 10 Apr 2017 | 14 Apr 2018 | 10 Apr 2018 |
| 15 | steamvalleyoutdoors.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 May 2017 | 28 Jul 2017 | 28 May 2018 |
| 16 | steamvalleycommunications.com | GoDaddy.com, LLC | 10 Nov 2017 | 14 Nov 2023 | 10 Nov 2033 |
| 17 | steamvalleysports.com | GoDaddy.com, LLC | 17 Feb 2023 | 18 Feb 2025 | 17 Feb 2027 |
| 18 | steamvalleycoffee.com | 1&1 Internet AG | 12 Jul 2023 | 24 Aug 2024 | 12 Jul 2024 |
| 19 | steamvalleycoffee.co.uk | - | 12 Jul 2023 | 27 May 2024 | 12 Jul 2024 |
| 20 | steamvalleyfinancialplanning.com | Squarespace Domains LLC | 10 Jan 2024 | 21 Feb 2025 | 10 Jan 2025 |
| 21 | steamvalleyfp.com | Squarespace Domains LLC | 10 Jan 2024 | 21 Feb 2025 | 10 Jan 2025 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=steamvalley
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |