With support for 
Keyword: SRIP
Reverse Whois » KEYWORD [srip ] { 2,998 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | srip.info | Dynadot, LLC | 10 Aug 2021 | 10 Aug 2021 | 10 Aug 2022 |
| 2 | srip.club | Uniregistrar Corp | 27 Nov 2015 | 27 Nov 2015 | 26 Nov 2016 |
| 3 | srip.com | eNom, Inc. | 28 Oct 2011 | 29 Sep 2025 | 28 Oct 2026 |
| 4 | srip.xyz | GMO Internet Inc. | 28 Aug 2025 | 3 Sep 2025 | 28 Aug 2026 |
| 5 | srip.top | Chengdu West Dimension Digital Technology Co., Ltd… | 15 Feb 2016 | - | 15 Feb 2017 |
| 6 | srip.wang | eName Technology Co., Ltd. | 1 Mar 2016 | 1 Mar 2016 | 1 Mar 2017 |
| 7 | srip.net | MarkMonitor Inc. | 8 Jul 2005 | 6 Jun 2025 | 8 Jul 2026 |
| 8 | srip.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 10 Nov 2016 | 12 Jun 2017 | 9 Nov 2017 |
| 9 | srip.org | Tucows Domains Inc. | 16 Aug 2017 | 6 Aug 2025 | 16 Aug 2026 |
| 10 | srip.ltd | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 12 Sep 2017 | 12 Sep 2017 | 12 Sep 2018 |
| 11 | srip.co.uk | - | 10 Apr 2012 | 27 Mar 2025 | 10 Apr 2027 |
| 12 | srip.loan | West263 International Limited | 28 Apr 2018 | 28 Apr 2018 | 28 Apr 2019 |
| 13 | srip.chat | Dynadot, LLC | 29 Apr 2024 | 12 Dec 2025 | 29 Apr 2026 |
| 14 | srip.net.cn | - | 3 Aug 2021 | - | 3 Aug 2026 |
| 15 | srip.it | - | 4 Jan 2023 | 19 Jan 2026 | 4 Jan 2026 |
| 16 | srip.blog | Automattic Inc. | 25 Sep 2022 | 8 Dec 2023 | 25 Sep 2023 |
| 17 | srip.com.cn | - | 6 May 2025 | - | 6 May 2026 |
| 18 | srip.scot | 1API GmbH | 25 Feb 2023 | 21 Nov 2025 | 25 Feb 2026 |
| 19 | srip.ca | - | 23 Feb 2012 | 24 Feb 2024 | 23 Feb 2026 |
| 20 | srip.store | Automattic Inc. | 18 Feb 2024 | 2 May 2025 | 18 Feb 2025 |
| 21 | srip.co.nz | - | 11 Feb 2019 | 9 Feb 2025 | - |
| 22 | srip.ru | - | 2 Jan 2025 | - | 2 Jan 2026 |
| 23 | srip.cam | Porkbun, LLC | 20 Sep 2024 | 3 Dec 2025 | 20 Sep 2025 |
| 24 | srip.eu | Realtime Register B.V. | - | - | - |
| 25 | srip.ink | GoDaddy.com, LLC | 25 Jul 2025 | 23 Sep 2025 | 25 Jul 2026 |
| 26 | sriprakash.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Dec 2004 | 23 Jan 2024 | 9 Dec 2027 |
| 27 | sripanwa.co.th | - | 18 May 2007 | 2 Sep 2024 | 17 May 2027 |
| 28 | sripiboon.com | OnlineNIC, Inc. | 12 Jan 2006 | 12 Jan 2006 | 12 Jan 2029 |
| 29 | sripuram.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Jun 2007 | 5 Aug 2025 | 21 Jun 2026 |
| 30 | sriputgold.com | Network Solutions, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 31 | sripanwa.com | GoDaddy.com, LLC | 1 Apr 2004 | 2 Sep 2024 | 1 Apr 2026 |
| 32 | sriprembaba.org | Dynadot, LLC | 4 Mar 2009 | 18 Apr 2025 | 4 Mar 2026 |
| 33 | sripadmachakram.com | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 34 | sriperumbudur.com | Dynadot, LLC | 24 May 2006 | 3 Dec 2025 | 24 May 2026 |
| 35 | sripavancomputers.com | GoDaddy.com, LLC | 27 May 2025 | 27 May 2025 | 27 May 2027 |
| 36 | sripandianindustries.com | Good Domain Registry Pvt Ltd. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 37 | sriprakashswamigal.co | GoDaddy.com, LLC | 29 May 2014 | 3 Jun 2015 | 28 May 2015 |
| 38 | sriprathibhajuniorcollege.com | GoDaddy.com, LLC | 30 May 2014 | 31 May 2015 | 30 May 2016 |
| 39 | sriprathyangira.com | Wild West Domains, LLC | 30 May 2013 | 31 May 2015 | 30 May 2016 |
| 40 | sriperumalstainlesssteel.com | Wild West Domains, LLC | 30 May 2014 | 31 May 2015 | 30 May 2016 |
| 41 | sripatham.com | GoDaddy.com, LLC | 1 Feb 2022 | 4 Oct 2022 | 1 Feb 2027 |
| 42 | sripadapackagings.com | Name.com, Inc. | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 43 | sripers.com | GoDaddy.com, LLC | 6 Oct 2022 | 6 Oct 2022 | 6 Oct 2023 |
| 44 | sripatum.com | eNom, Inc. | 17 Apr 2012 | 4 Dec 2025 | 17 Apr 2026 |
| 45 | sripagampriyal.com | GoDaddy.com, LLC | 2 Jul 2019 | 2 Jul 2019 | 2 Jul 2021 |
| 46 | sripd.net | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 47 | sripushpamcollege.com | Go Canada Domains, LLC | 21 Jul 2011 | 1 Jul 2025 | 21 Jul 2026 |
| 48 | sriperumalhomes.com | Good Domain Registry Pvt Ltd. | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 49 | sripowerservices.net | Tucows Domains Inc. | 28 Oct 2011 | 1 Nov 2014 | 28 Oct 2015 |
| 50 | sriprachan.com | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Sep 2019 | 14 Sep 2019 | 14 Sep 2020 |
| 51 | sriprasadh.info | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Nov 2014 | 31 Oct 2017 | 1 Nov 2018 |
| 52 | sripnrbuildersdevelopers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2016 |
| 53 | sripowerservices.org | Tucows Domains Inc. | 28 Oct 2011 | 1 Nov 2014 | 28 Oct 2015 |
| 54 | sripower.org | Tucows Domains Inc. | 28 Oct 2011 | 1 Nov 2014 | 28 Oct 2015 |
| 55 | sripalaraja.com | CV. Jogjacamp | 4 Nov 2014 | - | 4 Nov 2017 |
| 56 | sripa.com | TurnCommerce, Inc. DBA NameBright.com | 26 Apr 2006 | 11 Nov 2025 | 26 Apr 2026 |
| 57 | sripad.info | GoDaddy.com, LLC | 4 Jan 2021 | 11 Jan 2026 | 4 Jan 2027 |
| 58 | sripiamsuk-resort.com | DotArai Co., Ltd. | 18 Aug 2014 | 6 Jul 2025 | 18 Aug 2027 |
| 59 | sripathicleantech.com | Good Domain Registry Pvt Ltd. | 6 Jun 2016 | 22 Jun 2017 | 6 Jun 2018 |
| 60 | sriponnada.com | 1API GmbH | 14 May 2018 | 23 Nov 2025 | 14 May 2026 |
| 61 | sripages.info | GoDaddy.com, LLC | 26 Dec 2014 | 24 Feb 2015 | 26 Dec 2015 |
| 62 | sripages.com | - | 26 Dec 2003 | 2 Dec 2024 | 26 Dec 2025 |
| 63 | sripages.org | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 64 | sriprabudrivingschoolcdm.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 65 | sriputtangul.com | Namesilo, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 66 | sripanditravishankar.com | Network Solutions, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2018 |
| 67 | sripathyassoceates.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 68 | sripachaiyammalrealstate.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 69 | sripaliedu.com | Wild West Domains, LLC | 30 Jan 2017 | 30 Jan 2017 | 30 Jan 2018 |
| 70 | sriphalahealthcare.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 May 2016 | 31 May 2017 | 12 May 2018 |
| 71 | sriplanning.net | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 72 | sriproducts.com | TurnCommerce, Inc. DBA NameBright.com | 30 Jan 2021 | 27 Aug 2021 | 30 Jan 2026 |
| 73 | sripadhachhaya.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2014 | 4 Dec 2014 | 8 Nov 2015 |
| 74 | sripunya.com | Dynadot, LLC | 14 Jul 2021 | 8 Aug 2025 | 14 Jul 2028 |
| 75 | sripetalinghohosteamboat.com | Tucows Domains Inc. | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 76 | sriprlyatex.com | Tucows Domains Inc. | 28 Aug 2014 | 1 Sep 2015 | 28 Aug 2016 |
| 77 | sripadmaraja.com | OnlineNIC, Inc. | 12 Nov 2014 | 12 Nov 2025 | 12 Nov 2026 |
| 78 | sriphumhouse.com | Xin Net Technology Corporation | 30 Jun 2019 | 5 Mar 2021 | 30 Jun 2021 |
| 79 | sripuranam.com | Google, Inc. | 13 Oct 2021 | 13 Oct 2021 | 13 Oct 2022 |
| 80 | sripadmavathibuilders.com | Crazy Domains FZ-LLC | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 81 | sripechiamman.org | CloudFlare, Inc. | 16 Dec 2023 | 19 Dec 2025 | 16 Dec 2026 |
| 82 | sripics.com | Nordreg AB | 10 Jul 2025 | 8 Sep 2025 | 10 Jul 2026 |
| 83 | sripipathairclip.com | Gandi SAS | 31 Aug 2014 | 27 Jul 2017 | 31 Aug 2018 |
| 84 | sripadmalaya.com | Infocom Network Ltd. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 85 | sripdhf.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 86 | sriparajyotisha.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Sep 2014 | 4 Sep 2014 | 3 Sep 2015 |
| 87 | sripadhmaconstructions.com | GoDaddy.com, LLC | 10 Oct 2024 | 21 Nov 2025 | 10 Oct 2025 |
| 88 | sriprachasan.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 89 | sripasumponmasala.com | Crazy Domains FZ-LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 90 | sripragnacma.com | Dynadot, LLC | 31 Dec 2021 | 31 Dec 2021 | 31 Dec 2022 |
| 91 | sripi.com | GoDaddy.com, LLC | 1 Oct 2014 | 2 Oct 2025 | 1 Oct 2026 |
| 92 | sriprakhon-consulting.com | 1&1 Internet AG | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 93 | sriprakhon.com | 1&1 Internet AG | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 94 | sripiriyajewellery.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2014 | 11 Sep 2017 | 10 Sep 2018 |
| 95 | sripachanaapt.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Nov 2014 | 31 Dec 2017 | 19 Nov 2017 |
| 96 | sripydithalliammavaridevasthanam.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Oct 2014 | 20 Oct 2017 | 4 Oct 2018 |
| 97 | sripradu-community.com | OnlineNIC, Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 98 | sripe.info | GoDaddy.com, LLC | 23 Sep 2014 | 24 Sep 2014 | 23 Sep 2015 |
| 99 | sripraswathi.com | GoDaddy.com, LLC | 15 Dec 2021 | 27 Dec 2025 | 15 Dec 2026 |
| 100 | sriprabhagopalan.com | register.com, Inc. | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 101 | sriparvathaneni.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jul 2016 | 15 Mar 2020 | 20 Jul 2020 |
| 102 | sriprachanwattanayont.com | GoDaddy.com, LLC | 18 Oct 2014 | 29 Dec 2023 | 18 Oct 2023 |
| 103 | sriparameswari.com | GoDaddy.com, LLC | 9 Dec 2021 | 10 Dec 2025 | 9 Dec 2026 |
| 104 | sripalee2008.org | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 105 | sriprakashschool.com | GoDaddy.com, LLC | 10 Mar 2017 | 31 Mar 2025 | 10 Mar 2028 |
| 106 | sripipoh.com | NameCheap, Inc. | 16 Nov 2017 | 16 Nov 2017 | 16 Nov 2018 |
| 107 | sripatichandrasekharcompany.com | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 108 | sriparam.com | GoDaddy.com, LLC | 28 Nov 2014 | 8 Jan 2025 | 28 Nov 2024 |
| 109 | sriperfectmoney.com | GoDaddy.com, LLC | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 110 | sripalaniandavartravels.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 111 | sripooman.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 112 | sripragnasara.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 113 | sriparvathiindustries.asia | BigRock Solutions Ltd. | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 114 | sripadmavathihospitals.net | Domainshype.com, Inc. | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 115 | sriperiyanayakiamman.com | BigRock Solutions Ltd. | 16 Feb 2021 | 16 Feb 2021 | 16 Feb 2022 |
| 116 | sripank.com | GoDaddy.com, LLC | 5 Dec 2014 | 3 Jan 2025 | 5 Dec 2034 |
| 117 | sriprathimaschool.com | DropCatch.com 489 LLC | 26 Feb 2016 | 27 Feb 2017 | 26 Feb 2018 |
| 118 | sripr.com | DNSPod, Inc. | 20 Jun 2025 | 20 Jun 2025 | 20 Jun 2026 |
| 119 | sripanchamukhagayatri.org | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 120 | sriprima.com | eNom, Inc. | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 121 | sriprashanth.com | Google, Inc. | 10 Oct 2022 | 11 Oct 2023 | 10 Oct 2024 |
| 122 | sriprathimaschool.net | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 123 | sriprathimaschool.info | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 124 | sripoomanam.com | GoDaddy.com, LLC | 11 Dec 2014 | 22 Feb 2025 | 11 Dec 2024 |
| 125 | sriprathimaschool.org | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 126 | sripvgeneralstore.biz | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 11 Dec 2015 |
| 127 | sripvgeneralstore.info | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 128 | sriprakashautomotors.com | GoDaddy.com, LLC | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 129 | sripvgeneralstore.org | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 130 | sripvgeneralstore.net | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2016 |
| 131 | sripok.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 132 | sriphoto.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2024 | 15 Dec 2029 |
| 133 | sripriimeprinters.com | Eranet International Limited | 26 Apr 2022 | 2 Jun 2023 | 26 Apr 2023 |
| 134 | sripradagroups.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 135 | sriplotsnflats.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 136 | sripadmavathifunds.com | GoDaddy.com, LLC | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 137 | sriparameswaridigital.net | Domainshype.com, Inc. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 138 | sriptsnap.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 139 | sripoju.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 140 | sriparasakthiammantemple.net | Domainshype.com, Inc. | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 141 | sripower-trading.com | Tucows Domains Inc. | 29 Dec 2014 | 2 Jan 2016 | 29 Dec 2016 |
| 142 | sripadaya.com | Porkbun, LLC | 14 Feb 2022 | 27 Apr 2023 | 14 Feb 2023 |
| 143 | sripco.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 15 Apr 2024 | 15 Apr 2024 | 15 Apr 2025 |
| 144 | sripatchaiamman.com | BigRock Solutions Ltd. | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 145 | sripanchvatitravelstours.com | BigRock Solutions Ltd. | 31 Dec 2014 | 30 Dec 2016 | 31 Dec 2017 |
| 146 | sripanwaphuketresort.com | GoDaddy.com, LLC | 1 Jan 2015 | 2 Jan 2026 | 1 Jan 2027 |
| 147 | sripanwamermaids.com | GoDaddy.com, LLC | 1 Jan 2015 | 30 Jul 2025 | 1 Jan 2026 |
| 148 | sriprimapuncak.com | eNom, Inc. | 4 Jan 2015 | 15 Feb 2018 | 4 Jan 2018 |
| 149 | sripartners.capital | NETIM SARL | 17 Jul 2014 | 17 Jul 2014 | 17 Jul 2015 |
| 150 | sripatum.university | eNom, Inc. | 21 Aug 2014 | 11 Mar 2017 | 21 Aug 2020 |
| 151 | sripadavallabha.guru | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 152 | sripathy.photography | Cronon AG | 14 Jan 2015 | 28 Feb 2020 | 14 Jan 2021 |
| 153 | sripondypackaging.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jan 2015 | 7 Jan 2015 | 6 Jan 2016 |
| 154 | sripackiyalakshmiexports.com | Tucows Domains Inc. | 10 Jan 2015 | 14 Jan 2023 | 10 Jan 2023 |
| 155 | sripemmaraju.com | Google, Inc. | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 156 | sriparvathihospital.com | GoDaddy.com, LLC | 7 Jun 2022 | 27 Feb 2025 | 7 Jun 2026 |
| 157 | sriparaasakthiexports.com | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 158 | sripathisathy.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Aug 2015 | 15 Aug 2015 | 15 Aug 2016 |
| 159 | sripat.casa | Minds + Machines Registrar Limited | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 160 | sripat.work | Minds + Machines Registrar Limited | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 161 | sripings.casa | Minds + Machines Registrar Limited | 11 Jun 2015 | 11 Jun 2015 | 11 Jun 2016 |
| 162 | sriperumbudurhotels.review | Alpnames Limited | 3 Jul 2015 | - | 2 Jul 2016 |
| 163 | sripraphai.com | GoDaddy.com, LLC | 17 Jan 2015 | 18 Jan 2025 | 17 Jan 2030 |
| 164 | sripathamtravel.com | GoDaddy.com, LLC | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 165 | sripachaiammanearthmovers.com | GoDaddy.com, LLC | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 166 | sripkstraders.com | GoDaddy.com, LLC | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 167 | sripeedam.com | GoDaddy.com, LLC | 23 Sep 2020 | 23 Sep 2025 | 23 Sep 2026 |
| 168 | sripograms.com | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 169 | sripogram.com | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 170 | sripanchakshari.com | GoDaddy.com, LLC | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 171 | sripadmanabhaswamitemple.com | Tucows Domains Inc. | 6 Sep 2019 | 11 Sep 2020 | 6 Sep 2020 |
| 172 | sripadavallabhacharithamrutham.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 173 | sripadavallabhacharithamrutham.org | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 174 | sriponnumani.com | GoDaddy.com, LLC | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 175 | sripatham.org | GoDaddy.com, LLC | 30 Jan 2015 | 3 Feb 2025 | 30 Jan 2027 |
| 176 | sripadkulkarni.com | BigRock Solutions Ltd. | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 177 | sripadccd.com | GoDaddy.com, LLC | 8 Feb 2015 | 10 Feb 2022 | 8 Feb 2023 |
| 178 | sripadcaitanyacandradas.com | GoDaddy.com, LLC | 8 Feb 2015 | 8 Feb 2015 | 8 Feb 2016 |
| 179 | sriponkovil.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Jun 2025 | 8 Dec 2025 | 2 Jun 2026 |
| 180 | sripfriend.com | HiChina Zhicheng Technology Limited | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 181 | sripanchamukhicaterers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 182 | sripalanimurugan.com | Wild West Domains, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 183 | sripriyamasala.com | GoDaddy.com, LLC | 19 Nov 2024 | 25 Nov 2025 | 19 Nov 2027 |
| 184 | sripelangi.com | Wild West Domains, LLC | 2 Aug 2020 | 9 Aug 2025 | 2 Aug 2026 |
| 185 | sripalmozhiammantrust.com | - | 26 Jul 2016 | 26 Jul 2016 | 26 Jul 2017 |
| 186 | sripat.com | TurnCommerce, Inc. DBA NameBright.com | 16 May 2021 | 27 Jul 2025 | 16 May 2025 |
| 187 | sriputrajayaabadi.com | CV. Rumahweb Indonesia | 16 Feb 2015 | - | 16 Feb 2018 |
| 188 | sriperumbuduri.com | Tucows Domains Inc. | 14 Feb 2008 | 18 Feb 2015 | 14 Feb 2016 |
| 189 | sripathamtv.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2018 |
| 190 | sripad-weds-sheetal.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 191 | sripathasevatrust.org | SiliconHouse.Net Pvt. Ltd. | 18 Feb 2015 | 19 Feb 2015 | 18 Feb 2016 |
| 192 | sripadarajamutt.org | GoDaddy.com, LLC | 14 May 2004 | 23 Apr 2025 | 14 May 2026 |
| 193 | sriparentcoach.com | GoDaddy.com, LLC | 14 Jun 2019 | 14 Jun 2019 | 14 Jun 2020 |
| 194 | sriproject.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Feb 2021 | 19 Nov 2025 | 27 Feb 2026 |
| 195 | sriprasanna.com | NameCheap, Inc. | 23 Feb 2015 | 22 Feb 2025 | 23 Feb 2026 |
| 196 | sripisanuresort-sichang.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 May 2016 | 25 May 2016 | 25 May 2017 |
| 197 | sriptux.com | eNom, Inc. | 24 Feb 2015 | 25 Feb 2016 | 24 Feb 2017 |
| 198 | sripiti.com | GoDaddy.com, LLC | 12 Apr 2025 | 1 Jul 2025 | 12 Apr 2028 |
| 199 | sriphotos.com | GoDaddy.com, LLC | 27 Feb 2015 | 9 Apr 2025 | 27 Feb 2025 |
| 200 | sriptorpublica.net | 1&1 Internet AG | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 201 | sripvrprojects.com | BigRock Solutions Ltd. | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 202 | sriper.com | GoDaddy.com, LLC | 28 Apr 2023 | 9 Jun 2024 | 28 Apr 2024 |
| 203 | sripanwavillas.com | Name.com, Inc. | 3 Mar 2015 | 20 Feb 2017 | 3 Mar 2018 |
| 204 | sripowerhealth.com | GoDaddy.com, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2020 |
| 205 | sripgtillerstractors.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 206 | sripada-srivallabha.org | Key-Systems GmbH | 1 Mar 2015 | 21 Nov 2025 | 1 Mar 2026 |
| 207 | sripromoters.com | Name.com, Inc. | 9 Mar 2015 | 22 Mar 2017 | 9 Mar 2018 |
| 208 | sripadaravind.com | GoDaddy.com, LLC | 8 Mar 2015 | 8 Mar 2015 | 8 Mar 2016 |
| 209 | sripangulur.com | GoDaddy.com, LLC | 24 Mar 2021 | 5 May 2024 | 24 Mar 2024 |
| 210 | sripremjigroup.com | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 211 | sriprinters.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jul 2016 | 26 Aug 2017 | 15 Jul 2017 |
| 212 | sripadmasita.com | - | - | - | - |
| 213 | sripremasaiorganization.com | Tucows Domains Inc. | 15 Mar 2015 | 8 Mar 2025 | 15 Mar 2026 |
| 214 | sripremasaiorganization.net | Tucows Domains Inc. | 15 Mar 2015 | 19 Mar 2021 | 15 Mar 2021 |
| 215 | sriparvathimarketing.com | BigRock Solutions Ltd. | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 216 | sripremasaiorganization.org | Tucows Domains Inc. | 16 Mar 2015 | 14 Mar 2025 | 16 Mar 2026 |
| 217 | sripirom.com | eNom, Inc. | 19 Mar 2015 | 1 May 2025 | 19 Mar 2025 |
| 218 | sripropertyservices.com | Tucows Domains Inc. | 10 Dec 2025 | 10 Dec 2025 | 10 Dec 2026 |
| 219 | sriparvathiexport.com | - | - | - | - |
| 220 | sripadmavathiiasstudycircle.net | - | - | - | - |
| 221 | sripetruangreuang.com | OnlineNIC, Inc. | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 222 | sripipaji.com | GoDaddy.com, LLC | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 223 | sripranavam.net | 1&1 Internet AG | 13 Nov 2017 | 13 Nov 2017 | 13 Nov 2018 |
| 224 | sripranavam.com | 1&1 Internet AG | 13 Nov 2017 | 13 Nov 2017 | 13 Nov 2018 |
| 225 | sriprakashlohia.com | GoDaddy.com, LLC | 16 Jan 2024 | 16 Jan 2025 | 16 Jan 2034 |
| 226 | sripalace.com | GoDaddy.com, LLC | 5 Apr 2015 | 5 Apr 2015 | 5 Apr 2016 |
| 227 | sripdf.com | NameCheap, Inc. | 3 Jul 2020 | 3 Jun 2022 | 3 Jul 2023 |
| 228 | sripadmavathicolleges.com | CommuniGal Communication Ltd. | 21 Nov 2016 | 31 Dec 2017 | 21 Nov 2017 |
| 229 | sripranavtech.com | Net 4 India Limited | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 230 | sripisupati.com | GoDaddy.com, LLC | 8 Apr 2015 | 9 Apr 2025 | 8 Apr 2026 |
| 231 | sripramana.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 232 | sripatana.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Aug 2020 | 21 Oct 2022 | 20 Aug 2022 |
| 233 | sripoolslottery.com | Launchpad, Inc. | 13 Apr 2015 | 14 Apr 2015 | 13 Apr 2016 |
| 234 | sripickles.com | InterNetworX Ltd. & Co. KG | 11 Mar 2025 | 16 Dec 2025 | 11 Mar 2026 |
| 235 | sriputta.com | eNom, Inc. | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 236 | sriprapatsorn.com | Name.com, Inc. | 6 Sep 2015 | 9 Aug 2016 | 6 Sep 2017 |
| 237 | sriprabudrivingschool.com | GoDaddy.com, LLC | 5 Sep 2015 | 5 Sep 2015 | 5 Sep 2016 |
| 238 | sriprakasheyehospital.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Apr 2015 | 30 Dec 2024 | 17 Apr 2026 |
| 239 | sriprasadassociates.com | GoDaddy.com, LLC | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2016 |
| 240 | sripadaya.org | GoDaddy.com, LLC | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2016 |
| 241 | sriprasannavenkateswaraswamytemple.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 242 | sriponnusamycaterers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2015 | 19 Apr 2017 | 20 Apr 2018 |
| 243 | sripaljain.com | - | 3 Aug 2016 | 3 Aug 2016 | 3 Aug 2018 |
| 244 | sriprasiddhi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Apr 2015 | 22 Apr 2015 | 22 Apr 2016 |
| 245 | sriprimera.com | eNom, Inc. | 23 Apr 2015 | 18 May 2016 | 23 Apr 2018 |
| 246 | sripuja.com | NameKing.com Inc. | 11 Dec 2022 | 24 Dec 2025 | 11 Dec 2026 |
| 247 | sripanditji.com | - | - | - | - |
| 248 | sriphulajibaba.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2022 | 18 Nov 2023 | 18 Nov 2024 |
| 249 | sripad.com | TurnCommerce, Inc. DBA NameBright.com | 25 Apr 2015 | 11 Nov 2025 | 25 Apr 2026 |
| 250 | sripravinengineering.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Mar 2017 | 1 May 2017 | 1 Mar 2018 |
| 251 | sriparshva.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 252 | srips2015kims.com | GoDaddy.com, LLC | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 253 | sripinang2u.biz | eNom, Inc. | 30 Apr 2015 | 30 Apr 2015 | 29 Apr 2016 |
| 254 | sripinang.biz | eNom, Inc. | 30 Apr 2015 | 30 Apr 2015 | 29 Apr 2016 |
| 255 | sripadmavathischoolofnursing.com | GoDaddy.com, LLC | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 256 | sripotret.com | Realtime Register B.V. | 13 Feb 2024 | 14 Feb 2025 | 13 Feb 2026 |
| 257 | sripay.info | GoDaddy.com, LLC | 30 Apr 2015 | 21 Apr 2017 | 30 Apr 2018 |
| 258 | sripay.org | GoDaddy.com, LLC | 30 Apr 2015 | 11 Jun 2025 | 30 Apr 2025 |
| 259 | sripay.net | GoDaddy.com, LLC | 30 Apr 2015 | 11 Jun 2025 | 30 Apr 2025 |
| 260 | sripremanyoga.com | GMO Internet Inc. | 3 May 2015 | 3 Apr 2017 | 3 May 2018 |
| 261 | sriprakash.com | Hostinger, UAB | 28 Aug 2025 | 28 Aug 2025 | 28 Aug 2026 |
| 262 | sripak.com | NameCheap, Inc. | 17 Oct 2024 | 29 Dec 2025 | 17 Oct 2025 |
| 263 | sripisarnradio.com | West263 International Limited | 21 Oct 2020 | 21 Oct 2020 | 21 Oct 2021 |
| 264 | sriphatlaw.com | Web Commerce Communications Limited dba WebNic.cc | 6 May 2015 | 6 May 2015 | 6 May 2016 |
| 265 | sriphoenix.com | Network Solutions, LLC | 6 May 2015 | 6 Sep 2023 | 6 May 2026 |
| 266 | sripanchamukhiinteriors.com | SiliconHouse.Net Pvt. Ltd. | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 267 | sripadmainfracon.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 268 | sripunithapuri.com | BigRock Solutions Ltd. | 10 May 2015 | 10 May 2015 | 10 May 2016 |
| 269 | sripmsnursing.com | GMO Internet Inc. | 11 May 2015 | 1 May 2017 | 11 May 2018 |
| 270 | sripattani7.com | Tucows Domains Inc. | 12 May 2015 | 12 May 2015 | 12 May 2017 |
| 271 | sripathischool.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 9 Oct 2021 | 10 Oct 2021 | 9 Oct 2022 |
| 272 | sripadgaushala.com | GoDaddy.com, LLC | 13 Jan 2023 | 25 Jan 2024 | 13 Jan 2025 |
| 273 | sriperumbudurjjhomes.com | GoDaddy.com, LLC | 16 May 2015 | 16 May 2015 | 16 May 2017 |
| 274 | sriparnafashions.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Mar 2023 | 5 May 2024 | 24 Mar 2024 |
| 275 | sripoojasamagri.com | GoDaddy.com, LLC | 19 May 2015 | 19 May 2015 | 19 May 2016 |
| 276 | sriprbha.com | GoDaddy.com, LLC | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 277 | sripriyampromoters.net | Wild West Domains, LLC | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 278 | sripalibeautyparlour.com | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 279 | sripadaparanjyothi.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2017 |
| 280 | sripadandolivia.com | Tucows Domains Inc. | 2 Jun 2015 | 6 Jun 2017 | 2 Jun 2017 |
| 281 | sripo.net | NetEarth One Inc. d/b/a NetEarth | 4 Jun 2015 | 4 Jul 2017 | 4 Jun 2017 |
| 282 | sriparisthiti.com | GoDaddy.com, LLC | 16 Sep 2015 | 17 Sep 2015 | 16 Sep 2016 |
| 283 | sriprasadam.com | NameCheap, Inc. | 15 Oct 2023 | 27 Dec 2024 | 15 Oct 2024 |
| 284 | sripremasaibaba.org | GoDaddy.com, LLC | 8 Jun 2015 | 23 Jul 2025 | 8 Jun 2026 |
| 285 | sripropaint.com | Tucows Domains Inc. | 14 Sep 2012 | 18 Sep 2015 | 14 Sep 2016 |
| 286 | sripedia.org | Namesilo, LLC | 17 Sep 2015 | 7 Apr 2017 | 17 Sep 2017 |
| 287 | sripanhomestay.com | Dynadot, LLC | 20 Aug 2021 | 1 Aug 2025 | 20 Aug 2026 |
| 288 | sripadasolutions.com | GoDaddy.com, LLC | 12 Jul 2020 | 12 Jul 2020 | 12 Jul 2022 |
| 289 | sriprasannalakshminarasimhar.com | Good Domain Registry Pvt Ltd. | 20 Jun 2019 | 31 Jul 2020 | 20 Jun 2020 |
| 290 | sripharmacare.net | Tucows Domains Inc. | 12 Jun 2015 | 22 Jan 2025 | 12 Jun 2031 |
| 291 | sriprakruthiherbals.com | BigRock Solutions Ltd. | 14 Jun 2015 | 14 Jun 2015 | 14 Jun 2016 |
| 292 | sripaletammayouthtrusts.com | GoDaddy.com, LLC | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 293 | sriprojectsanddevelopers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jun 2015 | 22 Jul 2017 | 16 Jun 2017 |
| 294 | sripriyankaprinters.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jun 2015 | 17 Jun 2015 | 17 Jun 2016 |
| 295 | sripadhmavathitoursandtravels.com | ZNet Technologies Pvt Ltd. | 17 Jun 2015 | 18 Jun 2015 | 17 Jun 2016 |
| 296 | sripriyasbeauty.com | GoDaddy.com, LLC | 20 Sep 2015 | 20 Sep 2015 | 20 Sep 2017 |
| 297 | sripolymers.com | GoDaddy.com, LLC | 11 Dec 2023 | 22 Jan 2025 | 11 Dec 2024 |
| 298 | sripuramgoldentemple.com | Hostinger, UAB | 2 Jul 2025 | 1 Jan 2026 | 2 Jul 2026 |
| 299 | sriprashantsupermarket.com | GoDaddy.com, LLC | 18 Jun 2015 | 18 Jun 2015 | 18 Jun 2016 |
| 300 | sriprathyushahighschool.com | GoDaddy.com, LLC | 20 Jun 2015 | 20 Jun 2015 | 20 Jun 2020 |
| 301 | sripathy.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Sep 2015 | 21 Sep 2015 | 19 Sep 2020 |
| 302 | sripadram.com | eNom, Inc. | 8 Sep 2016 | 8 Sep 2016 | 8 Sep 2021 |
| 303 | sripar.com | GoDaddy.com, LLC | 2 Aug 2024 | 2 Aug 2024 | 2 Aug 2026 |
| 304 | sripetrust.org | GoDaddy.com, LLC | 22 Jun 2015 | 22 Jun 2017 | 22 Jun 2018 |
| 305 | sripailin-taraavenuerangsit.com | Tucows Domains Inc. | 22 Sep 2015 | 26 Sep 2017 | 22 Sep 2017 |
| 306 | sripatex.com | Tucows Domains Inc. | 25 Nov 2024 | 29 Nov 2025 | 25 Nov 2026 |
| 307 | sripadmavathyfoodandbeverages.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 308 | sriparasakthividyalaya.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Feb 2023 | 8 Apr 2025 | 22 Feb 2026 |
| 309 | sripaitv.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Jul 2015 | 3 Jul 2017 | 3 Jul 2017 |
| 310 | sripuzzle.info | GoDaddy.com, LLC | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 311 | sripalangpapers.com | Domain.com, LLC | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2016 |
| 312 | sripydithallamma.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Jul 2015 | 7 Jul 2015 | 7 Jul 2016 |
| 313 | sriprojects.com | GoDaddy.com, LLC | 16 Oct 2017 | 19 Sep 2025 | 16 Oct 2028 |
| 314 | srips.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Dec 2016 | 20 Dec 2017 | 20 Dec 2017 |
| 315 | sriprsgranitework.com | BigRock Solutions Ltd. | 17 Jul 2015 | 4 Jul 2017 | 17 Jul 2018 |
| 316 | sripongshopping.com | Key-Systems GmbH | 21 Jul 2015 | 26 Nov 2025 | 21 Jul 2026 |
| 317 | sripom.com | eNom, Inc. | 21 Jul 2015 | 21 Jul 2015 | 21 Jul 2016 |
| 318 | sripadmavathi.com | Crazy Domains FZ-LLC | 20 Jul 2007 | 21 Jul 2025 | 20 Jul 2027 |
| 319 | sripunyabumitravels.com | DreamHost, LLC | 29 Sep 2015 | 29 Sep 2015 | 29 Sep 2016 |
| 320 | sriprathyangirapacks.com | GoDaddy.com, LLC | 28 Sep 2015 | 29 Sep 2015 | 28 Sep 2016 |
| 321 | sripavansaiopticals.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Sep 2015 | 28 Sep 2015 | 28 Sep 2016 |
| 322 | sriparvathistores.com | DreamHost, LLC | 28 Sep 2015 | 8 Sep 2025 | 28 Sep 2026 |
| 323 | sripadmaraj.com | - | - | - | - |
| 324 | sriprabhudevanursery.com | GoDaddy.com, LLC | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 325 | sripooranigarments.com | BigRock Solutions Ltd. | 10 Jul 2024 | 16 Aug 2025 | 10 Jul 2026 |
| 326 | sripalihettiarachchi.com | Launchpad, Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 327 | sripadmampolytechnic.com | 35 Technology Co., Ltd. | 17 Dec 2021 | 18 Dec 2021 | 18 Dec 2022 |
| 328 | sriperiyanaayakicharitytrust.com | Good Domain Registry Pvt Ltd. | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 329 | sripondicherryroadways.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2016 |
| 330 | sripatsinghcollege.org | NameCheap, Inc. | 30 Sep 2015 | 22 Mar 2025 | 30 Sep 2026 |
| 331 | sripathiexports.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jul 2015 | 29 Nov 2016 | 29 Jul 2017 |
| 332 | sriparthasarathysilks.com | GoDaddy.com, LLC | 29 Jul 2015 | 6 Sep 2025 | 29 Jul 2027 |
| 333 | sriparamahamsanithyananda.com | CloudFlare, Inc. | 30 Jul 2015 | 30 Jun 2025 | 30 Jul 2026 |
| 334 | sripune.org | TLD Registrar Solutions Ltd. | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 335 | sripatipatra.com | GoDaddy.com, LLC | 31 Jul 2015 | 31 Jul 2025 | 31 Jul 2026 |
| 336 | sriparamahamsanithyananda.org | CloudFlare, Inc. | 30 Jul 2015 | 5 Jul 2025 | 30 Jul 2026 |
| 337 | sriparamahamsanithyananda.net | CloudFlare, Inc. | 30 Jul 2015 | 30 Jun 2025 | 30 Jul 2026 |
| 338 | sriparamahamsanithyananda.info | GoDaddy.com, LLC | 30 Jul 2015 | 26 Jun 2016 | 30 Jul 2018 |
| 339 | sripanchakalyani.com | GoDaddy.com, LLC | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 340 | sripriyamozumdar.net | BigRock Solutions Ltd. | 2 Oct 2015 | 3 Sep 2025 | 2 Oct 2026 |
| 341 | sripriyamozumdar.com | BigRock Solutions Ltd. | 2 Oct 2015 | 3 Sep 2025 | 2 Oct 2026 |
| 342 | sripoojastore.com | BigRock Solutions Ltd. | 11 Feb 2020 | 28 Sep 2025 | 11 Feb 2026 |
| 343 | sriparameshwara.com | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 344 | sripadmamgroup.com | Name.com, Inc. | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2016 |
| 345 | sripooraniladieshostel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2016 |
| 346 | sripavithrraairproducts.com | Net 4 India Limited | 7 Aug 2015 | 7 Aug 2015 | 7 Aug 2016 |
| 347 | sripremsaimatrimonial.com | GoDaddy.com, LLC | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2016 |
| 348 | sripoonthong.net | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 349 | sripoonsup.net | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 350 | sripromo2016.com | register.com, Inc. | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 351 | sripadavallabha.com | TurnCommerce, Inc. DBA NameBright.com | 6 Oct 2015 | 16 Nov 2025 | 6 Oct 2025 |
| 352 | sripumps.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Oct 2015 | 1 Oct 2025 | 9 Oct 2026 |
| 353 | sripooja.org | GoDaddy.com, LLC | 9 Oct 2015 | 7 Oct 2025 | 9 Oct 2034 |
| 354 | sripooja.com | GoDaddy.com, LLC | 9 Oct 2015 | 2 Oct 2025 | 9 Oct 2034 |
| 355 | sriparamayyasatsang.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Oct 2015 | 10 Oct 2016 | 9 Oct 2017 |
| 356 | sripriyatv.com | GoDaddy.com, LLC | 4 Jan 2017 | 4 Jan 2017 | 4 Jan 2018 |
| 357 | sripoenwoenradio.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Oct 2015 | 13 Oct 2025 | 12 Oct 2026 |
| 358 | sriparas.com | GoDaddy.com, LLC | 4 Jan 2020 | 4 Jan 2020 | 4 Jan 2022 |
| 359 | sripang.com | GoDaddy.com, LLC | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 360 | sriparthasarathyswamytemple.org | GMO Internet Inc. | 5 Jan 2017 | 6 Jan 2018 | 5 Jan 2019 |
| 361 | sriparthasarathy.com | GoDaddy.com, LLC | 13 Feb 2020 | 26 Apr 2024 | 13 Feb 2024 |
| 362 | sriprengineers.com | - | - | - | - |
| 363 | sriparts.com | FastDomain Inc. | 23 Oct 2015 | 10 Nov 2025 | 23 Oct 2026 |
| 364 | sripakornvill.com | Web Commerce Communications Limited dba WebNic.cc | 24 Oct 2015 | 24 Oct 2015 | 24 Oct 2016 |
| 365 | sripainter.com | GoDaddy.com, LLC | 31 Oct 2015 | 31 Oct 2015 | 31 Oct 2016 |
| 366 | sripemanandadahampasala.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 367 | sripadmavathiconsultants.com | GoDaddy.com, LLC | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 368 | sripriyaindustries.com | Good Domain Registry Pvt Ltd. | 5 Nov 2015 | 5 Nov 2015 | 5 Nov 2016 |
| 369 | sripadmavathicatering.com | Good Domain Registry Pvt Ltd. | 31 Jul 2023 | 1 Aug 2024 | 31 Jul 2025 |
| 370 | sripolurihanumajjanakiramasarma.com | BigRock Solutions Ltd. | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 371 | sripimolthum.com | GoDaddy.com, LLC | 20 Feb 2019 | 3 May 2024 | 20 Feb 2024 |
| 372 | sriprakashads.com | GoDaddy.com, LLC | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2016 |
| 373 | sripinnaka.com | Tucows Domains Inc. | 9 Nov 2015 | 13 Nov 2018 | 9 Nov 2018 |
| 374 | sripalimarumatha.org | GoDaddy.com, LLC | 11 Nov 2015 | 26 Dec 2025 | 11 Nov 2028 |
| 375 | sripriyaa.com | InterNetworX Ltd. & Co. KG | 10 Mar 2025 | 16 Dec 2025 | 10 Mar 2026 |
| 376 | sripangulur4.com | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 377 | sripandilandpromoters.com | Good Domain Registry Pvt Ltd. | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2016 |
| 378 | sripadasrivallabha.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Aug 2020 | 16 Aug 2025 | 17 Aug 2026 |
| 379 | sripadasrivallabha.net | eNom, Inc. | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 380 | sripclub.com | Beijing Lanhai Jiye Technology Co., Ltd | 23 Jul 2022 | 24 Aug 2024 | 23 Jul 2024 |
| 381 | sripambatti.org | Porkbun, LLC | 30 Jul 2022 | 11 Oct 2024 | 30 Jul 2024 |
| 382 | sripertiwi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Nov 2024 | 17 Jan 2026 | 20 Nov 2026 |
| 383 | sripat.xyz | GMO Internet Inc. | 11 Dec 2025 | - | 11 Dec 2026 |
| 384 | sripadmavathitraders.com | GoDaddy.com, LLC | 17 Jun 2024 | 22 Jun 2025 | 17 Jun 2026 |
| 385 | sriperumbudur.xyz | Crazy Domains FZ-LLC | 29 Nov 2015 | 4 Dec 2015 | 29 Nov 2017 |
| 386 | sripas.com | Name.com, Inc. | 26 Nov 2015 | 26 Nov 2015 | 26 Nov 2016 |
| 387 | sripta.com | Rebel.com Corp. | 19 Jan 2023 | 20 Jan 2026 | 19 Jan 2027 |
| 388 | sripramanandadahampasala.com | NetEarth One Inc. d/b/a NetEarth | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2016 |
| 389 | sripa.xyz | Hostinger, UAB | 2 Dec 2015 | 8 Apr 2016 | 2 Dec 2017 |
| 390 | sriptahfiz.com | GoDaddy.com, LLC | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2016 |
| 391 | sripadmavatiassociates.com | GoDaddy.com, LLC | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 392 | sripandiyanhotel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2015 | 11 Dec 2015 | 11 Dec 2016 |
| 393 | sripemanandadahampasala.org | NetEarth One Inc. d/b/a NetEarth | 15 Dec 2015 | 15 Dec 2015 | 15 Dec 2016 |
| 394 | sriponniammanconstruction.com | GoDaddy.com, LLC | 15 Dec 2015 | 15 Dec 2015 | 15 Dec 2016 |
| 395 | sriphalasamui.com | GoDaddy.com, LLC | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 396 | sripavitragold.com | GoDaddy.com, LLC | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 397 | sripadaswamy.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 398 | sripranadata.com | GoDaddy.com, LLC | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 399 | sriportfolios.org | GoDaddy.com, LLC | 8 Nov 2013 | 21 Dec 2015 | 8 Nov 2021 |
| 400 | sriparattutor.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 401 | sripadtech.com | GoDaddy.com, LLC | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 402 | sriperformance.com | GoDaddy.com, LLC | 27 Dec 2015 | 29 Sep 2025 | 27 Dec 2027 |
| 403 | sripis.com | GoDaddy.com, LLC | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2018 |
| 404 | sriphan-supply.com | eNom, Inc. | 5 Jan 2016 | 4 Jan 2016 | 5 Jan 2019 |
| 405 | sriperlaconstructions.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 406 | sripeacockexports.com | ZNet Technologies Pvt Ltd. | 7 Jan 2016 | 7 Jan 2016 | 7 Jan 2017 |
| 407 | sriphangan.com | HiChina Zhicheng Technology Limited | 14 Jun 2018 | 15 Jun 2018 | 14 Jun 2019 |
| 408 | sriperumalpackers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Apr 2023 | 22 Apr 2024 | 21 Apr 2025 |
| 409 | sripis.org | GoDaddy.com, LLC | 4 Jan 2016 | 5 Jan 2017 | 4 Jan 2018 |
| 410 | sripis.net | GoDaddy.com, LLC | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 411 | sripis.info | GoDaddy.com, LLC | 4 Jan 2016 | 5 Jan 2017 | 4 Jan 2018 |
| 412 | sripommitravels.com | GoDaddy.com, LLC | 13 Jan 2016 | 14 Jan 2016 | 13 Jan 2017 |
| 413 | sripujastores.com | Domain.com, LLC | 16 Jan 2016 | 16 Jan 2016 | 16 Jan 2017 |
| 414 | sripts-search.com | 1&1 Internet AG | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2018 |
| 415 | sriphum.com | Web Commerce Communications Limited dba WebNic.cc | 19 Feb 2022 | 30 Apr 2024 | 19 Feb 2024 |
| 416 | sripos.com | BigRock Solutions Ltd. | 24 Jan 2016 | 26 Dec 2024 | 24 Jan 2026 |
| 417 | sripaaddamlogistics.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jan 2016 | 19 Sep 2025 | 29 Jan 2026 |
| 418 | sriparn.com | GoDaddy.com, LLC | 5 Oct 2025 | 28 Oct 2025 | 5 Oct 2026 |
| 419 | sripurnawidari.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 420 | sriphalaresort.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 May 2019 | 6 May 2019 | 6 May 2020 |
| 421 | sripan-homestay.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Feb 2016 | 5 Feb 2016 | 5 Feb 2017 |
| 422 | sripadmarajayurveda.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Oct 2019 | 11 Jan 2026 | 30 Oct 2025 |
| 423 | sriparasakthicollegeofeducation.org | GoDaddy.com, LLC | 6 Feb 2016 | 10 Jan 2017 | 6 Feb 2018 |
| 424 | sripadmavathienterprises.com | GoDaddy.com, LLC | 22 Jul 2020 | 22 Jul 2020 | 22 Jul 2022 |
| 425 | sripaliprinters.com | Namesilo, LLC | 15 Feb 2016 | 15 Feb 2025 | 15 Feb 2026 |
| 426 | sriparnamitra.com | Domainshype.com, Inc. | 13 Feb 2016 | 14 Apr 2016 | 13 Feb 2021 |
| 427 | sripooraniconstruction.com | Good Domain Registry Pvt Ltd. | 15 Feb 2016 | 15 Feb 2016 | 15 Feb 2017 |
| 428 | sripathij.com | GoDaddy.com, LLC | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 429 | sriputih.com | Web Commerce Communications Limited dba WebNic.cc | 7 May 2021 | 22 Mar 2025 | 7 May 2026 |
| 430 | sriprai.com | Hostinger, UAB | 27 May 2021 | 28 May 2025 | 27 May 2026 |
| 431 | sriplantations.com | FastDomain Inc. | 11 Jun 2017 | 11 Jun 2017 | 11 Jun 2018 |
| 432 | sripster.com | Tucows Domains Inc. | 14 Oct 2020 | 18 Oct 2022 | 14 Oct 2022 |
| 433 | sripadkamalakar.com | GoDaddy.com, LLC | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2017 |
| 434 | sripradha.com | GoDaddy.com, LLC | 4 Jan 2024 | 4 Jan 2026 | 4 Jan 2027 |
| 435 | sripathis.com | GoDaddy.com, LLC | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2017 |
| 436 | sripriyabags.com | Wild West Domains, LLC | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 437 | sripuriob.xyz | GMO Internet Inc. | 29 Feb 2016 | 5 Mar 2016 | 28 Feb 2017 |
| 438 | sripalanimurugantravels.com | GoDaddy.com, LLC | 1 Mar 2016 | 1 Mar 2016 | 1 Mar 2017 |
| 439 | sripatanjaliyogalaya.org | GoDaddy.com, LLC | 2 Mar 2016 | 2 Mar 2017 | 2 Mar 2018 |
| 440 | sripelindong.com | Web Commerce Communications Limited dba WebNic.cc | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 441 | sripipatradio.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2017 |
| 442 | sripydog.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Mar 2016 | 9 Mar 2016 | 9 Mar 2017 |
| 443 | sriproductions.com | GoDaddy.com, LLC | 23 Sep 2020 | 23 Sep 2020 | 23 Sep 2021 |
| 444 | sriperfectengineering.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 445 | sripadmavathimahilakalasala.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 21 Apr 2023 | 29 May 2024 | 21 Apr 2024 |
| 446 | sripadainfo.com | NameCheap, Inc. | 2 Jan 2025 | 3 Jan 2026 | 2 Jan 2026 |
| 447 | sripremasaiorganizationonlus.org | Tucows Domains Inc. | 11 Mar 2016 | 15 Mar 2023 | 11 Mar 2024 |
| 448 | sripremasaiorganizationonlus.net | Tucows Domains Inc. | 11 Mar 2016 | 15 Mar 2022 | 11 Mar 2022 |
| 449 | sripremasaiorganizationonlus.com | Tucows Domains Inc. | 11 Mar 2016 | 4 Mar 2017 | 11 Mar 2018 |
| 450 | sripetchiamman.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Mar 2016 | 27 Nov 2016 | 14 Mar 2019 |
| 451 | sriprathinik.com | GoDaddy.com, LLC | 9 Sep 2011 | 7 Sep 2025 | 9 Sep 2027 |
| 452 | sripriyahomecare.com | GoDaddy.com, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 453 | sriparadisegroup.com | Namesilo, LLC | 9 Aug 2018 | 9 Aug 2018 | 9 Aug 2019 |
| 454 | sripraveenya.com | GoDaddy.com, LLC | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 455 | sripal.net | BigRock Solutions Ltd. | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 456 | sripelamin.com | Hostinger, UAB | 22 Mar 2016 | 1 Jun 2024 | 22 Mar 2024 |
| 457 | sripadma.xyz | GMO Internet Inc. | 23 Mar 2016 | 28 Mar 2016 | 23 Mar 2017 |
| 458 | sripohaci.com | eNom, Inc. | 26 Mar 2016 | 26 Mar 2016 | 26 Mar 2017 |
| 459 | sriparamjyothibhajans.org | GoDaddy.com, LLC | 27 Mar 2016 | 27 Mar 2016 | 27 Mar 2017 |
| 460 | sripadamrajayurveda.com | SiliconHouse.Net Pvt. Ltd. | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 461 | sripaliprinters.info | register.com, Inc. | 31 Mar 2016 | 15 Mar 2017 | 31 Mar 2018 |
| 462 | sripanyam.com | DropCatch.com 939 LLC | 30 Mar 2016 | 31 Mar 2017 | 30 Mar 2018 |
| 463 | sripadmini.com | Wild West Domains, LLC | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 464 | srippephotocontest.com | Tucows Domains Inc. | 30 Mar 2010 | 30 Mar 2010 | 30 Mar 2017 |
| 465 | sriperiyandavar.com | Realtime Register B.V. | 15 Jul 2021 | 26 Aug 2023 | 15 Jul 2023 |
| 466 | sripresshyd.com | GoDaddy.com, LLC | 3 Apr 2016 | 3 Apr 2016 | 3 Apr 2017 |
| 467 | sripiyangalu.com | GoDaddy.com, LLC | 14 Nov 2020 | 14 Nov 2020 | 14 Nov 2021 |
| 468 | sripoojithapublicschool.com | Steamline Domains, LLC | 11 Sep 2020 | 11 Sep 2020 | 11 Sep 2021 |
| 469 | sriparamjyotibhajans.org | GoDaddy.com, LLC | 4 Apr 2016 | 19 Mar 2017 | 4 Apr 2018 |
| 470 | sriproperties.info | GoDaddy.com, LLC | 6 Apr 2016 | 21 May 2025 | 6 Apr 2026 |
| 471 | sriproperties.net | GoDaddy.com, LLC | 6 Apr 2016 | 7 Apr 2025 | 6 Apr 2026 |
| 472 | sriparanistores.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 473 | sripadvaliharadas.net | Wild West Domains, LLC | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 474 | sripadmavatimarketing.com | GoDaddy.com, LLC | 24 Apr 2018 | 5 Jun 2025 | 24 Apr 2025 |
| 475 | sriprana.com | BigRock Solutions Ltd. | 2 Mar 2023 | 28 Feb 2025 | 2 Mar 2026 |
| 476 | sriparthisai.com | GoDaddy.com, LLC | 12 Apr 2016 | 12 Apr 2016 | 12 Apr 2018 |
| 477 | sriprana.org | GoDaddy.com, LLC | 13 Apr 2016 | 13 Apr 2016 | 13 Apr 2017 |
| 478 | sripadmastudio.com | Amazon Registrar, Inc. | 13 Apr 2016 | 13 Apr 2016 | 13 Apr 2017 |
| 479 | sriparamjyotideeksha.net | GoDaddy.com, LLC | 15 Apr 2016 | 15 Apr 2016 | 15 Apr 2017 |
| 480 | sriparamjyotideeksha.com | GoDaddy.com, LLC | 15 Apr 2016 | 15 Apr 2016 | 15 Apr 2017 |
| 481 | sripragathipride.com | GoDaddy.com, LLC | 16 Apr 2016 | 16 Apr 2016 | 16 Apr 2018 |
| 482 | sriparamjyotideeksha.org | GoDaddy.com, LLC | 15 Apr 2016 | 16 Apr 2017 | 15 Apr 2018 |
| 483 | sriparamjyotideeksha.info | GoDaddy.com, LLC | 15 Apr 2016 | 16 Apr 2017 | 15 Apr 2018 |
| 484 | sripratibhagroup.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2016 | 16 Apr 2016 | 16 Apr 2017 |
| 485 | sripriyankastudio.com | GoDaddy.com, LLC | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 486 | sripragathiinteriors.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 487 | sripathanjalitravels.com | GoDaddy.com, LLC | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 488 | sripadmavathivenkateswara.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Apr 2016 | 22 Jun 2016 | 22 Apr 2019 |
| 489 | sripawatha.com | GoDaddy.com, LLC | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 490 | sriparipoornasanathanaayurvedacollege.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 491 | sripriyajjimdo.com | GoDaddy.com, LLC | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 492 | sripathumdhamma.com | Domain.com, LLC | 26 Apr 2016 | 4 Oct 2016 | 26 Apr 2017 |
| 493 | sripwwyyw4.net | GMO Internet Inc. | 29 Apr 2016 | 29 Apr 2016 | 29 Apr 2017 |
| 494 | sripuripalace.com | GoDaddy.com, LLC | 29 Apr 2016 | 29 Apr 2016 | 29 Apr 2017 |
| 495 | sriperu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Oct 2007 | 14 Aug 2025 | 23 Oct 2026 |
| 496 | sripushpakapackers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Nov 2017 | 1 Nov 2017 | 1 Nov 2018 |
| 497 | sriprathum.com | eNom, Inc. | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 498 | sripathinettampadikaruppasamytrust.org | FastDomain Inc. | 11 May 2016 | 11 May 2016 | 11 May 2017 |
| 499 | sripadavallabhacharitamrutham.info | GoDaddy.com, LLC | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 500 | sripadavallabhacharitamrutham.net | GoDaddy.com, LLC | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 501 | sripadavallabhacharitamrutham.com | GoDaddy.com, LLC | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 502 | sriparamjyoti.org | GoDaddy.com, LLC | 13 May 2016 | 21 Dec 2025 | 13 May 2026 |
| 503 | sripadavallabhacharitamrutham.org | GoDaddy.com, LLC | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 504 | sriparamjyoti.net | GoDaddy.com, LLC | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 505 | sriparamjyoti.com | GoDaddy.com, LLC | 13 May 2016 | 21 Dec 2025 | 13 May 2026 |
| 506 | sriparnasthoughts.com | NameCheap, Inc. | 7 Jul 2022 | 18 Aug 2023 | 7 Jul 2023 |
| 507 | sripadapadmagosala.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 May 2016 | 30 Apr 2017 | 17 May 2018 |
| 508 | sripackersandmovers.com | Nordreg AB | 22 Oct 2025 | 22 Oct 2025 | 22 Oct 2026 |
| 509 | sriplecit.xyz | NameCheap, Inc. | 16 May 2016 | 10 Jun 2016 | 16 May 2017 |
| 510 | sripanwaphuket.review | Alpnames Limited | 5 May 2016 | 5 May 2016 | 4 May 2017 |
| 511 | sripalkatanguri.com | 1&1 Internet AG | 25 May 2016 | 25 May 2016 | 25 May 2018 |
| 512 | sriphiromrak.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 May 2016 | 20 May 2019 | 26 May 2026 |
| 513 | sripadaresidency.com | GoDaddy.com, LLC | 27 May 2016 | 27 May 2016 | 27 May 2017 |
| 514 | sripriyanka.com | BigRock Solutions Ltd. | 13 Jan 2018 | 24 Feb 2024 | 13 Jan 2024 |
| 515 | sriprabhutricks.com | GoDaddy.com, LLC | 13 Jul 2016 | 13 Jul 2016 | 13 Jul 2017 |
| 516 | sripaluka.com | Web Commerce Communications Limited dba WebNic.cc | 24 Nov 2023 | 24 Nov 2023 | 24 Nov 2026 |
| 517 | sriphochangauto.com | eNom, Inc. | 1 Jun 2016 | 31 May 2016 | 1 Jun 2020 |
| 518 | sripchat.com | EvoPlus Ltd. | 1 Jun 2016 | 13 Dec 2025 | 1 Jun 2026 |
| 519 | sripoornatyres.com | GoDaddy.com, LLC | 27 Oct 2021 | 7 Jan 2024 | 27 Oct 2023 |
| 520 | sripetalinghotel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 521 | sripriyajimdo.com | GoDaddy.com, LLC | 3 Jun 2016 | 3 Jun 2016 | 3 Jun 2017 |
| 522 | sripranavsteels.com | Tucows Domains Inc. | 2 Jul 2018 | 6 Jul 2019 | 2 Jul 2019 |
| 523 | sripitambaradham.com | GoDaddy.com, LLC | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 524 | sriprofoundly.xyz | GMO Internet Inc. | 1 Jun 2016 | 6 Jun 2016 | 1 Jun 2017 |
| 525 | sripoom.com | - | 12 Jun 2016 | 12 Jun 2016 | 12 Jun 2018 |
| 526 | sriperambudur.com | Google, Inc. | 11 Jun 2016 | 27 May 2025 | 11 Jun 2026 |
| 527 | sripradeep.com | Google, Inc. | 13 Jun 2016 | 29 May 2025 | 13 Jun 2026 |
| 528 | sripmsphysiotherapy.com | Internet Domain Services BS Corp | 17 May 2019 | 17 May 2019 | 17 May 2020 |
| 529 | sripraphairestaurant.com | Wild West Domains, LLC | 29 Feb 2008 | 1 Mar 2025 | 28 Feb 2026 |
| 530 | sripalaniaandavaragency.com | GoDaddy.com, LLC | 20 Jun 2016 | 20 Jun 2016 | 20 Jun 2017 |
| 531 | sriprashaliyatours.com | GoDaddy.com, LLC | 21 Jun 2016 | 15 Jun 2017 | 21 Jun 2018 |
| 532 | sripankrour.com | GoDaddy.com, LLC | 25 Jun 2016 | 25 Jun 2016 | 25 Jun 2017 |
| 533 | sripal.org | GoDaddy.com, LLC | 28 Jun 2016 | 28 Jun 2016 | 28 Jun 2017 |
| 534 | sriprachaschool.net | eNom, Inc. | 28 Jun 2016 | 28 Jun 2016 | 28 Jun 2017 |
| 535 | sripatsingcollege.com | GoDaddy.com, LLC | 28 Jun 2016 | 28 Jun 2016 | 28 Jun 2017 |
| 536 | sriployrung.com | GoDaddy.com, LLC | 30 Jun 2016 | 30 Jun 2025 | 30 Jun 2026 |
| 537 | sriprasannavenkateswaraswamytemple.org | GoDaddy.com, LLC | 30 Jun 2016 | 30 Jun 2016 | 30 Jun 2017 |
| 538 | sriphani.com | Tucows Domains Inc. | 16 Jun 2008 | 18 May 2025 | 16 Jun 2026 |
| 539 | sriprapaiburiram.com | eNom, Inc. | 4 Jul 2016 | 4 Jul 2016 | 4 Jul 2017 |
| 540 | sriperumbudurexpress.com | Tucows Domains Inc. | 4 Jul 2016 | 14 Aug 2023 | 4 Jul 2023 |
| 541 | srips.com | TurnCommerce, Inc. DBA NameBright.com | 5 Jul 2016 | 29 Jun 2020 | 5 Jul 2026 |
| 542 | sripoonjaji.com | Uniregistrar Corp | 6 Jul 2016 | 6 Jul 2016 | 6 Jul 2017 |
| 543 | sripaadaclinics.com | GoDaddy.com, LLC | 6 Jul 2016 | 6 Jul 2016 | 6 Jul 2017 |
| 544 | sripbox.com | - | 7 Jul 2016 | 7 Jul 2016 | 7 Jul 2017 |
| 545 | sripalibeautysaloon.com | BigRock Solutions Ltd. | 21 Feb 2019 | 21 Feb 2019 | 21 Feb 2020 |
| 546 | sripathisrinivasan.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jun 2016 | 14 Sep 2016 | 13 Jun 2017 |
| 547 | sripanjamivarahimandali.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Jul 2016 | 22 Aug 2017 | 11 Jul 2017 |
| 548 | sripongtestingsite.com | Amazon Registrar, Inc. | 12 Jul 2016 | 23 Jul 2025 | 12 Jul 2026 |
| 549 | sriprembaba.guru | GoDaddy.com, LLC | 5 Feb 2014 | 9 Jan 2017 | 5 Feb 2018 |
| 550 | sripandan.com | CV. Rumahweb Indonesia | 13 Jul 2016 | - | 13 Jul 2017 |
| 551 | sriprint.com | GoDaddy.com, LLC | 21 Nov 2021 | 2 Feb 2025 | 21 Nov 2024 |
| 552 | sriprakashana.org | GoDaddy.com, LLC | 14 Jul 2016 | 14 Jul 2016 | 14 Jul 2017 |
| 553 | sripada.in | - | 11 Mar 2010 | 10 Mar 2017 | 11 Mar 2020 |
| 554 | sripl.co.in | - | 5 Oct 2008 | 23 Aug 2024 | 5 Oct 2027 |
| 555 | sripyramid.in | - | 19 Sep 2013 | 9 Jun 2017 | 19 Sep 2018 |
| 556 | sripushpamcollege.co.in | Dynadot, LLC | 2 Dec 2023 | 26 Nov 2025 | 2 Dec 2026 |
| 557 | sriprakashana.com | GoDaddy.com, LLC | 14 Jul 2016 | 14 Jul 2016 | 14 Jul 2017 |
| 558 | sriproperties.biz | GoDaddy.com, LLC | 16 Apr 2010 | 2 May 2020 | 15 Apr 2021 |
| 559 | sripanwa.biz | GoDaddy.com, LLC | 2 Apr 2022 | 14 May 2023 | 2 Apr 2023 |
| 560 | sripachaiammantemplerendadi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jul 2016 | 22 Jul 2017 | 20 Jul 2018 |
| 561 | sripatcolor.com | GMO Internet Inc. | 21 Jul 2016 | 6 Jul 2017 | 21 Jul 2018 |
| 562 | sripowersolutions.com | Hostinger, UAB | 23 Apr 2023 | 14 May 2025 | 23 Apr 2026 |
| 563 | sripackindustries.com | Wild West Domains, LLC | 4 Feb 2025 | 4 Feb 2025 | 4 Feb 2026 |
| 564 | sripturetyper.com | - | 28 Jul 2016 | 28 Jul 2016 | 28 Jul 2017 |
| 565 | sripreethiindustries.com | - | 29 Jul 2016 | 29 Jul 2016 | 29 Jul 2017 |
| 566 | sripunkalasa.com | 1&1 Internet AG | 1 Aug 2016 | 2 Aug 2017 | 1 Aug 2018 |
| 567 | sriponnitravels.com | GoDaddy.com, LLC | 3 Aug 2016 | 21 May 2025 | 3 Aug 2026 |
| 568 | sripansauce.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Aug 2016 | 5 Aug 2025 | 5 Aug 2026 |
| 569 | sripushpakapackersandmovers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Aug 2016 | 15 Sep 2017 | 4 Aug 2017 |
| 570 | sripo-online.com | GMO Internet Inc. | 6 Aug 2016 | 17 Sep 2017 | 6 Aug 2017 |
| 571 | sripesona.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Aug 2016 | 20 Sep 2017 | 9 Aug 2017 |
| 572 | sriperiyanachiammantemple.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Aug 2016 | 23 Sep 2025 | 9 Aug 2026 |
| 573 | sripictures.com | DropCatch.com 678 LLC | 30 Oct 2018 | 30 Oct 2018 | 30 Oct 2019 |
| 574 | sripuvalai.com | - | 15 Aug 2016 | 15 Aug 2016 | 15 Aug 2017 |
| 575 | sripu.com | GoDaddy.com, LLC | 22 May 2021 | 22 May 2021 | 22 May 2022 |
| 576 | sripanwahabita.info | GoDaddy.com, LLC | 19 Aug 2016 | 30 Sep 2024 | 19 Aug 2024 |
| 577 | sripanwahabita.com | GoDaddy.com, LLC | 19 Aug 2016 | 20 Aug 2025 | 19 Aug 2026 |
| 578 | sripanwahabita.net | GoDaddy.com, LLC | 19 Aug 2016 | 30 Sep 2024 | 19 Aug 2024 |
| 579 | sripanwahabita.org | GoDaddy.com, LLC | 19 Aug 2016 | 30 Sep 2024 | 19 Aug 2024 |
| 580 | sriplay.com | - | 22 Aug 2016 | 22 Aug 2016 | 22 Aug 2017 |
| 581 | sriptlife.com | - | 23 Aug 2016 | 23 Aug 2016 | 23 Aug 2021 |
| 582 | sriptlife.net | - | 23 Aug 2016 | 23 Aug 2016 | 23 Aug 2021 |
| 583 | sripimc.com | GoDaddy.com, LLC | 29 Aug 2016 | 10 Oct 2024 | 29 Aug 2024 |
| 584 | sripranathideveloper.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Sep 2016 | 13 Oct 2017 | 1 Sep 2017 |
| 585 | sripari.com | Masterofmydomains.net LLC | 21 Nov 2024 | 4 Jan 2026 | 21 Nov 2025 |
| 586 | sripashupati.com | - | 6 Sep 2016 | 6 Sep 2016 | 6 Sep 2017 |
| 587 | sripragnyaconstructions.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Sep 2016 | 19 Oct 2017 | 7 Sep 2017 |
| 588 | sripsley.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Sep 2016 | 20 Oct 2017 | 8 Sep 2017 |
| 589 | sripratyangira.com | register.com, Inc. | 28 Dec 2022 | 9 Feb 2024 | 28 Dec 2023 |
| 590 | sripremafoods.com | - | 13 Sep 2016 | 13 Sep 2016 | 13 Sep 2018 |
| 591 | sripathi.space | 1&1 Internet AG | 14 Sep 2016 | 27 Oct 2024 | 14 Sep 2024 |
| 592 | sripathi.info | 1&1 Internet AG | 14 Sep 2016 | 26 Oct 2024 | 14 Sep 2024 |
| 593 | sripranavi.com | GoDaddy.com, LLC | 6 Apr 2022 | 12 Apr 2024 | 6 Apr 2026 |
| 594 | sriphatherb.com | GoDaddy.com, LLC | 11 Apr 2021 | 11 Apr 2021 | 11 Apr 2022 |
| 595 | sriparashara.com | - | 21 Sep 2016 | 21 Sep 2016 | 21 Sep 2017 |
| 596 | sriprojectservices.net | eNom, Inc. | 26 Sep 2016 | 7 Nov 2017 | 26 Sep 2017 |
| 597 | sripacs.com | CloudFlare, Inc. | 19 Apr 2023 | 7 Oct 2024 | 19 Apr 2026 |
| 598 | sripathikethumd.com | GoDaddy.com, LLC | 19 Feb 2014 | 20 Feb 2024 | 19 Feb 2026 |
| 599 | sripatpibool.com | register.com, Inc. | 15 Jun 2010 | 28 Jul 2024 | 15 Jun 2024 |
| 600 | sripy.com | GMO Internet Inc. | 25 Apr 2023 | 7 Jun 2025 | 25 Apr 2025 |
| 601 | sripools.com | Wild West Domains, LLC | 2 Jun 2013 | 3 Jun 2025 | 2 Jun 2026 |
| 602 | sripoomaariammankovil.com | GoDaddy.com, LLC | 22 Nov 2012 | 2 Sep 2014 | 22 Nov 2016 |
| 603 | sriphet.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jul 2024 | 15 Aug 2025 | 4 Jul 2025 |
| 604 | sripokkalivijayatrust.com | Namesilo, LLC | 9 Feb 2018 | 10 Feb 2018 | 9 Feb 2019 |
| 605 | sripper.com | - | 13 Feb 2025 | 13 Feb 2025 | 13 Feb 2026 |
| 606 | sripootorn.com | DreamHost, LLC | 19 Oct 2012 | 21 Oct 2017 | 19 Oct 2017 |
| 607 | sripvenkataraos.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Dec 2011 | 21 Dec 2025 | 20 Dec 2026 |
| 608 | sripp.com | Network Solutions, LLC | 11 Jul 2012 | 12 May 2025 | 11 Jul 2026 |
| 609 | sriphalagroup.com | GoDaddy.com, LLC | 6 Aug 2007 | 26 Sep 2025 | 25 Sep 2026 |
| 610 | sripambattisiddhar.com | GoDaddy.com, LLC | 2 Apr 2002 | 13 Mar 2025 | 2 Apr 2026 |
| 611 | sripanwasales.com | GoDaddy.com, LLC | 14 Jul 2009 | 9 Jul 2015 | 14 Jul 2017 |
| 612 | sriplas.com | Web Commerce Communications Limited dba WebNic.cc | 4 Mar 2003 | 16 Nov 2017 | 5 Mar 2026 |
| 613 | sripriya.com | GoDaddy.com, LLC | 8 May 2025 | 30 Sep 2025 | 8 May 2027 |
| 614 | sripadma.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Mar 2002 | 1 Mar 2025 | 19 Mar 2026 |
| 615 | sripati.com | FrontStreetDomains.com LLC | 20 Jan 2025 | 28 Jan 2026 | 20 Jan 2027 |
| 616 | sripawan.com | GoDaddy.com, LLC | 28 Jun 2014 | 21 Jun 2025 | 28 Jun 2026 |
| 617 | sripelangiconsdnbhd.com | Web Commerce Communications Limited dba WebNic.cc | 1 Oct 2013 | 1 Oct 2013 | 1 Oct 2018 |
| 618 | sripandankatering.com | Cloud Yuqu LLC | 27 Feb 2021 | 27 Feb 2021 | 27 Feb 2022 |
| 619 | sripintaral-amin.com | Tucows Domains Inc. | 10 Nov 2012 | 26 Oct 2025 | 10 Nov 2026 |
| 620 | sripadmamaliniproperties.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Nov 2013 | 7 Nov 2017 | 7 Nov 2017 |
| 621 | sriporon7shop.com | CV. Jogjacamp | 6 Apr 2012 | 13 May 2025 | 6 Apr 2025 |
| 622 | sripuvath.com | NameCheap, Inc. | 11 Oct 2025 | 14 Oct 2025 | 11 Oct 2026 |
| 623 | sripyer.com | 1API GmbH | 21 May 2011 | 4 Jul 2024 | 21 May 2024 |
| 624 | sripraagrifarms.com | Crazy Domains FZ-LLC | 30 Sep 2016 | 11 Oct 2017 | 30 Sep 2017 |
| 625 | sriphanvanich.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2022 | 30 Aug 2025 | 9 Sep 2026 |
| 626 | sripetrochemicalinc.com | register.com, Inc. | 17 Apr 2014 | 2 Apr 2016 | 17 Apr 2018 |
| 627 | sriperumbuduronline.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Sep 2013 | 24 Oct 2017 | 12 Sep 2017 |
| 628 | sriprints.com | GoDaddy.com, LLC | 28 Nov 2011 | 25 Nov 2025 | 28 Nov 2026 |
| 629 | sripoovarasitapes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Dec 2013 | 12 Nov 2014 | 27 Dec 2018 |
| 630 | sripandurangatemple.com | GMO Internet Inc. | 24 May 2022 | 4 Aug 2023 | 24 May 2023 |
| 631 | sriprinting.com | Google, Inc. | 26 Apr 2023 | 27 Apr 2024 | 26 Apr 2025 |
| 632 | sripress.com | Name.com, Inc. | 5 Jul 2007 | 13 Jun 2025 | 5 Jul 2026 |
| 633 | sriprofessionals.com | Tucows Domains Inc. | 23 Dec 2011 | 9 Dec 2025 | 23 Dec 2026 |
| 634 | sripro.com | Google, Inc. | 8 Jul 2025 | 8 Jul 2025 | 8 Jul 2026 |
| 635 | sripm.com | Hefei Juming Network Technology Co., Ltd | 30 Oct 2013 | 27 Dec 2025 | 30 Oct 2026 |
| 636 | sripaving.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Oct 2017 | 23 Oct 2017 | 23 Oct 2020 |
| 637 | sripadsridhar.com | GoDaddy.com, LLC | 26 Jul 2014 | 16 Sep 2022 | 26 Jul 2026 |
| 638 | sripurnamaberhad.com | Web Commerce Communications Limited dba WebNic.cc | 4 Aug 2010 | 4 Aug 2010 | 4 Aug 2018 |
| 639 | sriprajuk.com | GoDaddy.com, LLC | 27 Sep 2012 | 5 Aug 2016 | 27 Sep 2017 |
| 640 | sripinang.com | Metaregistrar BV Applications | 12 Jan 2026 | 13 Jan 2026 | 12 Jan 2027 |
| 641 | sripai.com | TurnCommerce, Inc. DBA NameBright.com | 10 May 2008 | 11 Nov 2025 | 10 May 2026 |
| 642 | sripingresort.com | GoDaddy.com, LLC | 13 Apr 2022 | 25 Apr 2023 | 13 Apr 2024 |
| 643 | sripathikethu.com | GoDaddy.com, LLC | 19 Feb 2014 | 20 Feb 2024 | 19 Feb 2026 |
| 644 | sripremasaitrust.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Mar 2013 | 10 Mar 2016 | 8 Mar 2017 |
| 645 | sriphat.com | GoDaddy.com, LLC | 4 May 2011 | 30 Apr 2025 | 4 May 2026 |
| 646 | sripd.com | - | 8 Aug 2025 | 8 Aug 2025 | 8 Aug 2026 |
| 647 | sripearlwhiteholidaytours.com | DomainSite, Inc. | 15 Mar 2014 | 15 Feb 2016 | 15 Mar 2017 |
| 648 | sripong.com | Realtime Register B.V. | 3 Oct 2024 | 17 Oct 2025 | 3 Oct 2025 |
| 649 | sripadam.com | Network Solutions, LLC | 9 May 2000 | 10 Mar 2025 | 9 May 2030 |
| 650 | sripadmam.com | GoDaddy.com, LLC | 19 Jun 2013 | 19 Jun 2025 | 19 Jun 2026 |
| 651 | sripadmamayurveda.com | GoDaddy.com, LLC | 25 Feb 2013 | 26 Feb 2025 | 25 Feb 2026 |
| 652 | sripandurangatrust.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Oct 2013 | 1 Dec 2025 | 30 Oct 2026 |
| 653 | sripalexports.com | GoDaddy.com, LLC | 28 Aug 2008 | 21 Aug 2025 | 28 Aug 2026 |
| 654 | sripangulur2.com | GoDaddy.com, LLC | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 655 | sripc.com | Chengdu West Dimension Digital Technology Co., Ltd… | 4 Aug 2021 | 4 Aug 2021 | 4 Aug 2026 |
| 656 | sripharmaindia.com | GoDaddy.com, LLC | 16 May 2014 | 16 May 2014 | 16 May 2019 |
| 657 | sripushp.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 16 Nov 2022 | 20 Nov 2023 | 16 Nov 2023 |
| 658 | sripada.com | 1&1 Internet AG | 15 Nov 2002 | 16 Nov 2025 | 15 Nov 2026 |
| 659 | sripath.com | GoDaddy.com, LLC | 20 Dec 2013 | 17 Dec 2023 | 20 Dec 2030 |
| 660 | sripaksi.com | Tucows Domains Inc. | 5 Jun 2012 | 7 May 2025 | 5 Jun 2026 |
| 661 | sripanakkattodil.com | GoDaddy.com, LLC | 20 Apr 2012 | 19 Apr 2016 | 20 Apr 2017 |
| 662 | sripop.com | Cosmotown, Inc. | 10 Dec 2025 | 10 Dec 2025 | 10 Dec 2026 |
| 663 | sriparasakthicollege.com | SliceofHeaven Domains, LLC | 25 Jan 2024 | 10 Mar 2025 | 25 Jan 2025 |
| 664 | sripalanimalaimurugan.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 1 Oct 2025 | 1 Oct 2025 | 1 Oct 2026 |
| 665 | sripadmavathisilks.com | GoDaddy.com, LLC | 6 May 2013 | 15 May 2024 | 6 May 2029 |
| 666 | sriprathumyotha.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Apr 2014 | 21 Apr 2017 | 21 Apr 2018 |
| 667 | sriparvathi.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Jul 2021 | 15 Jul 2023 | 15 Jul 2024 |
| 668 | sripropertysg.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Oct 2023 | 4 Nov 2025 | 20 Oct 2026 |
| 669 | sripundrik.com | GoDaddy.com, LLC | 5 Oct 2011 | 24 Dec 2025 | 5 Oct 2030 |
| 670 | sriponews.com | Amazon Registrar, Inc. | 29 Oct 2012 | 24 Sep 2025 | 29 Oct 2026 |
| 671 | sripubnet.com | eNom, Inc. | 26 Dec 2007 | 30 Dec 2025 | 26 Dec 2026 |
| 672 | sripadmavathityresandservices.com | GMO Internet Inc. | 3 Apr 2023 | 14 May 2024 | 2 Apr 2024 |
| 673 | sripur.com | NameCheap, Inc. | 28 Jan 2026 | 28 Jan 2026 | 28 Jan 2027 |
| 674 | sripadman.com | GoDaddy.com, LLC | 22 Nov 2006 | 2 Jan 2026 | 22 Nov 2025 |
| 675 | sriphanomtour.com | Free Spirit Domains, LLC | 18 Nov 2017 | 18 Nov 2017 | 18 Nov 2018 |
| 676 | sripelangimanagement.com | Web Commerce Communications Limited dba WebNic.cc | 3 Aug 2010 | 3 Aug 2010 | 3 Aug 2018 |
| 677 | sripoonsuk.com | TierraNet Inc. d/b/a DomainDiscover | 30 Mar 2010 | 22 Jan 2025 | 30 Mar 2027 |
| 678 | sripo.com | GoDaddy.com, LLC | 24 Apr 2021 | 21 May 2025 | 24 Apr 2026 |
| 679 | sripuramspurthi.com | GoDaddy.com, LLC | 21 Apr 2009 | 22 Apr 2025 | 21 Apr 2026 |
| 680 | sripanwaphuket.com | GoDaddy.com, LLC | 14 Jul 2009 | 25 Aug 2024 | 14 Jul 2024 |
| 681 | sriprasiddhiengineers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 May 2009 | 3 May 2017 | 4 May 2018 |
| 682 | sripadrao.com | eNom, Inc. | 21 Jul 2003 | 2 Sep 2016 | 21 Jul 2016 |
| 683 | sripanngoen.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 Jan 2022 | 16 Mar 2024 | 13 Jan 2024 |
| 684 | sripix.com | HiChina Zhicheng Technology Limited | 27 May 2019 | 27 May 2019 | 27 May 2020 |
| 685 | sripowergroup.com | Name.com, Inc. | 11 Sep 2008 | 12 Sep 2025 | 11 Sep 2026 |
| 686 | sriphysio.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Feb 2021 | 9 Feb 2025 | 15 Feb 2026 |
| 687 | srippaya.com | Japan Registry Services Co., Ltd. | 12 Jan 2001 | 26 Nov 2025 | 12 Jan 2027 |
| 688 | sripong2012.com | Tucows Domains Inc. | 13 Jul 2012 | 15 Jul 2025 | 13 Jul 2026 |
| 689 | sripenaga.com | Shinjiru MSC Sdn Bhd | 24 May 2007 | 11 Sep 2025 | 24 May 2026 |
| 690 | sripathipaperboards.com | Tucows Domains Inc. | 1 Dec 2025 | 1 Dec 2025 | 1 Dec 2026 |
| 691 | sripravasatravels.com | BigRock Solutions Ltd. | 4 Apr 2013 | 10 May 2015 | 4 Apr 2017 |
| 692 | sripatumstudio.com | OnlineNIC, Inc. | 22 Apr 2010 | 23 Oct 2017 | 22 Apr 2018 |
| 693 | sriplanet.com | TurnCommerce, Inc. DBA NameBright.com | 9 Apr 2017 | 21 Jun 2024 | 9 Apr 2024 |
| 694 | sriproserv.com | Tucows Domains Inc. | 4 Sep 2010 | 20 Aug 2025 | 4 Sep 2026 |
| 695 | sriprs.com | BigRock Solutions Ltd. | 5 Aug 2014 | 17 Sep 2016 | 5 Aug 2016 |
| 696 | sripathikrishnan.com | Squarespace Domains LLC | 27 Dec 2025 | 27 Dec 2025 | 27 Dec 2028 |
| 697 | sriprasannametals.com | Dynadot17 LLC | 4 May 2024 | 14 Jul 2025 | 4 May 2025 |
| 698 | sripower.com | Melbourne IT, Ltd | 29 Apr 2001 | 9 May 2025 | 29 Apr 2026 |
| 699 | sripattabiraman.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2012 | 8 Jan 2017 | 8 Jan 2018 |
| 700 | sripumps.com | TurnCommerce, Inc. DBA NameBright.com | 18 Aug 2017 | 12 Aug 2020 | 18 Aug 2026 |
| 701 | sripharmacare.com | Network Solutions, LLC | 8 Jun 2004 | 9 Jun 2025 | 8 Jun 2028 |
| 702 | sripowerservices.com | Tucows Domains Inc. | 28 Oct 2011 | 13 Oct 2025 | 28 Oct 2026 |
| 703 | sriplanroom.com | GoDaddy.com, LLC | 1 Dec 2003 | 2 Dec 2025 | 1 Dec 2026 |
| 704 | sripurvarama.com | GoDaddy.com, LLC | 16 Dec 2013 | 16 Dec 2014 | 16 Dec 2016 |
| 705 | sripandiyanindustries.com | GoDaddy.com, LLC | 31 Aug 2011 | 12 Oct 2025 | 31 Aug 2025 |
| 706 | sriprasit.com | Tucows Domains Inc. | 27 Apr 2005 | 18 Oct 2023 | 27 Apr 2027 |
| 707 | sriphetchabun.com | NameCheap, Inc. | 16 Jan 2004 | 27 Dec 2024 | 16 Jan 2026 |
| 708 | sripickpens.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2012 | 14 Nov 2017 | 14 Nov 2017 |
| 709 | sripadhcons.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 May 2012 | 19 Jul 2012 | 19 May 2017 |
| 710 | sriphanwong.com | GoDaddy.com, LLC | 12 Oct 2012 | 8 May 2025 | 12 Oct 2026 |
| 711 | sripelangicsb1.com | Web Commerce Communications Limited dba WebNic.cc | 29 Oct 2013 | 29 Oct 2013 | 29 Oct 2018 |
| 712 | sripadahotel.com | GoDaddy.com, LLC | 5 Mar 2014 | 6 Mar 2016 | 5 Mar 2017 |
| 713 | sripadmavathiwebhost.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Apr 2004 | 25 Mar 2017 | 1 Apr 2018 |
| 714 | sripothuloorigold.com | Tucows Domains Inc. | 30 Jan 2020 | 3 Feb 2022 | 30 Jan 2022 |
| 715 | sripalmygroup.com | Network Solutions, LLC | 22 Sep 2012 | 29 Jan 2015 | 22 Sep 2017 |
| 716 | sriproject.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Nov 2013 | 26 Nov 2015 | 12 Nov 2016 |
| 717 | sripadasrivallabhamahasamsthanam.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Dec 2012 | 28 Dec 2025 | 26 Dec 2026 |
| 718 | sriputraapartment.com | GoDaddy.com, LLC | 25 Feb 2011 | 15 Jan 2015 | 25 Feb 2017 |
| 719 | sripattaniswamy.com | Google, Inc. | 11 Sep 2012 | 12 Sep 2023 | 11 Sep 2024 |
| 720 | sriplacement.com | Tucows Domains Inc. | 25 Feb 2004 | 22 Feb 2025 | 25 Feb 2026 |
| 721 | sripe.com | TurnCommerce, Inc. DBA NameBright.com | 18 May 2011 | 18 Mar 2024 | 18 May 2026 |
| 722 | sriploy.com | Name.com, Inc. | 21 Feb 2022 | 30 Jan 2026 | 21 Feb 2027 |
| 723 | sripoma.com | Tucows Domains Inc. | 5 Dec 2008 | 25 Jul 2025 | 5 Dec 2027 |
| 724 | sripen.com | DropCatch.com 1380 LLC | 25 Dec 2024 | 25 Jan 2026 | 25 Dec 2025 |
| 725 | sripengantin.com | Painted Pony Names, LLC | 8 Jun 2017 | 9 Jun 2017 | 8 Jun 2018 |
| 726 | sripolytechnic.com | EastEndDomains, LLC | 22 Nov 2019 | 23 Nov 2019 | 22 Nov 2020 |
| 727 | sriprecitec.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Mar 2008 | 27 Nov 2016 | 6 Mar 2019 |
| 728 | sriprakashaenterprises.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 May 2018 | 8 May 2018 | 8 May 2019 |
| 729 | sripadha.com | GoDaddy.com, LLC | 22 Sep 2020 | 29 Sep 2024 | 22 Sep 2026 |
| 730 | sripanwaresidencesphuket.com | GoDaddy.com, LLC | 2 Sep 2010 | 3 Sep 2024 | 2 Sep 2026 |
| 731 | sriphetfamily.com | GoDaddy.com, LLC | 15 Oct 2006 | 16 Oct 2025 | 15 Oct 2026 |
| 732 | sriphotography.com | Google, Inc. | 12 Apr 2013 | 28 Mar 2025 | 12 Apr 2026 |
| 733 | sripadavallabhamiracles.com | GoDaddy.com, LLC | 13 Jun 2014 | 10 Jun 2024 | 13 Jun 2026 |
| 734 | sripangkor.com | GMO Internet Inc. | 8 Jul 2022 | 18 Sep 2023 | 8 Jul 2023 |
| 735 | sriponveltextiles.com | Wild West Domains, LLC | 4 Nov 2013 | 10 Nov 2015 | 4 Nov 2016 |
| 736 | sripanwa-resales.com | GoDaddy.com, LLC | 7 Mar 2013 | 8 Mar 2016 | 7 Mar 2017 |
| 737 | sriportfolios.com | GoDaddy.com, LLC | 8 Nov 2013 | 18 Jun 2025 | 6 Apr 2025 |
| 738 | sripremasai.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Mar 2013 | 10 Mar 2016 | 8 Mar 2017 |
| 739 | sripalsanijewels.com | GoDaddy.com, LLC | 9 Feb 2018 | 9 Oct 2022 | 9 Feb 2028 |
| 740 | sripadhmam.com | GoDaddy.com, LLC | 28 Jul 2010 | 23 Jul 2025 | 28 Jul 2026 |
| 741 | sripadmavathitravels.com | Wild West Domains, LLC | 7 May 2024 | 19 Jul 2025 | 7 May 2025 |
| 742 | sriprivateiti.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jun 2013 | 17 Aug 2013 | 17 Jun 2018 |
| 743 | sripriyaconstructions.com | Tucows Domains Inc. | 29 Nov 2013 | 28 Nov 2025 | 29 Nov 2026 |
| 744 | sriparvatiengineeringservices.com | GoDaddy.com, LLC | 28 Mar 2014 | 28 Mar 2016 | 28 Mar 2017 |
| 745 | sriprembaba.com | Porkbun, LLC | 14 Jul 2012 | 13 Jul 2025 | 14 Jul 2026 |
| 746 | sripadapinakapani.com | GoDaddy.com, LLC | 17 Jan 2022 | 30 Mar 2024 | 17 Jan 2024 |
| 747 | sripalang.com | eNom, Inc. | 3 Jun 2013 | 9 Apr 2024 | 3 Jun 2026 |
| 748 | sripplephotography.com | DOMAIN NAME NETWORK PTY LTD | 4 Aug 2021 | 4 Aug 2021 | 4 Aug 2022 |
| 749 | sriplatform.com | 1&1 Internet AG | 22 Oct 2011 | 23 Oct 2016 | 22 Oct 2018 |
| 750 | sripan.com | OnlineNIC, Inc. | 11 Aug 2008 | 20 Sep 2025 | 11 Aug 2025 |
| 751 | sripathanjaliyogacentre.com | - | 31 May 2024 | 29 May 2025 | 31 May 2026 |
| 752 | sripartners.com | GoDaddy.com, LLC | 23 May 2017 | 24 May 2025 | 23 May 2026 |
| 753 | sripal.com | NameCheap, Inc. | 5 Aug 2002 | 6 Jul 2025 | 5 Aug 2026 |
| 754 | sriproperties.com | TurnCommerce, Inc. DBA NameBright.com | 4 Sep 2004 | 23 Jun 2025 | 4 Sep 2026 |
| 755 | sripreecha.com | CloudFlare, Inc. | 22 Feb 2011 | 28 Aug 2025 | 22 Feb 2026 |
| 756 | sripitham.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Sep 2012 | 14 Sep 2025 | 18 Sep 2026 |
| 757 | sripanwarental.com | GoDaddy.com, LLC | 14 Jul 2009 | 9 Jul 2015 | 14 Jul 2017 |
| 758 | sriperakumhousingproject.com | Hongkong Domain Name Information Management Co., L… | 14 Apr 2021 | 14 Apr 2021 | 14 Apr 2022 |
| 759 | sripattour.com | OnlineNIC, Inc. | 22 Sep 2013 | 25 Sep 2016 | 22 Sep 2016 |
| 760 | sripadamarketing.com | CloudFlare, Inc. | 1 Oct 2011 | 10 Dec 2024 | 1 Oct 2024 |
| 761 | sripathi.com | GoDaddy.com, LLC | 11 Nov 2001 | 9 Aug 2024 | 11 Nov 2026 |
| 762 | sriplattform.com | 1&1 Internet AG | 22 Oct 2011 | 23 Oct 2016 | 22 Oct 2018 |
| 763 | sripadmanabhaswamy.com | DropCatch.com 1124 LLC | 20 Sep 2017 | 20 Sep 2017 | 20 Sep 2018 |
| 764 | srippl.com | Hostinger, UAB | 20 Dec 2009 | 22 Dec 2025 | 20 Dec 2026 |
| 765 | sripetrochemical.com | register.com, Inc. | 23 Jun 2014 | 8 Jun 2016 | 23 Jun 2018 |
| 766 | sripethotel.com | eNom, Inc. | 2 Jan 2008 | 18 Dec 2016 | 2 Jan 2019 |
| 767 | sriponkaliamman.com | PSI-USA, Inc. dba Domain Robot | 11 Jul 2023 | 10 Jul 2024 | 11 Jul 2024 |
| 768 | sripremacharitabletrust.com | Tucows Domains Inc. | 23 Mar 2013 | 16 Feb 2025 | 23 Mar 2026 |
| 769 | sripuchonghotel.com | Automattic Inc. | 4 Apr 2011 | 23 Nov 2025 | 4 Apr 2027 |
| 770 | sriphala.com | CV. Jogjacamp | 19 Dec 2016 | 27 Feb 2025 | 3 Mar 2026 |
| 771 | sripanwaholiday.com | GoDaddy.com, LLC | 7 Apr 2011 | 8 Mar 2015 | 7 Apr 2017 |
| 772 | sripadas.com | GoDaddy.com, LLC | 8 Apr 2005 | 9 Apr 2025 | 8 Apr 2026 |
| 773 | sripadindia.com | GoDaddy.com, LLC | 10 Apr 2009 | 5 Mar 2025 | 10 Apr 2026 |
| 774 | sripadh.com | Eranet International Limited | 14 May 2022 | 20 Jun 2023 | 14 May 2023 |
| 775 | sripadmanabhaswamytemple.com | DropCatch.com 1024 LLC | 20 Sep 2017 | 20 Sep 2017 | 20 Sep 2018 |
| 776 | sripayung.com | NameCheap, Inc. | 25 Jun 2025 | 25 Jun 2025 | 25 Jun 2026 |
| 777 | sriprakashschools.com | GoDaddy.com, LLC | 23 Oct 2007 | 23 Oct 2025 | 23 Oct 2026 |
| 778 | sripolla.com | GoDaddy.com, LLC | 7 Oct 2013 | 13 Oct 2015 | 7 Oct 2016 |
| 779 | sripenagagroup.com | GoDaddy.com, LLC | 14 May 2012 | 15 May 2016 | 14 May 2017 |
| 780 | sripanwaluxury.com | GoDaddy.com, LLC | 14 Jul 2009 | 9 Jul 2015 | 14 Jul 2017 |
| 781 | sripalmyitsolutions.com | Network Solutions, LLC | 5 Jun 2013 | 5 Mar 2017 | 5 Jun 2018 |
| 782 | sriprintanddesign.com | 1&1 Internet AG | 3 May 2014 | 4 May 2016 | 3 May 2017 |
| 783 | sripranananda.com | NameCheap, Inc. | 4 Jan 2004 | 18 Jul 2025 | 17 Aug 2026 |
| 784 | sripetaling-kualalumpur.com | eNom, Inc. | 26 Jul 2010 | 27 Jun 2017 | 26 Jul 2018 |
| 785 | sript.com | GoDaddy.com, LLC | 5 Mar 2005 | 13 Feb 2025 | 5 Mar 2026 |
| 786 | sripradafashions.com | Wild West Domains, LLC | 7 May 2014 | 7 May 2024 | 7 May 2034 |
| 787 | sripadsteels.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jul 2002 | 28 Jul 2025 | 24 Jul 2026 |
| 788 | sriptech.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Dec 2012 | 15 Dec 2025 | 15 Dec 2026 |
| 789 | sripathy.com | TurnCommerce, Inc. DBA NameBright.com | 30 Apr 2017 | 10 Jun 2025 | 30 Apr 2025 |
| 790 | sripanwavilla.com | Beijing Lanhai Jiye Technology Co., Ltd | 1 Oct 2023 | 16 Oct 2025 | 1 Oct 2026 |
| 791 | sripadukaacademy.com | eNom, Inc. | 29 May 2011 | 25 Nov 2025 | 29 May 2026 |
| 792 | sriputtrumurugan.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Mar 2013 | 27 Dec 2024 | 11 Mar 2026 |
| 793 | sripriyaadvisoryservices.com | eNom, Inc. | 29 Feb 2012 | 18 Feb 2016 | 28 Feb 2017 |
| 794 | sripoppular.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jun 2014 | 17 Jun 2025 | 17 Jun 2026 |
| 795 | sripatanjalinurserygarden.com | GoDaddy.com, LLC | 13 Nov 2014 | 22 Nov 2015 | 13 Nov 2017 |
| 796 | sripl.com | GoDaddy.com, LLC | 26 Aug 2005 | 21 Jun 2024 | 26 Aug 2028 |
| 797 | sripitsanu-sichang-resort.com | Uniregistrar Corp | - | - | - |
| 798 | sriplaw.com | GoDaddy.com, LLC | 20 Dec 2012 | 20 Dec 2025 | 20 Dec 2026 |
| 799 | sriponvanduayyanar.com | Good Domain Registry Pvt Ltd. | 15 Sep 2012 | 8 Sep 2025 | 15 Sep 2026 |
| 800 | sriprabha.com | GoDaddy.com, LLC | 27 Oct 2005 | 27 Oct 2024 | 27 Oct 2026 |
| 801 | sripharma.com | TurnCommerce, Inc. DBA NameBright.com | 6 Sep 2013 | 25 Aug 2021 | 6 Sep 2026 |
| 802 | sripinunt-hotel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Oct 2011 | 13 Oct 2017 | 13 Oct 2017 |
| 803 | sripleystudio.com | GoDaddy.com, LLC | 6 Mar 2012 | 6 Mar 2012 | 6 Mar 2017 |
| 804 | sripadmanabharic.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Dec 2012 | 22 Dec 2025 | 5 Dec 2026 |
| 805 | sripadmavathisilk.com | BigRock Solutions Ltd. | 26 Oct 2013 | 31 Oct 2017 | 26 Oct 2018 |
| 806 | sripadmainfoway.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2005 | 28 Aug 2016 | 28 Aug 2016 |
| 807 | sriphils.com | register.com, Inc. | 21 Sep 2004 | 22 Aug 2024 | 21 Sep 2026 |
| 808 | sripantairesort.com | Eranet International Limited | 9 Nov 2025 | 26 Dec 2025 | 9 Nov 2026 |
| 809 | sripurnomo.com | CV. Rumahweb Indonesia | 19 Sep 2011 | - | 19 Sep 2016 |
| 810 | sripixel.com | Realtime Register B.V. | 26 Nov 2024 | 27 Nov 2025 | 26 Nov 2026 |
| 811 | sripoku.com | Amazon Registrar, Inc. | 15 Oct 2008 | 10 Sep 2025 | 15 Oct 2026 |
| 812 | sripadasamadhi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Oct 2018 | 6 Oct 2025 | 19 Oct 2026 |
| 813 | sriprofessionalservices.com | Tucows Domains Inc. | 4 Sep 2010 | 20 Aug 2025 | 4 Sep 2026 |
| 814 | sriphumsin.com | Web Commerce Communications Limited dba WebNic.cc | 17 Dec 2012 | 4 Apr 2013 | 17 Dec 2017 |
| 815 | sripushpam.com | Tucows Domains Inc. | 4 Nov 2009 | 14 Oct 2025 | 4 Nov 2026 |
| 816 | sripatmansion.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Dec 2011 | 17 Dec 2012 | 23 Dec 2017 |
| 817 | sripallavicaterers.com | Wild West Domains, LLC | 26 Sep 2023 | 11 Oct 2024 | 26 Sep 2025 |
| 818 | sripoonsup.com | Google, Inc. | 1 Jul 2011 | 30 Jun 2025 | 1 Jul 2026 |
| 819 | sripoornalogistics.com | GoDaddy.com, LLC | 20 Dec 2012 | 17 Dec 2014 | 20 Dec 2016 |
| 820 | sriplus.com | TurnCommerce, Inc. DBA NameBright.com | 8 Jan 2018 | 20 Mar 2025 | 8 Jan 2025 |
| 821 | sriplast.com | Key-Systems GmbH | 20 Dec 2024 | 21 Dec 2025 | 20 Dec 2026 |
| 822 | sripadaindradasa.com | RegistryGate GmbH | 10 Feb 2011 | 23 Nov 2025 | 10 Feb 2026 |
| 823 | sriprapa.com | GoDaddy.com, LLC | 30 Sep 2005 | 1 Oct 2024 | 30 Sep 2026 |
| 824 | sripaada.com | Tucows Domains Inc. | 26 Mar 2013 | 25 Feb 2025 | 26 Mar 2026 |
| 825 | sriphairinresort.com | GoDaddy.com, LLC | 11 Sep 2011 | 12 Sep 2025 | 11 Sep 2026 |
| 826 | sriparadisetours.com | NameCheap, Inc. | 3 Jun 2024 | 11 Jun 2025 | 3 Jun 2026 |
| 827 | sriphotovideo.com | GoDaddy.com, LLC | 24 Apr 2014 | 25 Apr 2016 | 24 Apr 2017 |
| 828 | sriparimalacharya.com | BigRock Solutions Ltd. | 13 Feb 2014 | 17 Mar 2017 | 13 Feb 2020 |
| 829 | sripanwaresidence.com | GoDaddy.com, LLC | 8 Jun 2011 | 9 Jun 2025 | 8 Jun 2027 |
| 830 | sripkf.com | Network Solutions, LLC | 7 Nov 2005 | 8 Sep 2021 | 7 Nov 2026 |
| 831 | sriperumbudurs.com | Tucows Domains Inc. | 27 Feb 2005 | 18 Jun 2016 | 27 Feb 2017 |
| 832 | sripeetam.com | GoDaddy.com, LLC | 6 Aug 2002 | 9 Feb 2025 | 6 Aug 2027 |
| 833 | sripura.com | Name.com, Inc. | 9 Jan 2024 | 9 Jan 2026 | 9 Jan 2027 |
| 834 | sriprithviconstructions.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Oct 2012 | 29 Nov 2016 | 8 Oct 2018 |
| 835 | sripoonthong.com | Google, Inc. | 1 Jul 2011 | 30 Jun 2025 | 1 Jul 2026 |
| 836 | sriprakasha.com | Dynadot, LLC | 19 Mar 2008 | 1 Jun 2025 | 19 Mar 2027 |
| 837 | sripanchamukhi.com | Tucows Domains Inc. | 11 Sep 2011 | 15 Sep 2017 | 11 Sep 2017 |
| 838 | sripearls.com | Xin Net Technology Corporation | 9 Jul 2019 | 31 May 2020 | 9 Jul 2020 |
| 839 | sripathisolutions.com | NameCheap, Inc. | 31 May 2025 | 31 May 2025 | 31 May 2026 |
| 840 | sripair.com | 1&1 Internet AG | 7 Sep 2012 | 10 Oct 2025 | 7 Sep 2026 |
| 841 | sripitambara.com | GoDaddy.com, LLC | 26 Oct 2013 | 3 Nov 2015 | 26 Oct 2016 |
| 842 | sripaduka.com | GoDaddy.com, LLC | 21 Apr 2024 | 28 Apr 2025 | 21 Apr 2026 |
| 843 | sriparvathiexports.com | Beijing Lanhai Jiye Technology Co., Ltd | 22 Dec 2021 | 23 Jan 2025 | 22 Dec 2024 |
| 844 | sripukhraj.com | DNC Holdings, Inc. | 25 Apr 2013 | - | 25 Apr 2018 |
| 845 | sriparshvadrughouse.com | - | 12 Sep 2024 | 14 Oct 2025 | 12 Sep 2025 |
| 846 | sriprahlada.com | GoDaddy.com, LLC | 27 Apr 2010 | 22 Apr 2024 | 27 Apr 2027 |
| 847 | sripadmavathiengg.com | eNom, Inc. | 29 Jun 2011 | 1 Jul 2017 | 29 Jun 2018 |
| 848 | sripalmavilla.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Aug 2011 | 14 Aug 2025 | 15 Aug 2026 |
| 849 | sripay.com | GoDaddy.com, LLC | 25 Nov 2009 | 27 Sep 2024 | 25 Nov 2028 |
| 850 | srippe.com | Network Solutions, LLC | 12 Apr 1999 | 18 Apr 2024 | 12 Apr 2027 |
| 851 | sriplasticindustries.com | GoDaddy.com, LLC | 9 May 2014 | 9 May 2014 | 9 May 2019 |
| 852 | sripuwath.com | NameCheap, Inc. | 24 Sep 2009 | 25 Sep 2025 | 24 Sep 2026 |
| 853 | sriprarthanaschool.com | GoDaddy.com, LLC | 15 Aug 2022 | 26 Sep 2023 | 15 Aug 2023 |
| 854 | sriprosmaju.com | Web Commerce Communications Limited dba WebNic.cc | 20 Apr 2010 | 20 Apr 2010 | 20 Apr 2018 |
| 855 | sripanwaresales.com | GoDaddy.com, LLC | 7 Mar 2013 | 8 Mar 2015 | 7 Mar 2017 |
| 856 | sripackaging.com | GoDaddy.com, LLC | 9 Apr 2007 | 10 Apr 2025 | 9 Apr 2027 |
| 857 | sriproperty.com | Annulet LLC | 13 Oct 2013 | 14 Oct 2025 | 13 Oct 2026 |
| 858 | sripolychem.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Aug 2009 | 19 Sep 2016 | 8 Aug 2016 |
| 859 | sriponazhagunachiamman.com | Porkbun, LLC | 15 Apr 2013 | 26 Jul 2025 | 15 Apr 2026 |
| 860 | sripuram.com | TurnCommerce, Inc. DBA NameBright.com | 20 Jul 2006 | 11 Nov 2025 | 20 Jul 2026 |
| 861 | sriparasarabhattar.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2013 | 6 Mar 2017 | 28 Jan 2018 |
| 862 | sripuramtemple.com | GoDaddy.com, LLC | 29 Jul 2013 | 16 Jul 2016 | 29 Jul 2017 |
| 863 | sripunyabhoomi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 May 2017 | 28 Jul 2017 | 28 May 2018 |
| 864 | sripurwanto.com | CV. Jogjacamp | 15 Mar 2010 | 15 Mar 2016 | 15 Mar 2018 |
| 865 | sripmscop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Sep 2002 | 3 Sep 2025 | 4 Sep 2026 |
| 866 | sripf-alsace.com | OVH sas | 20 Dec 2004 | 8 Dec 2016 | 20 Dec 2019 |
| 867 | sripola.com | Amazon Registrar, Inc. | 18 Jan 2010 | 14 Dec 2025 | 18 Jan 2027 |
| 868 | sripaisit.com | Namesilo, LLC | 19 Nov 2007 | 20 Nov 2025 | 19 Nov 2026 |
| 869 | sripetch.com | OnlineNIC, Inc. | 17 Oct 2008 | 22 Oct 2025 | 17 Oct 2026 |
| 870 | sriprathyangiradevi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Jan 2012 | 15 Jan 2017 | 27 Jan 2018 |
| 871 | sripadinhiraadkavu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Oct 2011 | 26 Oct 2017 | 26 Oct 2018 |
| 872 | sriplanning.com | Squarespace Domains LLC | 23 Dec 2024 | 8 Dec 2025 | 23 Dec 2026 |
| 873 | sripangulur3.com | GoDaddy.com, LLC | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 874 | sriperiyandavarmodernricemill.com | - | 3 Oct 2016 | 3 Oct 2016 | 3 Oct 2017 |
| 875 | sripongmarket.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Oct 2016 | 15 Nov 2017 | 4 Oct 2017 |
| 876 | sripiwat.com | OnlineNIC, Inc. | 19 Aug 2008 | 22 Aug 2025 | 19 Aug 2026 |
| 877 | sriplecit.com | - | 19 Sep 2023 | 19 Nov 2024 | 19 Sep 2024 |
| 878 | sripal.us | Uniregistrar Corp | 7 Oct 2016 | 7 Oct 2016 | 6 Oct 2017 |
| 879 | sripermata.com | - | 10 Oct 2016 | 10 Oct 2016 | 10 Oct 2017 |
| 880 | sripuramstore.com | GoDaddy.com, LLC | 10 Oct 2016 | 19 Dec 2024 | 10 Oct 2026 |
| 881 | sriportfolios.info | GoDaddy.com, LLC | 8 Nov 2013 | 21 Dec 2015 | 8 Nov 2021 |
| 882 | sripenagagroup.info | GoDaddy.com, LLC | 14 May 2012 | 15 May 2017 | 14 May 2018 |
| 883 | sriprathinik.info | GoDaddy.com, LLC | 9 Sep 2011 | 21 Sep 2016 | 9 Sep 2017 |
| 884 | sriprakashjaiswal.info | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Mar 2014 | 6 Mar 2017 | 4 Mar 2018 |
| 885 | sriprakashswamigal.info | GoDaddy.com, LLC | 4 May 2012 | 4 May 2020 | 4 May 2021 |
| 886 | sripati.info | GoDaddy.com, LLC | 21 Jan 2011 | 30 Jan 2026 | 21 Jan 2027 |
| 887 | sripada.info | 1&1 Internet AG | 14 Jan 2024 | 24 Jan 2026 | 14 Jan 2027 |
| 888 | sripanwa.info | GoDaddy.com, LLC | 2 Apr 2022 | 14 Apr 2023 | 2 Apr 2024 |
| 889 | sripurampeeth.com | Good Domain Registry Pvt Ltd. | 12 Oct 2016 | 21 Nov 2017 | 12 Oct 2017 |
| 890 | sripub.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Oct 2016 | 24 Nov 2017 | 12 Oct 2017 |
| 891 | sripakpraresort.com | - | 14 Oct 2016 | 14 Oct 2016 | 14 Oct 2017 |
| 892 | sripmpl.com | BigRock Solutions Ltd. | 17 Oct 2016 | 18 Oct 2017 | 17 Oct 2018 |
| 893 | sriproserv.net | Tucows Domains Inc. | 4 Sep 2010 | 20 Aug 2025 | 4 Sep 2026 |
| 894 | sripanwa.net | GoDaddy.com, LLC | 4 May 2007 | 28 Aug 2025 | 4 May 2026 |
| 895 | sripriya.net | GoDaddy.com, LLC | 21 Jul 2008 | 13 Jul 2016 | 21 Jul 2017 |
| 896 | srippers.net | Tucows Domains Inc. | 3 Sep 2008 | 9 Aug 2016 | 3 Sep 2017 |
| 897 | sripada.net | GoDaddy.com, LLC | 16 Nov 2012 | 17 Nov 2025 | 16 Nov 2026 |
| 898 | sripages.net | GoDaddy.com, LLC | 3 Jun 2006 | 8 Jun 2016 | 3 Jun 2017 |
| 899 | sripad.net | DropCatch.com 1228 LLC | 6 Jun 2019 | 6 Jun 2019 | 6 Jun 2020 |
| 900 | sriphan.net | Tucows Domains Inc. | 30 Sep 2006 | 4 Oct 2021 | 30 Sep 2021 |
| 901 | sriprofessionals.net | Tucows Domains Inc. | 5 Feb 2012 | 9 Feb 2017 | 5 Feb 2017 |
| 902 | sripudhuvangalamman.net | Beijing Lanhai Jiye Technology Co., Ltd | 24 Dec 2025 | 24 Dec 2025 | 24 Dec 2026 |
| 903 | sripubnet.net | eNom, Inc. | 26 Dec 2007 | 30 Dec 2025 | 26 Dec 2026 |
| 904 | sriprawat.net | NamePal.com #8025 | 6 Dec 2022 | 19 Feb 2024 | 6 Dec 2023 |
| 905 | sripranananda.net | NameCheap, Inc. | 4 Jan 2004 | 18 Jul 2025 | 17 Aug 2026 |
| 906 | sriproot.net | GMO Internet Inc. | 21 Jan 2006 | 20 Jan 2026 | 21 Jan 2027 |
| 907 | sriportfolios.net | GoDaddy.com, LLC | 8 Nov 2013 | 21 Dec 2015 | 8 Nov 2021 |
| 908 | sripraneeth.net | GoDaddy.com, LLC | 10 May 2006 | 7 Sep 2022 | 10 May 2028 |
| 909 | sriprakashswamigal.net | GoDaddy.com, LLC | 29 May 2014 | 29 May 2014 | 29 May 2019 |
| 910 | sripe.net | HiChina Zhicheng Technology Limited | 7 Jul 2009 | 11 Jun 2024 | 7 Jul 2027 |
| 911 | sriplanet.net | GoDaddy.com, LLC | 23 May 2007 | 5 Feb 2016 | 20 Jan 2017 |
| 912 | sriprofessionalservices.net | Tucows Domains Inc. | 4 Sep 2010 | 20 Aug 2025 | 4 Sep 2026 |
| 913 | sripadavallabha.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Sep 2013 | 18 Sep 2016 | 18 Sep 2016 |
| 914 | sripiboon.net | OnlineNIC, Inc. | 4 Jan 2007 | 4 Jan 2007 | 3 Jan 2017 |
| 915 | sripower.net | Tucows Domains Inc. | 28 Oct 2011 | 13 Oct 2025 | 28 Oct 2026 |
| 916 | sripadmam.net | GoDaddy.com, LLC | 19 Jun 2013 | 19 Jun 2025 | 19 Jun 2026 |
| 917 | sriprathinik.net | GoDaddy.com, LLC | 9 Sep 2011 | 3 Sep 2014 | 9 Sep 2016 |
| 918 | sripuram.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jun 2009 | 23 Jun 2025 | 23 Jun 2026 |
| 919 | sripadmamayurveda.net | GoDaddy.com, LLC | 25 Feb 2013 | 26 Feb 2025 | 25 Feb 2026 |
| 920 | sriphalagroup.net | GoDaddy.com, LLC | 24 Sep 2007 | 4 Sep 2022 | 24 Sep 2030 |
| 921 | sripremacharitabletrust.net | Tucows Domains Inc. | 23 Mar 2013 | 3 Jun 2024 | 23 Mar 2024 |
| 922 | sripcc.com | - | 20 Oct 2016 | 20 Oct 2016 | 20 Oct 2017 |
| 923 | sripriyankaglass.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Oct 2022 | 3 Jan 2024 | 22 Oct 2023 |
| 924 | sriportfolio.com | 1&1 Internet AG | 7 Mar 2022 | 20 May 2024 | 7 Mar 2024 |
| 925 | sripremananda.org | GoDaddy.com, LLC | 17 Jan 2000 | 17 Jan 2026 | 17 Jan 2027 |
| 926 | sripadmasundaramtrust.org | FastDomain Inc. | 26 Oct 2012 | 10 Dec 2025 | 26 Oct 2026 |
| 927 | sripubnet.org | eNom, Inc. | 26 Dec 2007 | 11 Mar 2017 | 26 Dec 2017 |
| 928 | sripoornamahameru.org | GoDaddy.com, LLC | 18 Jan 2006 | 13 Jan 2026 | 18 Jan 2027 |
| 929 | sripadmanabhaswamy.org | GoDaddy.com, LLC | 3 Jul 2011 | 14 Sep 2016 | 3 Jul 2017 |
| 930 | sripai.org | DomainSite, Inc. | 18 Nov 2013 | 19 Nov 2017 | 18 Nov 2018 |
| 931 | sriphat.org | GoDaddy.com, LLC | 4 May 2011 | 5 May 2025 | 4 May 2026 |
| 932 | sriproserv.org | Tucows Domains Inc. | 4 Sep 2010 | 25 Aug 2025 | 4 Sep 2026 |
| 933 | sripachaiammanmannarswamytvm.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 May 2013 | 4 Jul 2014 | 29 May 2019 |
| 934 | sripaduka.org | Amazon Registrar, Inc. | 9 Feb 2019 | 10 Jan 2025 | 9 Feb 2026 |
| 935 | sripremasai.org | GoDaddy.com, LLC | 15 Oct 2017 | 15 Oct 2017 | 15 Oct 2018 |
| 936 | sriprofessionalservices.org | Tucows Domains Inc. | 4 Sep 2010 | 25 Aug 2025 | 4 Sep 2026 |
| 937 | sriparashakthi.org | GoDaddy.com, LLC | 3 Oct 2003 | 27 Oct 2025 | 3 Oct 2026 |
| 938 | sripatum.org | HiChina Zhicheng Technology Limited | 4 Jun 2013 | 24 Jan 2016 | 4 Jun 2020 |
| 939 | sriphoenix.org | Network Solutions, LLC | 29 Mar 2008 | 5 Sep 2023 | 29 Mar 2026 |
| 940 | sripadavallabha.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Aug 2013 | 11 Aug 2025 | 6 Aug 2026 |
| 941 | sripati.org | Tucows Domains Inc. | 1 Aug 2010 | 11 Sep 2024 | 1 Aug 2024 |
| 942 | sripadmam.org | GoDaddy.com, LLC | 19 Jun 2013 | 3 Aug 2025 | 19 Jun 2026 |
| 943 | sripada.org | GoDaddy.com, LLC | 12 Aug 2000 | 26 Sep 2025 | 12 Aug 2027 |
| 944 | sriphalagroup.org | GoDaddy.com, LLC | 24 Sep 2007 | 11 Jun 2024 | 24 Sep 2030 |
| 945 | sripmscop.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Nov 2009 | 13 Nov 2025 | 9 Nov 2026 |
| 946 | sripps.org | Above.com Pty Ltd. | 3 Jul 2007 | 18 May 2025 | 3 Jul 2026 |
| 947 | sripeedam.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Nov 2012 | 17 Dec 2015 | 22 Nov 2016 |
| 948 | sriprathinik.org | GoDaddy.com, LLC | 9 Sep 2011 | 21 Oct 2016 | 9 Sep 2017 |
| 949 | sripadmamayurveda.org | GoDaddy.com, LLC | 25 Feb 2013 | 11 Apr 2025 | 25 Feb 2026 |
| 950 | sriparabrahma.org | GoDaddy.com, LLC | 14 Jun 2013 | 17 Jun 2025 | 14 Jun 2026 |
| 951 | sripuramsrivenkateswara.org | NetEarth One Inc. d/b/a NetEarth | 12 Sep 2012 | 21 Sep 2013 | 12 Sep 2017 |
| 952 | sripelangi.org | Ledl.net GmbH | 27 May 2014 | 28 May 2017 | 27 May 2018 |
| 953 | sripavitrasri.org | GoDaddy.com, LLC | 14 May 2014 | 30 Apr 2025 | 14 May 2027 |
| 954 | sripmc.org | Network Solutions, LLC | 15 Oct 2003 | 21 Aug 2023 | 15 Oct 2028 |
| 955 | sripuramgoldentemple.org | Namesilo, LLC | 19 Aug 2011 | 17 Jan 2017 | 19 Aug 2017 |
| 956 | sripadasrivallabha.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2008 | 24 Oct 2025 | 18 Nov 2026 |
| 957 | sripf02.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Jan 2011 | 11 Jan 2026 | 21 Jan 2027 |
| 958 | sripaadham.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2010 | 31 May 2017 | 27 May 2018 |
| 959 | sripadma.org | FastDomain Inc. | 15 Sep 2013 | 15 Sep 2017 | 15 Sep 2018 |
| 960 | sriplanet.org | GoDaddy.com, LLC | 23 May 2007 | 24 May 2016 | 23 May 2017 |
| 961 | sriprojects.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Oct 2006 | 8 Dec 2025 | 27 Oct 2025 |
| 962 | sripadmanabhaswamytemple.org | GoDaddy.com, LLC | 3 Jul 2011 | 14 Sep 2016 | 3 Jul 2017 |
| 963 | sripadavallabhapuram.org | GoDaddy.com, LLC | 25 Dec 2010 | 12 Apr 2015 | 25 Dec 2021 |
| 964 | sripremacharitabletrust.org | Tucows Domains Inc. | 23 Mar 2013 | 28 Jul 2025 | 23 Mar 2026 |
| 965 | sripranananda.org | NameCheap, Inc. | 4 Jan 2004 | 11 Dec 2025 | 4 Jan 2027 |
| 966 | sripl.org | 1&1 Internet AG | 9 Jan 2025 | 9 Jan 2026 | 9 Jan 2027 |
| 967 | sripurandaraashrama.org | Tucows Domains Inc. | 2 Oct 2006 | 6 Oct 2025 | 2 Oct 2026 |
| 968 | sripremasaitrust.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Mar 2013 | 10 Mar 2016 | 8 Mar 2017 |
| 969 | sripm.org | HiChina Zhicheng Technology Limited | 30 Oct 2013 | 13 May 2016 | 30 Oct 2018 |
| 970 | sripudhuvangalamman.org | GoDaddy.com, LLC | 7 Jan 2023 | 22 Aug 2024 | 7 Jan 2027 |
| 971 | sripadrao.org | eNom, Inc. | 30 Jun 2000 | 6 Jun 2025 | 30 Jun 2026 |
| 972 | sripanwa.org | GoDaddy.com, LLC | 25 Feb 2010 | 26 Feb 2017 | 25 Feb 2018 |
| 973 | sripf-bretagne.org | Network Solutions, LLC | 23 Apr 2007 | 23 Apr 2017 | 23 Apr 2019 |
| 974 | sriprofessionals.org | Tucows Domains Inc. | 5 Feb 2012 | 9 Feb 2017 | 5 Feb 2018 |
| 975 | sripf-b-fc.org | Online SAS | 23 Mar 2004 | 27 Mar 2025 | 23 Mar 2027 |
| 976 | sriprasanthisociety.org | GoDaddy.com, LLC | 11 Feb 2005 | 29 Oct 2024 | 11 Feb 2026 |
| 977 | sripasupathinathalayamkk.org | eNom, Inc. | 16 Apr 2014 | 22 May 2017 | 16 Apr 2018 |
| 978 | sriprajwalaproductions.com | - | 23 Oct 2016 | 23 Oct 2016 | 23 Oct 2017 |
| 979 | sripendowolamtim.com | CV. Rumahweb Indonesia | 24 Oct 2016 | - | 24 Oct 2017 |
| 980 | sripathitravels.com | - | 24 Oct 2016 | 24 Oct 2016 | 24 Oct 2017 |
| 981 | srippuilavasam.com | - | 26 Oct 2016 | 26 Oct 2016 | 26 Oct 2017 |
| 982 | sriplan.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Jun 2016 | 29 Jul 2016 | 3 Jun 2017 |
| 983 | sriproonlineshops.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 5 Sep 2016 | 2 Jun 2017 |
| 984 | sripps.ch | - | - | - | - |
| 985 | sripanwa.de | - | - | 21 Nov 2025 | - |
| 986 | sripanwa.kr | - | 26 Feb 2010 | 7 Mar 2017 | 26 Feb 2018 |
| 987 | sripsprivatetutor.com | - | 28 Oct 2016 | 28 Oct 2016 | 28 Oct 2017 |
| 988 | sripoker.com | eNom, Inc. | 30 Oct 2016 | 11 Dec 2017 | 30 Oct 2017 |
| 989 | sripetharanaswamykovil.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2016 | 11 Dec 2017 | 4 Nov 2018 |
| 990 | sripnd.com | - | 4 Nov 2016 | 4 Nov 2016 | 4 Nov 2017 |
| 991 | sript.org | Tucows Domains Inc. | 22 Feb 2023 | 28 Jan 2025 | 22 Feb 2026 |
| 992 | sriphumrice.com | GoDaddy.com, LLC | 7 Nov 2016 | 7 Nov 2016 | 7 Nov 2017 |
| 993 | sripabanana.com | Tucows Domains Inc. | 11 Nov 2016 | 15 Nov 2017 | 11 Nov 2017 |
| 994 | sriphotostudio.site | Google, Inc. | 10 Nov 2016 | 20 May 2020 | 10 Nov 2023 |
| 995 | sriparvathitoursandtravels.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Nov 2016 | 17 Dec 2017 | 11 Nov 2017 |
| 996 | sriprahladanarasimha.com | GoDaddy.com, LLC | 11 Nov 2016 | 11 Nov 2016 | 11 Nov 2019 |
| 997 | sripalaniyappaelumbumurivuvaidyasalai.com | GoDaddy.com, LLC | 13 Nov 2016 | 13 Nov 2016 | 13 Nov 2017 |
| 998 | srippswellness.com | eNom, Inc. | 14 Nov 2016 | 13 Nov 2016 | 14 Nov 2017 |
| 999 | sripadmavathimedicalstores.site | Google, Inc. | 17 Nov 2016 | 20 May 2020 | 17 Nov 2023 |
| 1000 | sriperumbudurland.com | Network Solutions, LLC | 17 Nov 2016 | 23 Nov 2017 | 17 Nov 2017 |
Displaying 1,000 out of 2,998 domains starting with the keyword "SRIP". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=srip
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |