With support for 
Keyword: SPARKLINGWHITE
Reverse Whois » KEYWORD [sparklingwhite ] { 49 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | sparklingwhite.com | Tucows Domains Inc. | 4 Sep 2002 | 10 Sep 2025 | 4 Sep 2025 |
| 2 | sparklingwhite.co.uk | - | 14 Jun 2012 | 22 Jul 2025 | 14 Jun 2026 |
| 3 | sparklingwhite.xyz | Dynadot, LLC | 20 May 2021 | 30 Jul 2023 | 20 May 2023 |
| 4 | sparklingwhite.uk | - | 21 Jul 2021 | 21 Jul 2022 | 21 Jul 2023 |
| 5 | sparklingwhite.org | Google, Inc. | 17 Apr 2020 | 17 Apr 2023 | 17 Apr 2024 |
| 6 | sparklingwhite.it | - | 29 Nov 2019 | 13 Jan 2025 | 28 Dec 2025 |
| 7 | sparklingwhitediamonds.com | eNom, Inc. | 17 Dec 2009 | 11 Dec 2024 | 17 Dec 2025 |
| 8 | sparklingwhitesmiles.org | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2016 |
| 9 | sparklingwhitestone.com | FastDomain Inc. | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 10 | sparklingwhiteners.com | GoDaddy.com, LLC | 11 Feb 2022 | 25 Apr 2023 | 11 Feb 2023 |
| 11 | sparklingwhiters.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 May 2015 | 19 May 2015 | 19 May 2016 |
| 12 | sparklingwhitener.com | NameKing.com Inc. | 19 May 2015 | 24 Jun 2017 | 19 May 2017 |
| 13 | sparklingwhiterners.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 14 | sparklingwhiteteeth.com | GoDaddy.com, LLC | 10 Nov 2015 | 8 Nov 2024 | 10 Nov 2025 |
| 15 | sparklingwhitemusic.com | GoDaddy.com, LLC | 13 Jun 2010 | 17 Jul 2013 | 13 Jun 2017 |
| 16 | sparklingwhitesmiles.com | Wild West Domains, LLC | 22 May 2006 | 3 Sep 2022 | 22 May 2026 |
| 17 | sparklingwhitewines.com | GoDaddy.com, LLC | 6 Dec 2005 | 16 Nov 2024 | 6 Dec 2025 |
| 18 | sparklingwhites.com | TurnCommerce, Inc. DBA NameBright.com | 21 Aug 2011 | 2 Nov 2024 | 21 Aug 2024 |
| 19 | sparklingwhitesukcosmetics.com | Easyspace LTD | 1 Sep 2012 | 25 Aug 2016 | 1 Sep 2018 |
| 20 | sparklingwhitesmile.com | GoDaddy.com, LLC | 12 Apr 2005 | 27 Feb 2024 | 12 Apr 2026 |
| 21 | sparklingwhitewine.com | GoDaddy.com, LLC | 14 Jul 2005 | 24 Jun 2025 | 14 Jul 2026 |
| 22 | sparklingwhitesandbeaches.com | GoDaddy.com, LLC | 3 Aug 2010 | 4 Aug 2016 | 3 Aug 2017 |
| 23 | sparklingwhitesmile.org | GoDaddy.com, LLC | 15 Nov 2016 | 16 Nov 2017 | 15 Nov 2018 |
| 24 | sparklingwhites.org | 1&1 Internet AG | 28 Jun 2017 | 28 Aug 2017 | 28 Jun 2018 |
| 25 | sparklingwhiteglow.com | NameCheap, Inc. | 21 Aug 2017 | 21 Aug 2017 | 21 Aug 2018 |
| 26 | sparklingwhitedownloadsite.review | NameCheap, Inc. | 18 Nov 2017 | 18 Nov 2017 | 18 Nov 2018 |
| 27 | sparklingwhites.co.uk | - | 5 Oct 2015 | 4 Oct 2023 | 5 Oct 2025 |
| 28 | sparklingwhitecs.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 9 Sep 2014 | 2 Sep 2016 | 9 Sep 2018 |
| 29 | sparklingwhitecarpetcleaning.co.uk | register.com, Inc. | 13 Nov 2017 | 6 Mar 2025 | 13 Nov 2025 |
| 30 | sparklingwhitesmilesatl.com | GoDaddy.com, LLC | 3 Jul 2018 | 14 Aug 2024 | 3 Jul 2024 |
| 31 | sparklingwhitecleaners.com | Network Solutions, LLC | 5 Mar 2019 | 5 Mar 2019 | 5 Mar 2020 |
| 32 | sparklingwhitesmilesatl.net | GoDaddy.com, LLC | 10 Mar 2019 | 11 Mar 2025 | 10 Mar 2027 |
| 33 | sparklingwhitepro.com | GoDaddy.com, LLC | 13 Oct 2019 | 13 Oct 2019 | 13 Oct 2020 |
| 34 | sparklingwhiteshop.com | Hostinger, UAB | 19 Oct 2019 | 19 Oct 2019 | 19 Oct 2020 |
| 35 | sparklingwhitesmile.net | Google, Inc. | 22 Jan 2020 | 22 Jan 2020 | 22 Jan 2021 |
| 36 | sparklingwhites.club | 1&1 Internet AG | 14 Jul 2020 | 19 Jul 2020 | 14 Jul 2021 |
| 37 | sparklingwhites.store | Tucows Domains Inc. | 30 Jun 2021 | 4 Jul 2022 | 30 Jun 2023 |
| 38 | sparklingwhitedental.com | GoDaddy.com, LLC | 29 Oct 2021 | 10 Jan 2024 | 29 Oct 2023 |
| 39 | sparklingwhiteproblems.com | GoDaddy.com, LLC | 20 Jul 2022 | 30 Aug 2024 | 20 Jul 2024 |
| 40 | sparklingwhitesmile.app | GoDaddy.com, LLC | 3 Sep 2020 | 3 Sep 2023 | 3 Sep 2024 |
| 41 | sparklingwhitesllc.com | Google, Inc. | 13 Jun 2023 | 13 Jul 2024 | 13 Jun 2024 |
| 42 | sparklingwhitesmile.com.au | - | - | 26 Nov 2024 | - |
| 43 | sparklingwhitedental.com.au | - | - | 17 Oct 2024 | - |
| 44 | sparklingwhitecleaningservices.co.uk | - | 12 Jul 2020 | 27 Jun 2025 | 12 Jul 2026 |
| 45 | sparklingwhitecleaningcompany.com | Google, Inc. | 30 May 2024 | 15 May 2025 | 30 May 2026 |
| 46 | sparklingwhitecleaningcompany.net | Wix.com Ltd. | 30 May 2024 | 30 May 2024 | 30 May 2026 |
| 47 | sparklingwhitecare.co.uk | - | 18 Feb 2025 | 18 Feb 2025 | 18 Feb 2026 |
| 48 | sparklingwhitecarpetcleaningplymouth.co.uk | register.com, Inc. | 28 Feb 2025 | 28 Feb 2025 | 28 Feb 2026 |
| 49 | sparklingwhitelimited.co.uk | - | 5 Jul 2025 | 5 Jul 2025 | 5 Jul 2026 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=sparklingwhite
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |