With support for 
Keyword: SEPTICTANK
Reverse Whois » KEYWORD [septictank ] { 2,551 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | septictank.limited | Tucows Domains Inc. | 6 Aug 2014 | 10 Aug 2019 | 6 Aug 2020 |
| 2 | septictank.guide | eNom, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 3 | septictank.help | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 4 | septictank.care | NameCheap, Inc. | 20 May 2018 | 4 Jun 2024 | 20 May 2025 |
| 5 | septictank.wales | Mesh Digital Limited | 2 Mar 2015 | 2 Mar 2017 | 2 Mar 2018 |
| 6 | septictank.solutions | NameCheap, Inc. | 27 Jul 2023 | 27 Jul 2025 | 27 Jul 2026 |
| 7 | septictank.xyz | Google, Inc. | 17 Jun 2021 | 29 May 2025 | 17 Jun 2030 |
| 8 | septictank.services | GoDaddy.com, LLC | 30 Jul 2015 | 13 Sep 2025 | 30 Jul 2026 |
| 9 | septictank.info | NameCheap, Inc. | 21 Jul 2024 | 21 Jul 2025 | 21 Jul 2026 |
| 10 | septictank.work | GoDaddy.com, LLC | 17 Apr 2025 | 22 Apr 2025 | 17 Apr 2026 |
| 11 | septictank.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2024 | 15 Oct 2025 |
| 12 | septictank.link | Uniregistrar Corp | 14 Jul 2017 | 20 Jul 2017 | 14 Jul 2018 |
| 13 | septictank.online | GoDaddy.com, LLC | 17 Apr 2025 | 27 May 2025 | 17 Apr 2026 |
| 14 | septictank.site | Hostinger, UAB | 6 Jul 2025 | 11 Jul 2025 | 6 Jul 2026 |
| 15 | septictank.co.uk | - | 7 Nov 2003 | 8 Oct 2025 | 7 Nov 2026 |
| 16 | septictank.build | Reserved for non-billable transactions where Regis… | 3 Oct 2024 | 27 Sep 2025 | 3 Oct 2026 |
| 17 | septictank.world | Synergy Wholesale Pty Ltd | 28 Apr 2016 | 13 Apr 2025 | 28 Apr 2026 |
| 18 | septictank.sydney | Synergy Wholesale Pty Ltd | 28 Apr 2016 | 18 Apr 2025 | 28 Apr 2026 |
| 19 | septictank.support | Synergy Wholesale Pty Ltd | 28 Apr 2016 | 13 Apr 2025 | 28 Apr 2026 |
| 20 | septictank.express | Synergy Wholesale Pty Ltd | 27 Apr 2016 | 13 Apr 2025 | 27 Apr 2026 |
| 21 | septictank.delivery | Synergy Wholesale Pty Ltd | 28 Apr 2016 | 13 Apr 2025 | 28 Apr 2026 |
| 22 | septictank.ltd | GoDaddy.com, LLC | 4 Jan 2025 | 9 Jan 2025 | 4 Jan 2026 |
| 23 | septictank.guru | NameCheap, Inc. | 20 May 2018 | 1 Jul 2024 | 20 May 2024 |
| 24 | septictank.company | GoDaddy.com, LLC | 17 Apr 2025 | 22 Apr 2025 | 17 Apr 2026 |
| 25 | septictank.in | - | 25 Apr 2007 | 27 Mar 2025 | 25 Apr 2026 |
| 26 | septictank.repair | NameCheap, Inc. | 21 Jan 2024 | 22 Dec 2024 | 21 Jan 2026 |
| 27 | septictank.cleaning | Google, Inc. | 16 Jun 2021 | 7 Jun 2025 | 16 Jun 2026 |
| 28 | septictank.biz | 1API GmbH | 31 Jan 2020 | 7 Mar 2024 | 31 Jan 2024 |
| 29 | septictank.tech | CV. Rumahweb Indonesia | 25 Aug 2016 | 5 Oct 2017 | 25 Aug 2017 |
| 30 | septictank.click | Hostinger, UAB | 10 Dec 2024 | 15 Dec 2024 | 10 Dec 2025 |
| 31 | septictank.com | GoDaddy.com, LLC | 25 Jan 1996 | 25 Jan 2025 | 26 Jan 2027 |
| 32 | septictank.mobi | NameCheap, Inc. | 2 Dec 2018 | 2 Dec 2018 | 2 Dec 2019 |
| 33 | septictank.net | GoDaddy.com, LLC | 4 Apr 2002 | 15 Mar 2025 | 4 Apr 2026 |
| 34 | septictank.org | GoDaddy.com, LLC | 25 Oct 2021 | 23 Apr 2025 | 25 Oct 2026 |
| 35 | septictank.us | Domain Registration Services, Inc. dba dotEarth.co… | 27 Apr 2002 | 11 Jun 2025 | 26 Apr 2026 |
| 36 | septictank.de | - | - | 26 Oct 2011 | - |
| 37 | septictank.systems | GoDaddy.com, LLC | 8 Dec 2023 | 19 Jan 2025 | 8 Dec 2024 |
| 38 | septictank.ninja | GoDaddy.com, LLC | 17 Nov 2016 | 1 Jan 2025 | 17 Nov 2026 |
| 39 | septictank.store | - | 11 Aug 2025 | 16 Aug 2025 | 11 Aug 2026 |
| 40 | septictank.uk | - | 15 Jul 2014 | 15 Jun 2025 | 15 Jul 2026 |
| 41 | septictank.org.uk | - | 1 Feb 2017 | 25 Jan 2024 | 1 Feb 2026 |
| 42 | septictank.blue | NameCheap, Inc. | 2 Dec 2018 | 2 Dec 2018 | 2 Dec 2019 |
| 43 | septictank.pro | GoDaddy.com, LLC | 16 Apr 2022 | 5 Sep 2024 | 16 Apr 2032 |
| 44 | septictank.today | GoDaddy.com, LLC | 8 Jan 2024 | 19 Feb 2025 | 8 Jan 2025 |
| 45 | septictank.life | NameCheap, Inc. | 2 Dec 2018 | 2 Dec 2018 | 2 Dec 2019 |
| 46 | septictank.tips | NameCheap, Inc. | 2 Dec 2018 | 2 Dec 2018 | 2 Dec 2019 |
| 47 | septictank.claims | Google, Inc. | 28 Mar 2019 | 3 Jun 2025 | 28 Mar 2026 |
| 48 | septictank.expert | Network Solutions, LLC | 16 Jan 2017 | 22 Dec 2019 | 16 Jan 2021 |
| 49 | septictank.homes | Global Domains International, Inc. DBA DomainCostC… | 8 Sep 2019 | 7 Nov 2019 | 8 Sep 2020 |
| 50 | septictank.sbs | NameCheap, Inc. | 17 Mar 2022 | 17 Mar 2022 | 17 Mar 2023 |
| 51 | septictank.app | NameCheap, Inc. | 29 Dec 2022 | 9 Feb 2025 | 29 Dec 2024 |
| 52 | septictank.live | CommuniGal Communication Ltd. | 21 Apr 2024 | 1 Jul 2025 | 21 Apr 2025 |
| 53 | septictank.engineer | Google, Inc. | 28 Mar 2019 | 27 May 2024 | 28 Mar 2024 |
| 54 | septictank.nl | The Registrar Company B.V. | 12 Sep 2012 | 7 Sep 2021 | - |
| 55 | septictank.co.nz | - | 2 Nov 2009 | 29 Feb 2024 | - |
| 56 | septictank.ru | - | 17 Apr 2019 | - | 17 Apr 2026 |
| 57 | septictank.be | Cronon AG | 19 Jan 2024 | - | - |
| 58 | septictank.website | NameCheap, Inc. | 5 Aug 2024 | 16 Sep 2025 | 5 Aug 2025 |
| 59 | septictank.com.au | - | - | 9 Jul 2025 | - |
| 60 | septictank.bond | Key-Systems, LLC | 28 Aug 2024 | 29 Oct 2024 | 28 Aug 2025 |
| 61 | septictank.ai | GoDaddy.com, LLC | 1 Mar 2024 | 2 Apr 2025 | 1 Mar 2026 |
| 62 | septictank.eu | - | - | - | - |
| 63 | septictank.uk.com | Porkbun, LLC | 29 Apr 2025 | 13 Jun 2025 | 29 Apr 2026 |
| 64 | septictank.ca | - | 13 Aug 2025 | 12 Oct 2025 | 13 Aug 2026 |
| 65 | septictankbiofit.com | CV. Rumahweb Indonesia | 28 Jun 2011 | 27 Aug 2025 | 27 Jun 2027 |
| 66 | septictanksga.com | eNom, Inc. | 23 Oct 2014 | 5 Dec 2024 | 23 Oct 2024 |
| 67 | septictankbio.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 68 | septictankaerator.com | Dynadot, LLC | 25 Jan 2020 | 25 Jan 2020 | 25 Jan 2021 |
| 69 | septictankfilter.com | GoDaddy.com, LLC | 18 Nov 2015 | 12 May 2025 | 11 May 2026 |
| 70 | septictankodor.com | NameCheap, Inc. | 23 Sep 2015 | 24 Aug 2025 | 23 Sep 2026 |
| 71 | septictankproblem.com | P.A. Viet Nam Company Limited | 25 Jan 2023 | 25 Jan 2023 | 25 Jan 2024 |
| 72 | septictanksusa.com | GoDaddy.com, LLC | 21 Feb 2018 | 22 Feb 2019 | 21 Feb 2020 |
| 73 | septictankservices.com | GoDaddy.com, LLC | 8 Jun 2005 | 9 Jun 2025 | 8 Jun 2026 |
| 74 | septictankindia.com | GoDaddy.com, LLC | 26 Mar 2014 | 6 Mar 2025 | 26 Mar 2026 |
| 75 | septictankplumbing.com | - | 15 Apr 2014 | 16 May 2025 | 15 Apr 2026 |
| 76 | septictanktoilet.com | CV. Rumahweb Indonesia | 31 Oct 2014 | - | 31 Oct 2017 |
| 77 | septictankpumping.ca | - | 12 Jan 2004 | 10 Jan 2025 | 12 Jan 2026 |
| 78 | septictanksforsale.com | Tucows Domains Inc. | 24 Jan 2017 | 25 Dec 2024 | 24 Jan 2026 |
| 79 | septictankodors.com | NameCheap, Inc. | 7 Dec 2007 | 7 Nov 2024 | 7 Dec 2025 |
| 80 | septictankrepair911.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 81 | septictankshoustontx.com | eNom, Inc. | 7 Aug 2013 | 9 Jul 2015 | 7 Aug 2016 |
| 82 | septictankalarm.com | Tucows Domains Inc. | 10 Jul 2009 | 10 Jun 2025 | 10 Jul 2026 |
| 83 | septictankcare.net | NameCheap, Inc. | 28 May 2010 | 28 Apr 2025 | 28 May 2026 |
| 84 | septictankparts.com | eNom, Inc. | 15 May 2007 | 2 May 2023 | 15 May 2026 |
| 85 | septictankemptyingswansea.com | GoDaddy.com, LLC | 11 Jun 2011 | 12 Jun 2015 | 11 Jun 2016 |
| 86 | septictankemptyingoxfordshire.com | DropFall.com, Inc. | 13 Jan 2022 | 13 Jan 2022 | 13 Jan 2023 |
| 87 | septictankemptyingcwmbran.com | GoDaddy.com, LLC | 11 Jun 2011 | 12 Jun 2015 | 11 Jun 2016 |
| 88 | septictankemptyingbristol.com | GoDaddy.com, LLC | 11 Jun 2011 | 12 Jun 2015 | 11 Jun 2016 |
| 89 | septictankfixer.com | GoDaddy.com, LLC | 16 Oct 2010 | 11 Dec 2024 | 10 Dec 2025 |
| 90 | septictankseverett.com | GoDaddy.com, LLC | 14 Jun 2012 | 15 Jun 2015 | 14 Jun 2016 |
| 91 | septictankemptyingherefordshire.com | GoDaddy.com, LLC | 14 Jun 2011 | 15 Jun 2015 | 14 Jun 2016 |
| 92 | septictankmankent.com | GoDaddy.com, LLC | 14 Jun 2011 | 15 Jun 2015 | 14 Jun 2016 |
| 93 | septictanksmetropolisil.com | GoDaddy.com, LLC | 16 Jun 2014 | 17 Jun 2015 | 16 Jun 2016 |
| 94 | septictankpumpinginsavannahga.com | GoDaddy.com, LLC | 26 Sep 2024 | 3 Sep 2025 | 26 Sep 2026 |
| 95 | septictankcleaningomaha.com | GoDaddy.com, LLC | 6 Nov 2014 | 7 Nov 2016 | 6 Nov 2018 |
| 96 | septictankpumpingatlanta.net | eNom, Inc. | 25 May 2016 | 25 May 2016 | 25 May 2017 |
| 97 | septictankinstallationasheville.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 98 | septictankfibreglass.com | West263 International Limited | 7 Oct 2020 | 7 Oct 2020 | 7 Oct 2021 |
| 99 | septictankemptyingscotland.com | Mesh Digital Limited | 7 Mar 2022 | 20 Apr 2023 | 7 Mar 2023 |
| 100 | septictankandexcavationservices.com | Tucows Domains Inc. | 19 Aug 2011 | 22 Aug 2014 | 19 Aug 2015 |
| 101 | septictankcleaners.net | Rebel.com Corp. | 12 Nov 2015 | 25 Sep 2017 | 12 Nov 2018 |
| 102 | septictankemptyingnorfolk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Jan 2016 | 27 Jan 2025 | 26 Jan 2026 |
| 103 | septictankpumpingorlando.com | GoDaddy.com, LLC | 12 Mar 2019 | 24 May 2024 | 12 Mar 2024 |
| 104 | septictankserviceopelikaal.com | Launchpad, Inc. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 105 | septictank-system.com | GoDaddy.com, LLC | 10 Nov 2014 | 8 Nov 2016 | 10 Nov 2017 |
| 106 | septictankssouthwales.com | Mesh Digital Limited | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 107 | septictankemptyingsouthwales.com | Mesh Digital Limited | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 108 | septictankinstallationsouthwales.com | Mesh Digital Limited | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 109 | septictankservicescumbria.com | Mesh Digital Limited | 11 Nov 2014 | 31 Oct 2017 | 11 Nov 2018 |
| 110 | septictankscumbria.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 11 Nov 2014 | 23 Jun 2024 | 11 Nov 2025 |
| 111 | septictankcleaningcumbria.com | Mesh Digital Limited | 11 Nov 2014 | 31 Oct 2017 | 11 Nov 2018 |
| 112 | septictankjacksonville.com | GoDaddy.com, LLC | 12 Sep 2014 | 12 Sep 2025 | 12 Sep 2026 |
| 113 | septictankremediation.com | TierraNet Inc. d/b/a DomainDiscover | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 114 | septictanksmonroecounty.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 115 | septictanksrandolphcounty.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 116 | septictanksstclaircounty.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 117 | septictankterbaik.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 118 | septictankpumpinginfo.com | Wild West Domains, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 119 | septictankservicesbreckenridge.com | eNom, Inc. | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 120 | septictankpumpingresults.com | GoDaddy.com, LLC | 17 Nov 2014 | 13 Nov 2016 | 17 Nov 2017 |
| 121 | septictanksatlantaga.com | Name.com, Inc. | 19 Sep 2014 | 16 Oct 2016 | 19 Sep 2017 |
| 122 | septictankinspectioncapecod.com | Eranet International Limited | 4 Apr 2025 | 4 Apr 2025 | 4 Apr 2026 |
| 123 | septictank-fibreglass.com | CV. Rumahweb Indonesia | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 124 | septictankcleaningtraversecity.com | Wild West Domains, LLC | 8 Sep 2014 | 9 Sep 2025 | 8 Sep 2026 |
| 125 | septictankemptying.net | Webfusion Ltd. | 15 Apr 2015 | 8 Apr 2017 | 15 Apr 2019 |
| 126 | septictanksemptiedpenrith.com | Mesh Digital Limited | 24 Sep 2014 | 29 Sep 2019 | 24 Sep 2019 |
| 127 | septictanksinpenrith.com | Mesh Digital Limited | 24 Sep 2014 | 29 Sep 2019 | 24 Sep 2019 |
| 128 | septictankemptyingpenrith.com | Mesh Digital Limited | 24 Sep 2014 | 29 Aug 2018 | 24 Sep 2019 |
| 129 | septictankcleaningpenrith.com | Mesh Digital Limited | 24 Sep 2014 | 29 Aug 2018 | 24 Sep 2019 |
| 130 | septictankservice.net | GoDaddy.com, LLC | 8 Apr 2025 | 8 Apr 2025 | 8 Apr 2026 |
| 131 | septictanksoakawayworms.com | GoDaddy.com, LLC | 24 Feb 2020 | 24 Feb 2020 | 24 Feb 2021 |
| 132 | septictankbacteriapackets.com | GoDaddy.com, LLC | 10 Oct 2014 | 11 Oct 2016 | 10 Oct 2017 |
| 133 | septictankserviceschilo.com | GoDaddy.com, LLC | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 134 | septictanktreatment.org | NameCheap, Inc. | 5 Apr 2022 | 16 Jun 2024 | 5 Apr 2024 |
| 135 | septictankemptying.biz | Tucows Domains Inc. | 14 Oct 2012 | 17 Oct 2014 | 13 Oct 2014 |
| 136 | septictankerservices.com | - | - | - | - |
| 137 | septictankbiotech.biz | GMO Internet Inc. | 15 Oct 2014 | 15 Oct 2014 | 14 Oct 2015 |
| 138 | septictankcontractors.com | DropCatch.com 1408 LLC | 15 Feb 2018 | 15 Feb 2018 | 15 Feb 2019 |
| 139 | septictank-depot.com | Tucows Domains Inc. | 3 Dec 2008 | 7 Dec 2014 | 3 Dec 2015 |
| 140 | septictanksc.com | GoDaddy.com, LLC | 18 Dec 2014 | 5 Apr 2025 | 18 Dec 2034 |
| 141 | septictanktablets.com | GoDaddy.com, LLC | 4 Nov 2021 | 5 Nov 2024 | 4 Nov 2025 |
| 142 | septictankserviceal.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 143 | septictanks.xyz | GoDaddy.com, LLC | 2 Jun 2014 | 27 Aug 2025 | 2 Jun 2026 |
| 144 | septictankcleaningmetropolisil.com | GoDaddy.com, LLC | 11 Aug 2015 | 10 Aug 2021 | 11 Aug 2022 |
| 145 | septictankcleaningmarionil.com | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 146 | septictankcleaningcarbondaleil.com | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 147 | septictanks.kiwi | Web Drive Ltd | 24 Nov 2016 | 29 Nov 2016 | 24 Nov 2017 |
| 148 | septictanks.cymru | Mesh Digital Limited | 8 Mar 2015 | 11 Sep 2018 | 8 Mar 2020 |
| 149 | septictankcleaning.kiwi | Tucows Domains Inc. | 18 Nov 2016 | 23 Nov 2016 | 18 Nov 2017 |
| 150 | septictanks.wales | Mesh Digital Limited | 8 Mar 2015 | 11 Sep 2018 | 8 Mar 2020 |
| 151 | septictanks.scot | 1&1 Internet AG | 27 Mar 2015 | - | 27 Mar 2016 |
| 152 | septictanksanbernardino.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2025 | 14 Aug 2027 |
| 153 | septictankorangecounty.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2025 | 14 Aug 2027 |
| 154 | septictanklosangeles.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2025 | 14 Aug 2027 |
| 155 | septictanks.direct | GoDaddy.com, LLC | 15 Apr 2015 | 2 Nov 2015 | 15 Apr 2020 |
| 156 | septictankpumpingplattsmouthne.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2017 |
| 157 | septictankplumbingplattsmouthne.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2017 |
| 158 | septictanksemptying.com | Mesh Digital Limited | 6 Jan 2015 | 30 Oct 2019 | 6 Jan 2020 |
| 159 | septictanksandsystemsuniongrove.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 160 | septictankguys.com | Porkbun, LLC | 24 Jul 2023 | 23 Jul 2025 | 24 Jul 2026 |
| 161 | septictanksemptied.net | Mesh Digital Limited | 6 Jan 2015 | 14 Dec 2016 | 6 Jan 2018 |
| 162 | septictankcleaninginanderson.com | GoDaddy.com, LLC | 16 Jan 2015 | 30 Mar 2025 | 16 Jan 2025 |
| 163 | septictankneo.com | Tucows Domains Inc. | 15 Jan 2014 | 19 Jan 2015 | 15 Jan 2016 |
| 164 | septictankcleaninginmountpoconopa.com | eNom, Inc. | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2018 |
| 165 | septictankprice.com | GoDaddy.com, LLC | 6 Jul 2025 | 6 Jul 2025 | 6 Jul 2026 |
| 166 | septictankfailure.com | DreamHost, LLC | 15 Nov 2023 | 15 Oct 2024 | 15 Nov 2025 |
| 167 | septictankprice.net | eNom, Inc. | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 168 | septictank-bonamite9.com | GMO Internet Inc. | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 169 | septictankmilkopal.com | GMO Internet Inc. | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 170 | septictankcleaningloysburgpa.com | eNom, Inc. | 6 Feb 2015 | 5 Jan 2016 | 6 Feb 2018 |
| 171 | septictankunderstanding.net | GMO Internet Inc. | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 172 | septictank-hyalite.net | GMO Internet Inc. | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 173 | septictankelaeolite.org | GMO Internet Inc. | 5 Feb 2015 | - | 5 Feb 2016 |
| 174 | septictank-reliable.org | GMO Internet Inc. | 5 Feb 2015 | - | 5 Feb 2016 |
| 175 | septictanktreatmentlocalexperts.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 176 | septictankservicelocalexperts.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 177 | septictankpumpinglocalexperts.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 178 | septictankmaintenancelocalexperts.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 179 | septictanklocalexperts.com | GoDaddy.com, LLC | 20 Aug 2015 | 11 May 2016 | 20 Aug 2016 |
| 180 | septictankinstallationlocalexperts.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 181 | septictankcleaninglocalexperts.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 182 | septictankbiotun.com | CV. Rumahweb Indonesia | 20 Aug 2015 | 13 Sep 2015 | 20 Aug 2016 |
| 183 | septictankssystems.com | TLDs LLC dba SRSplus | 9 Feb 2015 | 24 Mar 2017 | 9 Feb 2018 |
| 184 | septictankdonegal.com | Blacknight Internet Solutions Ltd. | 10 Feb 2015 | 26 Mar 2025 | 10 Feb 2025 |
| 185 | septictankpumpingcost.com | GoDaddy.com, LLC | 12 Feb 2015 | 13 Feb 2024 | 12 Feb 2026 |
| 186 | septictankfrost10.com | GMO Internet Inc. | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 187 | septictankcleaningmiamifl.com | - | 9 Jan 2025 | 9 Jan 2025 | 9 Jan 2026 |
| 188 | septictanksinscotland.com | Tucows Domains Inc. | 18 Feb 2014 | 22 Feb 2015 | 18 Feb 2016 |
| 189 | septictankbiohitech.com | GMO Internet Inc. | 23 Feb 2015 | 28 Feb 2017 | 22 Feb 2018 |
| 190 | septictankservicesinsc.com | GoDaddy.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 191 | septictanksclitheroe.com | Mesh Digital Limited | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 192 | septictanksblackburn.com | Mesh Digital Limited | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 193 | septictankpumpingcost.org | NameCheap, Inc. | 7 Jun 2018 | 22 Jul 2025 | 7 Jun 2026 |
| 194 | septictankneedletin9.com | GMO Internet Inc. | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 195 | septictank-dynamic.com | GMO Internet Inc. | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 196 | septictank-azure8.com | GMO Internet Inc. | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 197 | septictankthankful.net | GMO Internet Inc. | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 198 | septictankametrine9.net | - | - | - | - |
| 199 | septictank-happy.net | GMO Internet Inc. | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 200 | septictank-great.net | GMO Internet Inc. | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 201 | septictank-amatrix10.net | GMO Internet Inc. | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 202 | septictankdeepskyblue.org | GMO Internet Inc. | 6 Mar 2015 | - | 6 Mar 2016 |
| 203 | septictank-emery9.org | GMO Internet Inc. | 6 Mar 2015 | - | 6 Mar 2016 |
| 204 | septictankservicemodesto.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 205 | septictankpumpingpalmsprings.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 206 | septictankpumpingpalmdale.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 207 | septictankpumpingmodesto.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 208 | septictankpumpinglancaster.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 209 | septictankpumpinghemet.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 210 | septictankcleaningchennai.com | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 211 | septictankwhiteopal.org | GMO Internet Inc. | 9 Mar 2015 | - | 9 Mar 2016 |
| 212 | septictank-gymnite8.org | GMO Internet Inc. | 9 Mar 2015 | - | 9 Mar 2016 |
| 213 | septictanksscotland.com | GoDaddy.com, LLC | 18 Dec 2018 | 19 Dec 2024 | 18 Dec 2026 |
| 214 | septictankcleaningwilsonnc.com | eNom, Inc. | 13 Mar 2015 | 13 Feb 2016 | 13 Mar 2017 |
| 215 | septictankcare.org | eNom, Inc. | 15 Mar 2015 | 16 Mar 2015 | 15 Mar 2016 |
| 216 | septictankcleaningjasper.com | GoDaddy.com, LLC | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 217 | septictankservicemerced.com | GoDaddy.com, LLC | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 218 | septictankfayetteville.com | GoDaddy.com, LLC | 27 Aug 2015 | 1 Aug 2025 | 27 Aug 2026 |
| 219 | septictankcleaningatlanta.com | - | 3 May 2025 | 3 May 2025 | 3 May 2026 |
| 220 | septictankcleaners.org | Rebel.com Corp. | 1 Aug 2015 | 2 Aug 2016 | 1 Aug 2017 |
| 221 | septictankbio-green.com | Tucows Domains Inc. | 25 Mar 2014 | 29 Mar 2015 | 25 Mar 2016 |
| 222 | septictanksuk.net | Above.com Pty Ltd. | 6 Jun 2023 | 17 Jul 2025 | 6 Jun 2025 |
| 223 | septictankpumpingredding.com | Tucows Domains Inc. | 3 Apr 2015 | 7 Apr 2018 | 3 Apr 2018 |
| 224 | septictankbiosystem.com | NameCheap, Inc. | 15 Mar 2019 | 13 Feb 2025 | 15 Mar 2026 |
| 225 | septictankpumpingredding.net | Tucows Domains Inc. | 6 Apr 2015 | 10 Apr 2017 | 6 Apr 2017 |
| 226 | septictankserviceocala.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 Jul 2024 | 16 Aug 2025 | 25 Jul 2026 |
| 227 | septictanksoptions.com | Name.com, Inc. | 8 Apr 2015 | 4 May 2017 | 8 Apr 2018 |
| 228 | septictanks.org | GoDaddy.com, LLC | 22 Jun 2019 | 6 Aug 2025 | 22 Jun 2026 |
| 229 | septictanksoptions.net | eNom, Inc. | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 230 | septictanktreatmentguys.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 231 | septictankserviceguys.com | GoDaddy.com, LLC | 10 Apr 2015 | 1 Apr 2019 | 10 Apr 2020 |
| 232 | septictankpumpingguys.com | GoDaddy.com, LLC | 10 Apr 2015 | 22 May 2025 | 10 Apr 2025 |
| 233 | septictankproblemguys.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 234 | septictankmaintenanceguys.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 235 | septictankinstallationguys.com | Dynadot, LLC | 10 Aug 2022 | 19 Sep 2025 | 10 Aug 2025 |
| 236 | septictanktreatment.biz | GMO Internet Inc. | 13 Apr 2015 | 13 Apr 2015 | 12 Apr 2016 |
| 237 | septictanksstclaircountyil.com | GoDaddy.com, LLC | 4 Sep 2015 | 29 Aug 2019 | 4 Sep 2020 |
| 238 | septictanksrandolphcountyil.com | GoDaddy.com, LLC | 4 Sep 2015 | 29 Aug 2019 | 4 Sep 2020 |
| 239 | septictanksmonroecountyil.com | GoDaddy.com, LLC | 4 Sep 2015 | 29 Aug 2019 | 4 Sep 2020 |
| 240 | septictankandexcavating.com | Tucows Domains Inc. | 1 Sep 2010 | 5 Sep 2015 | 1 Sep 2016 |
| 241 | septictankcleaningutah.com | FastDomain Inc. | 15 Apr 2015 | 15 Apr 2015 | 15 Apr 2016 |
| 242 | septictankbiotechnology.com | CV. Jogjacamp | 16 Apr 2015 | 24 Apr 2025 | 16 Apr 2026 |
| 243 | septictankriverside.com | Tucows Domains Inc. | 2 Sep 2010 | 6 Sep 2015 | 2 Sep 2016 |
| 244 | septictankprofessionals.com | eNom, Inc. | 3 Aug 2022 | 3 Aug 2023 | 3 Aug 2026 |
| 245 | septictankinspection.com | Fabulous.com Pty Ltd. | 15 Apr 2001 | 18 Apr 2025 | 15 Apr 2026 |
| 246 | septictankssomerset.com | 1&1 Internet AG | 20 Jun 2025 | 20 Jun 2025 | 20 Jun 2027 |
| 247 | septictankservicesinasburyia.com | eNom, Inc. | 28 Apr 2015 | 27 Mar 2016 | 28 Apr 2017 |
| 248 | septictankcleaningguide.net | Name.com, Inc. | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 249 | septictankcompanies.com | GoDaddy.com, LLC | 23 Aug 2025 | 23 Aug 2025 | 23 Aug 2026 |
| 250 | septictank-pros.com | TLD Registrar Solutions Ltd. | 12 May 2015 | 12 May 2015 | 12 May 2016 |
| 251 | septictankinstallationinbedfordva.com | eNom, Inc. | 20 May 2015 | 18 Apr 2016 | 20 May 2017 |
| 252 | septictankbiogift.com | CV. Rumahweb Indonesia | 20 May 2015 | 6 May 2025 | 20 May 2027 |
| 253 | septictankpro.com | NameCheap, Inc. | 16 Nov 2016 | 17 Oct 2024 | 16 Nov 2025 |
| 254 | septictankcontractor.com | GoDaddy.com, LLC | 6 Jun 2025 | 6 Jun 2025 | 6 Jun 2026 |
| 255 | septictankpumpingpros.com | NameCheap, Inc. | 20 Mar 2024 | 1 Jun 2025 | 20 Mar 2025 |
| 256 | septictankinstallationinmooresvillenc.com | NameCheap, Inc. | 5 Jun 2015 | 6 Jun 2025 | 5 Jun 2026 |
| 257 | septictankpumpingvt.com | NameCheap, Inc. | 22 Mar 2025 | 22 Mar 2025 | 22 Mar 2026 |
| 258 | septictankpumpingnh.com | NameCheap, Inc. | 22 Mar 2025 | 22 Mar 2025 | 22 Mar 2026 |
| 259 | septictankreplacement.com | GoDaddy.com, LLC | 17 Sep 2015 | 18 Sep 2025 | 17 Sep 2026 |
| 260 | septictankpumpingsanluisobispo.com | Tucows Domains Inc. | 17 Sep 2015 | 21 Sep 2019 | 17 Sep 2019 |
| 261 | septictankhub.com | NameCheap, Inc. | 23 Feb 2023 | 6 May 2024 | 23 Feb 2024 |
| 262 | septictankovate.com | Blacknight Internet Solutions Ltd. | 13 Jun 2015 | 23 May 2017 | 13 Jun 2018 |
| 263 | septictankbioipal.com | Dynadot, LLC | 31 Aug 2022 | 10 Oct 2023 | 31 Aug 2023 |
| 264 | septictankcontractors.us | Misk.com, Inc. | 10 May 2002 | 2 Jun 2025 | 9 May 2026 |
| 265 | septictankcleaning.us | Misk.com, Inc. | 10 May 2002 | 31 May 2017 | 9 May 2018 |
| 266 | septictankservicesbrooks.com | Name.com, Inc. | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 267 | septictankcleaningtips.com | GMO Internet Inc. | 3 Nov 2016 | 19 Oct 2017 | 3 Nov 2018 |
| 268 | septictankrepairguys.com | GoDaddy.com, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 269 | septictankcleaningguys.com | SliceofHeaven Domains, LLC | 16 Sep 2020 | 17 Sep 2020 | 16 Sep 2021 |
| 270 | septictanksanluisobispo.com | GoDaddy.com, LLC | 13 Dec 2019 | 13 Dec 2019 | 13 Dec 2020 |
| 271 | septictankworms.net | Webfusion Ltd. | 1 Jul 2015 | 24 Jun 2017 | 1 Jul 2018 |
| 272 | septictankworms.info | Mesh Digital Limited | 1 Jul 2015 | 24 Jun 2017 | 1 Jul 2018 |
| 273 | septictankrescue.net | eNom, Inc. | 25 Sep 2015 | 24 Aug 2016 | 25 Sep 2017 |
| 274 | septictanksinmaconga.com | eNom, Inc. | 7 Jul 2015 | 7 Jul 2015 | 7 Jul 2016 |
| 275 | septictankpumpinginmarionva.com | eNom, Inc. | 8 Jul 2015 | 6 Jun 2016 | 8 Jul 2018 |
| 276 | septictankatl.com | GoDaddy.com, LLC | 1 Jun 2020 | 2 Jun 2025 | 1 Jun 2026 |
| 277 | septictankswilmington.com | Tucows Domains Inc. | 10 Jul 2015 | 14 Jul 2019 | 10 Jul 2019 |
| 278 | septictankinstallationinleesburgfl.com | eNom, Inc. | 13 Jul 2015 | 11 Jun 2016 | 13 Jul 2018 |
| 279 | septictankdraincleaning.com | Protocol Internet Technology Limited T/A Hosting I… | 16 Jul 2015 | 17 Jul 2017 | 16 Jul 2017 |
| 280 | septictanksonline.com | Webfusion Ltd. | 20 Jul 2015 | 10 Jul 2019 | 20 Jul 2020 |
| 281 | septictanksca11.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Oct 2017 | 13 Dec 2017 | 13 Oct 2018 |
| 282 | septictankemptyingca11.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Oct 2017 | 13 Dec 2017 | 13 Oct 2018 |
| 283 | septictankcleaningca11.com | Mesh Digital Limited | 24 Jan 2018 | 24 Jan 2018 | 24 Jan 2019 |
| 284 | septictank-repairatlanta.com | Tucows Domains Inc. | 20 Jul 2015 | 24 Jul 2018 | 20 Jul 2018 |
| 285 | septictankpumpinginabingdonva.com | eNom, Inc. | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2016 |
| 286 | septictankpumpinginblackstonema.com | eNom, Inc. | 23 Jul 2015 | 21 Jun 2016 | 23 Jul 2018 |
| 287 | septictankplastic.com | GMO Internet Inc. | 28 Apr 2012 | 4 Apr 2017 | 28 Apr 2018 |
| 288 | septictankbioguna.com | Realtime Register B.V. | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2016 |
| 289 | septictankpumpingwisconsin.com | Tucows Domains Inc. | 25 Jul 2011 | 29 Jul 2015 | 25 Jul 2016 |
| 290 | septictankdesignandrepair.com | Tucows Domains Inc. | 26 Jul 2010 | 30 Jul 2015 | 26 Jul 2016 |
| 291 | septictankpumpingmiami.com | GoDaddy.com, LLC | 4 Aug 2025 | 5 Aug 2025 | 4 Aug 2026 |
| 292 | septictankpumpingatlanta.com | Namesilo, LLC | 20 May 2020 | 21 May 2020 | 20 May 2021 |
| 293 | septictankdesign.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Aug 2015 | 5 Aug 2016 | 4 Aug 2017 |
| 294 | septictankcleaningtrichy.com | Wild West Domains, LLC | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2016 |
| 295 | septictankcover.com | GoDaddy.com, LLC | 4 Oct 2015 | 1 Feb 2025 | 22 Feb 2027 |
| 296 | septictanksolution.com | GoDaddy.com, LLC | 26 Apr 2022 | 13 Aug 2025 | 26 Apr 2027 |
| 297 | septictankcleaningcork.com | Blacknight Internet Solutions Ltd. | 6 Oct 2015 | 19 Dec 2024 | 6 Oct 2024 |
| 298 | septictanksinspringhillfl.com | eNom, Inc. | 7 Oct 2015 | 8 Sep 2016 | 7 Oct 2017 |
| 299 | septictanksinclearwaterfl.com | eNom, Inc. | 7 Oct 2015 | 8 Sep 2016 | 7 Oct 2017 |
| 300 | septictankcenter.com | Uniregistrar Corp | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 301 | septictankpros.xyz | NameCheap, Inc. | 11 Oct 2015 | 11 Oct 2015 | 11 Oct 2016 |
| 302 | septictankssurrey.com | Mesh Digital Limited | 14 Oct 2015 | 29 Sep 2019 | 14 Oct 2020 |
| 303 | septictanknews.com | eNom, Inc. | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 304 | septictankfortlauderdale.com | Tucows Domains Inc. | 12 Oct 2010 | 16 Oct 2015 | 12 Oct 2016 |
| 305 | septictankcleaners.xyz | NameCheap, Inc. | 16 Oct 2015 | 16 Oct 2015 | 16 Oct 2016 |
| 306 | septictanktc.com | Tucows Domains Inc. | 14 Oct 2011 | 18 Oct 2015 | 14 Oct 2016 |
| 307 | septictanksinphoenixaz.com | eNom, Inc. | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 308 | septictanksocala.com | Tucows Domains Inc. | 29 Jun 2023 | 8 Jul 2024 | 29 Jun 2025 |
| 309 | septictankfertilizer.org | Tucows Domains Inc. | 24 Oct 2015 | 4 Oct 2016 | 24 Oct 2017 |
| 310 | septictankfertilizer.net | Tucows Domains Inc. | 24 Oct 2015 | 28 Oct 2018 | 24 Oct 2018 |
| 311 | septictankfertilizer.info | Tucows Domains Inc. | 24 Oct 2015 | 28 Oct 2018 | 24 Oct 2019 |
| 312 | septictankfertilizer.com | Tucows Domains Inc. | 24 Oct 2015 | 28 Oct 2019 | 24 Oct 2019 |
| 313 | septictankfertiliser.org | Tucows Domains Inc. | 24 Oct 2015 | 4 Oct 2016 | 24 Oct 2017 |
| 314 | septictankfertiliser.net | Tucows Domains Inc. | 24 Oct 2015 | 28 Oct 2018 | 24 Oct 2018 |
| 315 | septictankfertiliser.info | Tucows Domains Inc. | 24 Oct 2015 | 28 Oct 2018 | 24 Oct 2019 |
| 316 | septictankfertiliser.com | Namecroc.com LLC | 10 Jan 2020 | 11 Jan 2020 | 10 Jan 2021 |
| 317 | septictankcleaningandpumping.com | Tucows Domains Inc. | 22 Oct 2010 | 26 Oct 2015 | 22 Oct 2016 |
| 318 | septictankrepaircompany.com | eNom1010, Inc. | 16 Jan 2025 | 21 Jan 2025 | 16 Jan 2026 |
| 319 | septictankcleaninginpune.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Oct 2015 | 8 Nov 2016 | 28 Oct 2017 |
| 320 | septictank-problems.com | Tucows Domains Inc. | 27 Oct 2011 | 31 Oct 2015 | 27 Oct 2016 |
| 321 | septictanksanglesey.com | Webfusion Ltd. | 2 Nov 2015 | 25 Jan 2023 | 2 Nov 2026 |
| 322 | septictankestimates.com | GoDaddy.com, LLC | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 323 | septictanktylertx.com | NameCheap, Inc. | 5 Feb 2019 | 5 Feb 2019 | 5 Feb 2020 |
| 324 | septictankodessatx.com | NameCheap, Inc. | 5 Feb 2019 | 5 Feb 2019 | 5 Feb 2020 |
| 325 | septictankcleaning.xyz | Uniregistrar Corp | 10 May 2017 | 10 May 2017 | 10 May 2018 |
| 326 | septictankinstallationinaustintx.com | eNom, Inc. | 16 Nov 2015 | 15 Oct 2016 | 16 Nov 2017 |
| 327 | septictank-4u.com | NameCheap, Inc. | 13 Aug 2023 | 25 Oct 2024 | 13 Aug 2024 |
| 328 | septictanksoakaway.info | GoDaddy.com, LLC | 12 Mar 2016 | 8 Mar 2017 | 12 Mar 2018 |
| 329 | septictanksemptying.info | TLD Registrar Solutions Ltd. | 21 Nov 2014 | 22 Nov 2015 | 21 Nov 2016 |
| 330 | septictankcleaningcenter.xyz | NameCheap, Inc. | 23 Nov 2015 | 9 Dec 2016 | 23 Nov 2017 |
| 331 | septictankserviceco.xyz | NameCheap, Inc. | 28 Nov 2015 | 9 Dec 2016 | 28 Nov 2017 |
| 332 | septictankbiomaster.com | CV. Rumahweb Indonesia | 3 Dec 2015 | 6 May 2025 | 3 Dec 2027 |
| 333 | septictankscork.com | Blacknight Internet Solutions Ltd. | 4 Dec 2015 | 13 Nov 2016 | 4 Dec 2017 |
| 334 | septictankdirectory.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2024 | 5 Dec 2025 |
| 335 | septictankpumpingsc.com | NameCheap, Inc. | 22 Mar 2025 | 22 Mar 2025 | 22 Mar 2026 |
| 336 | septictankbiotech.org | Namesilo, LLC | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 337 | septictankbiotech.info | CV. Rumahweb Indonesia | 24 Jan 2018 | 24 Jan 2018 | 24 Jan 2019 |
| 338 | septictankpumpers.com | Google, Inc. | 7 May 2021 | 22 Apr 2025 | 7 May 2026 |
| 339 | septictankproblem.org | Network Solutions, LLC | 21 May 2018 | 17 Jun 2024 | 21 May 2026 |
| 340 | septictankbiorich.com | Amazon Registrar, Inc. | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2016 |
| 341 | septictankorlando.com | Metaregistrar BV Applications | 11 Mar 2019 | 13 Mar 2025 | 11 Mar 2026 |
| 342 | septictankpumping.top | - | 14 Mar 2025 | 15 Mar 2025 | 14 Mar 2026 |
| 343 | septictankpumped.com | GoDaddy.com, LLC | 28 Dec 2015 | 2 Jul 2025 | 28 Dec 2025 |
| 344 | septictankrisers.net | GoDaddy.com, LLC | 1 Jan 2016 | 1 Jan 2016 | 1 Jan 2017 |
| 345 | septictankfindlayohio.com | Tucows Domains Inc. | 3 Jan 2011 | 7 Jan 2016 | 3 Jan 2017 |
| 346 | septictankspro.com | GoDaddy.com, LLC | 6 Dec 2024 | 6 Dec 2024 | 6 Dec 2025 |
| 347 | septictanksindiana.com | Tucows Domains Inc. | 18 Jan 2011 | 22 Jan 2016 | 18 Jan 2017 |
| 348 | septictank-service.com | GoDaddy.com, LLC | 19 Dec 2023 | 24 Sep 2024 | 19 Dec 2024 |
| 349 | septictanksberkshire.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jun 2017 | 29 Jun 2018 | 29 Jun 2018 |
| 350 | septictanksstaffordshire.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Jan 2016 | 27 Jan 2016 | 27 Jan 2017 |
| 351 | septictankcleaningdublin.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2016 | 28 Jan 2016 | 28 Jan 2017 |
| 352 | septictanksbuckinghamshire.com | eNom, Inc. | 10 Jul 2018 | 28 Jun 2019 | 10 Jul 2020 |
| 353 | septictanksinsurrey.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Feb 2016 | 16 Feb 2017 | 1 Feb 2018 |
| 354 | septictankseastsussex.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Feb 2016 | 16 Feb 2017 | 1 Feb 2018 |
| 355 | septictankpumpingin.xyz | NameCheap, Inc. | 2 Feb 2016 | 24 Feb 2016 | 2 Feb 2017 |
| 356 | septictankswestsussex.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Feb 2016 | 3 Feb 2018 | 3 Feb 2018 |
| 357 | septictankssussex.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Feb 2016 | 3 Feb 2018 | 3 Feb 2018 |
| 358 | septictankemptyingwestsussex.com | GoDaddy.com, LLC | 17 Nov 2021 | 17 Nov 2021 | 17 Nov 2022 |
| 359 | septictanksalisbury.info | GoDaddy.com, LLC | 5 Feb 2016 | - | 5 Feb 2017 |
| 360 | septictanks.online | GoDaddy.com, LLC | 4 Jan 2025 | 21 Feb 2025 | 4 Jan 2026 |
| 361 | septictankatlanta.com | eNom, Inc. | 11 Jul 2024 | 23 Aug 2025 | 11 Jul 2025 |
| 362 | septictanksuppliers.com | Mesh Digital Limited | 8 Aug 2025 | 8 Aug 2025 | 8 Aug 2026 |
| 363 | septictankcleaningauthority.com | GoDaddy.com, LLC | 9 Feb 2016 | 10 Feb 2016 | 9 Feb 2017 |
| 364 | septictankauthority.com | Tucows Domains Inc. | 25 May 2025 | 25 May 2025 | 25 May 2026 |
| 365 | septictankspecialists.com | Dynadot, LLC | 23 Aug 2025 | 25 Aug 2025 | 23 Aug 2026 |
| 366 | septictank-pumpingatlanta.com | Tucows Domains Inc. | 12 Feb 2016 | 23 Aug 2017 | 12 Feb 2018 |
| 367 | septictank-pumping.xyz | GoDaddy.com, LLC | 22 Feb 2023 | 4 May 2024 | 22 Feb 2024 |
| 368 | septictankcleaningtempletx.com | Tucows Domains Inc. | 15 Feb 2012 | 19 Feb 2016 | 15 Feb 2017 |
| 369 | septictanklakelandfl.com | GoDaddy.com, LLC | 19 Feb 2016 | 19 Feb 2016 | 19 Feb 2017 |
| 370 | septictankcleaninglakelandfl.com | GoDaddy.com, LLC | 19 Feb 2016 | 19 Feb 2016 | 19 Feb 2017 |
| 371 | septictankcleaningprices.com | Blacknight Internet Solutions Ltd. | 20 Feb 2016 | 20 Feb 2016 | 20 Feb 2017 |
| 372 | septictanksemptyingcumbria.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Mar 2016 | 4 Mar 2016 | 4 Mar 2017 |
| 373 | septictankemptyingcumbria.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Oct 2019 | 9 Oct 2019 | 9 Oct 2020 |
| 374 | septictankspenrith.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Mar 2016 | 9 Mar 2016 | 9 Mar 2017 |
| 375 | septictankcure.com | 1&1 Internet AG | 5 May 2020 | 5 May 2020 | 5 May 2021 |
| 376 | septictankcleaning.melbourne | Crazy Domains FZ-LLC | 14 Mar 2016 | 27 Mar 2024 | 14 Mar 2024 |
| 377 | septictankservice.online | NameCheap, Inc. | 11 Mar 2016 | 11 Mar 2016 | 11 Mar 2017 |
| 378 | septictanks.site | GoDaddy.com, LLC | 11 Mar 2016 | 25 May 2017 | 11 Mar 2018 |
| 379 | septictanks.help | GoDaddy.com, LLC | 11 Mar 2016 | 13 Mar 2017 | 11 Mar 2018 |
| 380 | septictankny.com | GoDaddy.com, LLC | 25 Jan 2021 | 26 Jan 2025 | 25 Jan 2026 |
| 381 | septictankpumpingrr.com | GoDaddy.com, LLC | 21 Mar 2016 | 21 Mar 2016 | 21 Mar 2017 |
| 382 | septictankssystems.org | eNom, Inc. | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 383 | septictankemptyinginwiltshire.com | Tucows Domains Inc. | 22 Mar 2016 | 26 Mar 2019 | 22 Mar 2019 |
| 384 | septictankbiofil.click | CV. Rumahweb Indonesia | 28 Mar 2016 | 8 May 2017 | 28 Mar 2017 |
| 385 | septictankemptyingberkshire.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Mar 2016 | 29 Mar 2018 | 29 Mar 2018 |
| 386 | septictankbot.com | Dynadot, LLC | 11 Apr 2016 | 12 Apr 2025 | 11 Apr 2026 |
| 387 | septictankbiological.com | CV. Rumahweb Indonesia | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 388 | septictanksbeckley.com | Tucows Domains Inc. | 13 Apr 2011 | 13 Apr 2011 | 13 Apr 2017 |
| 389 | septictankteam.com | eNom, Inc. | 18 Apr 2016 | 17 Mar 2017 | 18 Apr 2018 |
| 390 | septictanksetup.com | eNom, Inc. | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 391 | septictankcleaningzimmerman.com | Tucows Domains Inc. | 18 Apr 2011 | 22 Apr 2017 | 18 Apr 2017 |
| 392 | septictankcleaningeastbethel.com | Tucows Domains Inc. | 18 Apr 2011 | 22 Apr 2017 | 18 Apr 2017 |
| 393 | septictankhollywoodandmiami.com | Tucows Domains Inc. | 19 Apr 2011 | 19 Apr 2011 | 19 Apr 2017 |
| 394 | septictankservicetn.com | Tucows Domains Inc. | 23 Apr 2012 | 23 Apr 2012 | 23 Apr 2017 |
| 395 | septictankshop.net | Synergy Wholesale Pty Ltd | 27 Apr 2016 | 13 Apr 2025 | 27 Apr 2026 |
| 396 | septictankwellington.com | Tucows Domains Inc. | 11 May 2016 | 15 May 2018 | 11 May 2018 |
| 397 | septictankpompanobeach.com | Tucows Domains Inc. | 11 May 2016 | 15 May 2018 | 11 May 2018 |
| 398 | septictankcleaningscotland.com | GoDaddy.com, LLC | 16 Jun 2023 | 22 Nov 2023 | 16 Jun 2024 |
| 399 | septictankservicesbohol.com | RegistryGate GmbH | 20 May 2016 | 20 May 2019 | 20 May 2020 |
| 400 | septictanksystems.net | Tucows Domains Inc. | 8 Apr 2010 | 10 Mar 2025 | 8 Apr 2026 |
| 401 | septictanknorthmississippi.com | Tucows Domains Inc. | 19 May 2011 | 19 May 2011 | 19 May 2017 |
| 402 | septictankdantoilet.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 May 2022 | 21 Jun 2024 | 20 May 2024 |
| 403 | septictankshop.sydney | Synergy Wholesale Pty Ltd | 28 Apr 2016 | 18 Apr 2025 | 28 Apr 2026 |
| 404 | septictankemptyingcornwall.com | Mesh Digital Limited | 17 Feb 2022 | 12 Feb 2025 | 17 Feb 2026 |
| 405 | septictankinserts.us | GoDaddy.com, LLC | 25 May 2016 | 25 May 2017 | 24 May 2018 |
| 406 | septictankinserts.com | GoDaddy.com, LLC | 25 May 2016 | 26 May 2025 | 25 May 2026 |
| 407 | septictankbio.tech | CV. Rumahweb Indonesia | 25 May 2016 | 25 May 2016 | 25 May 2017 |
| 408 | septictankcleaningcontractor.com | - | 31 May 2016 | 31 May 2016 | 31 May 2017 |
| 409 | septictanksbulgaria.biz | Mesh Digital Limited | 5 Jun 2016 | 16 Jul 2024 | 4 Jun 2024 |
| 410 | septictankproblems.org | GoDaddy.com, LLC | 12 Jan 2010 | 14 Jan 2017 | 12 Jan 2018 |
| 411 | septictankbio.xyz | NameCheap, Inc. | 1 Jun 2016 | 27 Jun 2016 | 1 Jun 2017 |
| 412 | septictanksomaha.com | GoDaddy.com, LLC | 11 Jun 2016 | 12 Jun 2019 | 11 Jun 2020 |
| 413 | septictankrepair.xyz | NameCheap, Inc. | 11 Jun 2016 | 29 Jul 2016 | 11 Jun 2017 |
| 414 | septictankbiopure.com | CV. Rumahweb Indonesia | 13 Jun 2016 | - | 13 Jun 2020 |
| 415 | septictankwarranty.com | TurnCommerce, Inc. DBA NameBright.com | 24 Sep 2022 | 18 Sep 2023 | 24 Sep 2025 |
| 416 | septictankmechanical.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Sep 2023 | 8 Nov 2024 | 7 Sep 2024 |
| 417 | septictankpumpingocal.com | Tucows Domains Inc. | 17 Jun 2013 | 21 Jun 2017 | 17 Jun 2017 |
| 418 | septictankbiomax.com | CV. Rumahweb Indonesia | 21 Jun 2016 | 21 Jun 2016 | 21 Jun 2017 |
| 419 | septictankcleaningincoimbatore.com | GoDaddy.com, LLC | 25 Jun 2016 | 25 Jun 2016 | 25 Jun 2017 |
| 420 | septictankdoctor.net | Tucows Domains Inc. | 23 Jun 2010 | 23 Jun 2010 | 23 Jun 2017 |
| 421 | septictankplumbingannail.com | GoDaddy.com, LLC | 30 Jun 2016 | 30 Jun 2016 | 30 Jun 2017 |
| 422 | septictankplumbingmetropolisil.com | GoDaddy.com, LLC | 30 Jun 2016 | 30 Jun 2016 | 30 Jun 2017 |
| 423 | septictankplumbingcarbondaleil.com | GoDaddy.com, LLC | 30 Jun 2016 | 30 Jun 2016 | 30 Jun 2017 |
| 424 | septictankpumpout.net | Tucows Domains Inc. | 2 Jul 2014 | 2 Jul 2014 | 2 Jul 2017 |
| 425 | septictankseptictank.org | Tucows Domains Inc. | 19 Jan 2013 | 21 Dec 2016 | 19 Jan 2018 |
| 426 | septictankseptictank.net | Tucows Domains Inc. | 19 Jan 2013 | 21 Dec 2016 | 19 Jan 2018 |
| 427 | septictankinstallation.info | Tucows Domains Inc. | 19 Jan 2013 | 21 Dec 2016 | 19 Jan 2018 |
| 428 | septictanksemptied.com | Webfusion Ltd. | 7 Jul 2016 | 18 Sep 2024 | 7 Jul 2024 |
| 429 | septictanks.link | Uniregistrar Corp | 20 Jun 2016 | 31 Jul 2017 | 20 Jun 2017 |
| 430 | septictankscott.org | GoDaddy.com, LLC | 9 Jul 2016 | 10 Jul 2017 | 9 Jul 2018 |
| 431 | septictankscott.com | GoDaddy.com, LLC | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 432 | septictanksderbyshire.com | Wild West Domains, LLC | 10 Feb 2025 | 10 Feb 2025 | 10 Feb 2026 |
| 433 | septictanksandcesspitsstaffordshire.com | Gandi SAS | 11 Jul 2016 | 11 Jul 2016 | 11 Jul 2017 |
| 434 | septictanksandcesspitsderbyshire.com | Gandi SAS | 11 Jul 2016 | 11 Jul 2016 | 11 Jul 2017 |
| 435 | septictankcleaning.in | - | 18 Sep 2013 | 18 Sep 2025 | 18 Sep 2026 |
| 436 | septictankemptying.company | GoDaddy.com, LLC | 25 Apr 2014 | 6 Jan 2017 | 25 Apr 2019 |
| 437 | septictankemptying.services | 1&1 Internet AG | 9 Jul 2014 | 23 Aug 2025 | 9 Jul 2026 |
| 438 | septictankwarranty.biz | GoDaddy.com, LLC | 7 Jul 2013 | 12 Jul 2019 | 6 Jul 2020 |
| 439 | septictanksystems.biz | eNom, Inc. | 8 Nov 2001 | 11 Mar 2017 | 7 Nov 2017 |
| 440 | septictankpumping.biz | 1&1 Internet AG | 30 Nov 2007 | 30 Dec 2024 | 29 Nov 2024 |
| 441 | septictankcleaning.biz | 1&1 Internet AG | 30 Nov 2007 | 30 Dec 2024 | 29 Nov 2024 |
| 442 | septictankoklahomacity.com | Tucows Domains Inc. | 14 Jul 2011 | 18 Jul 2016 | 14 Jul 2016 |
| 443 | septictankpumpingohio.com | eNom, Inc. | 17 Jul 2016 | 17 Jul 2017 | 17 Jul 2018 |
| 444 | septictankcleaningohio.com | eNom, Inc. | 17 Jul 2016 | 17 Jul 2017 | 17 Jul 2018 |
| 445 | septictankadditives.biz | Tucows Domains Inc. | 8 Feb 2012 | 11 Feb 2019 | 7 Feb 2019 |
| 446 | septictankemptyingsurrey.com | Webfusion Ltd. | 20 Jul 2016 | 13 Jul 2017 | 20 Jul 2018 |
| 447 | septictanksincornwall.com | 1&1 Internet AG | 16 Sep 2024 | 9 Oct 2025 | 16 Sep 2026 |
| 448 | septictankbiogreen.com | Hostinger, UAB | 7 Jan 2017 | 17 Dec 2024 | 7 Jan 2026 |
| 449 | septictankprosorlando.com | NameCheap, Inc. | 1 Aug 2016 | 2 Jul 2025 | 1 Aug 2026 |
| 450 | septictankgreatfallsmt.com | Tucows Domains Inc. | 27 Jul 2010 | 31 Jul 2016 | 27 Jul 2016 |
| 451 | septictankservices1.xyz | NameCheap, Inc. | 4 Aug 2016 | 9 Aug 2016 | 4 Aug 2017 |
| 452 | septictankandpumping.com | - | 2 Aug 2011 | 2 Aug 2011 | 2 Aug 2017 |
| 453 | septictankbiogen.com | CV. Rumahweb Indonesia | 7 Aug 2016 | - | 7 Aug 2017 |
| 454 | septictankreuse.com | - | 7 Aug 2016 | 7 Aug 2016 | 7 Aug 2018 |
| 455 | septictankreuse.org | GoDaddy.com, LLC | 7 Aug 2016 | 7 Oct 2016 | 7 Aug 2018 |
| 456 | septictankcover.info | GoDaddy.com, LLC | 8 Aug 2016 | 21 Sep 2017 | 8 Aug 2018 |
| 457 | septictanktreatment.solutions | GoDaddy.com, LLC | 8 Aug 2016 | 13 Aug 2016 | 8 Aug 2017 |
| 458 | septictankrepairman.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Aug 2016 | 16 Sep 2017 | 10 Aug 2018 |
| 459 | septictankscornwall.com | 1&1 Internet AG | 14 Dec 2016 | 29 Jul 2021 | 14 Dec 2025 |
| 460 | septictankpumpinggwinnett.com | register.com, Inc. | 18 Aug 2016 | 21 Aug 2017 | 18 Aug 2019 |
| 461 | septictankpumpinggwinett.com | register.com, Inc. | 17 Aug 2016 | 19 Aug 2025 | 17 Aug 2026 |
| 462 | septictankpumpingwinett.com | - | 17 Aug 2016 | 17 Aug 2016 | 17 Aug 2017 |
| 463 | septictankcleaningspringfieldil.com | - | 30 Aug 2016 | 30 Aug 2016 | 30 Aug 2017 |
| 464 | septictankscotland.com | Webfusion Ltd. | 14 Apr 2023 | 15 Apr 2025 | 14 Apr 2027 |
| 465 | septictankemptyingworms.com | Tucows Domains Inc. | 8 Sep 2016 | 12 Sep 2018 | 8 Sep 2018 |
| 466 | septictankpumpingcarbondaleil.com | GoDaddy.com, LLC | 9 Sep 2016 | 29 Aug 2019 | 9 Sep 2020 |
| 467 | septictankpumpingannail.com | GoDaddy.com, LLC | 9 Sep 2016 | 29 Aug 2019 | 9 Sep 2020 |
| 468 | septictankpumpingmetropolisil.com | GoDaddy.com, LLC | 9 Sep 2016 | 29 Aug 2019 | 9 Sep 2020 |
| 469 | septictankemptying.online | Mesh Digital Limited | 12 Sep 2016 | 27 Oct 2017 | 12 Sep 2017 |
| 470 | septictanktools.com | 1&1 Internet AG | 15 Sep 2016 | 15 Sep 2016 | 15 Sep 2018 |
| 471 | septictankuk.com | - | 22 Sep 2009 | 22 Sep 2009 | 22 Sep 2017 |
| 472 | septictankbiosuper.com | CV. Rumahweb Indonesia | 23 Aug 2021 | 3 Oct 2023 | 23 Aug 2023 |
| 473 | septictanksanglesey.wales | Mesh Digital Limited | 26 Sep 2016 | 9 Jun 2024 | 26 Sep 2026 |
| 474 | septictankapplevalley.com | GoDaddy.com, LLC | 28 Mar 2013 | 23 Mar 2024 | 28 Mar 2026 |
| 475 | septictanker.com | GoDaddy.com, LLC | 28 Mar 2001 | 29 Mar 2025 | 28 Mar 2027 |
| 476 | septictankcleaningwpbfl.com | eNom, Inc. | 12 Jun 2013 | 14 May 2016 | 12 Jun 2017 |
| 477 | septictanksvc.com | GoDaddy.com, LLC | 9 Mar 2014 | 27 Apr 2015 | 9 Mar 2018 |
| 478 | septictanktrap.com | GoDaddy.com, LLC | 19 Nov 2008 | 17 Oct 2015 | 19 Nov 2017 |
| 479 | septictankcleaningcanton.com | GoDaddy.com, LLC | 27 Dec 2010 | 30 Dec 2024 | 27 Dec 2025 |
| 480 | septictankcleaninguniontownpa.com | register.com, Inc. | 7 Jun 2012 | 22 Sep 2016 | 7 Jun 2017 |
| 481 | septictanksuk.com | Wix.com Ltd. | 21 Oct 2024 | 21 Oct 2024 | 21 Oct 2027 |
| 482 | septictankpipereplacementscork.com | Wild West Domains, LLC | 28 Jan 2013 | 30 Apr 2015 | 28 Jan 2017 |
| 483 | septictankdrainfieldproblems.com | GoDaddy.com, LLC | 5 Oct 2013 | 2 Oct 2015 | 5 Oct 2016 |
| 484 | septictankaerators.com | GoDaddy.com, LLC | 31 Dec 2006 | 1 Jan 2025 | 31 Dec 2025 |
| 485 | septictanksleicester.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 486 | septictankbiotek.com | CV. Rumahweb Indonesia | 1 Jun 2013 | - | 1 Jun 2019 |
| 487 | septictankbiotech.com | CV. Rumahweb Indonesia | 12 Apr 2011 | 12 Apr 2025 | 12 Apr 2028 |
| 488 | septictankregulations.com | Google, Inc. | 11 Mar 2023 | 12 Mar 2024 | 11 Mar 2025 |
| 489 | septictankssaintjosephmo.com | Key-Systems GmbH | 23 Jun 2025 | 24 Jun 2025 | 23 Jun 2026 |
| 490 | septictankswales.com | Tucows Domains Inc. | 18 Oct 2010 | 19 Sep 2025 | 18 Oct 2026 |
| 491 | septictanks911.com | GoDaddy.com, LLC | 7 Nov 2013 | 8 Nov 2017 | 7 Nov 2019 |
| 492 | septictank-supplies.com | Shining Star Domains, LLC | 1 Oct 2017 | 1 Oct 2017 | 1 Oct 2018 |
| 493 | septictankexperts.com | Webfusion Ltd. | 18 Jan 2023 | 19 Jan 2025 | 18 Jan 2026 |
| 494 | septictanksurrey.com | Wild West Domains, LLC | 9 Dec 2010 | 20 Dec 2018 | 9 Dec 2019 |
| 495 | septictankbiotechsistem.com | - | 21 Oct 2024 | 9 Apr 2025 | 21 Oct 2025 |
| 496 | septictanksleicestershire.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 497 | septictanksparta.com | GoDaddy.com, LLC | 10 May 2013 | 29 Apr 2016 | 10 May 2017 |
| 498 | septictankcity.com | GoDaddy.com, LLC | 17 Jul 2012 | 17 Jul 2024 | 17 Jul 2027 |
| 499 | septictankandpumpstationserviceandrepairallentown.com | eNom, Inc. | 21 Feb 2013 | 19 Feb 2025 | 21 Feb 2026 |
| 500 | septictankservicesalbany.com | register.com, Inc. | 7 Mar 2013 | 7 Mar 2013 | 7 Mar 2017 |
| 501 | septictankpumpingzimmerman.com | Tucows Domains Inc. | 14 Apr 2011 | 18 Apr 2017 | 14 Apr 2017 |
| 502 | septictankbiotechnologi.com | - | 21 Oct 2024 | 9 Apr 2025 | 21 Oct 2025 |
| 503 | septictank-services.com | GoDaddy.com, LLC | 5 Mar 2013 | 27 Dec 2024 | 5 Mar 2026 |
| 504 | septictankpumpingvaldosta.com | GoDaddy.com, LLC | 7 Apr 2012 | 8 Apr 2016 | 7 Apr 2017 |
| 505 | septictanka-z.com | eNom, Inc. | 29 Jan 2007 | 4 Jun 2016 | 29 Jan 2017 |
| 506 | septictankdesign.com | TurnCommerce, Inc. DBA NameBright.com | 20 Feb 2018 | 14 Feb 2021 | 20 Feb 2026 |
| 507 | septictankcleaningcompanies.com | Easyspace LTD | 2 Dec 2011 | 13 Nov 2024 | 2 Dec 2025 |
| 508 | septictankemptyingsouthwest.com | GoDaddy.com, LLC | 11 Jun 2011 | 12 Jun 2015 | 11 Jun 2017 |
| 509 | septictanksystem.com | GoDaddy.com, LLC | 19 Sep 2000 | 2 Sep 2025 | 19 Sep 2026 |
| 510 | septictankstobyhanna.com | eNom, Inc. | 14 Apr 2014 | 16 Mar 2015 | 14 Apr 2018 |
| 511 | septictankpumpingjacksonmi.com | Launchpad, Inc. | 17 Jan 2014 | 2 Jan 2025 | 17 Jan 2026 |
| 512 | septictankcleaningkentcounty.com | Tucows Domains Inc. | 4 Oct 2011 | 8 Oct 2020 | 4 Oct 2020 |
| 513 | septictankadvisor.com | GoDaddy.com, LLC | 18 Aug 2025 | 18 Aug 2025 | 18 Aug 2026 |
| 514 | septictanklangley.com | Wild West Domains, LLC | 9 Dec 2010 | 10 Jun 2016 | 9 Dec 2017 |
| 515 | septictanksvero.com | eNom, Inc. | 18 Jul 2013 | 30 Aug 2016 | 18 Jul 2016 |
| 516 | septictankinsurance.com | GoDaddy.com, LLC | 4 Feb 2025 | 4 Feb 2025 | 4 Feb 2026 |
| 517 | septictanksithaca.com | register.com, Inc. | 16 Oct 2012 | 22 Jan 2016 | 16 Oct 2016 |
| 518 | septictankswhiterock.com | Wild West Domains, LLC | 25 Aug 2011 | 26 Aug 2019 | 25 Aug 2020 |
| 519 | septictanksdorset.com | Wild West Domains, LLC | 25 Apr 2024 | 14 Apr 2025 | 25 Apr 2026 |
| 520 | septictanktest.com | Wild West Domains, LLC | 1 Oct 2012 | 12 Nov 2024 | 1 Oct 2024 |
| 521 | septictankspeterborough.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 522 | septictankinstallation.com | GoDaddy.com, LLC | 25 Oct 2004 | 5 Oct 2025 | 25 Oct 2026 |
| 523 | septictankcare.com | GoDaddy.com, LLC | 29 Oct 2002 | 9 Oct 2025 | 29 Oct 2026 |
| 524 | septictankscleaning.com | GoDaddy.com, LLC | 3 May 2025 | 3 May 2025 | 3 May 2026 |
| 525 | septictankygc.com | eNom, Inc. | 20 Mar 2012 | 1 May 2024 | 20 Mar 2024 |
| 526 | septictankemptyingoxford.com | GoDaddy.com, LLC | 11 Jun 2011 | 12 Jun 2015 | 11 Jun 2017 |
| 527 | septictankemptycumbria.com | Tucows Domains Inc. | 22 Mar 2013 | 20 Feb 2017 | 22 Mar 2018 |
| 528 | septictankslincoln.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 529 | septictanksupplies.com | 1&1 Internet AG | 8 Aug 2013 | 9 Oct 2025 | 8 Aug 2026 |
| 530 | septictankresolve.com | eNom, Inc. | 28 Apr 2014 | 27 Mar 2015 | 28 Apr 2018 |
| 531 | septictanksflorence.com | register.com, Inc. | 18 Aug 2011 | 19 Aug 2025 | 18 Aug 2026 |
| 532 | septictankmuseum.com | eNom, Inc. | 26 Jun 2012 | 25 May 2017 | 26 Jun 2019 |
| 533 | septictankvancouver.com | Wild West Domains, LLC | 9 Dec 2010 | 10 Jun 2016 | 9 Dec 2017 |
| 534 | septictankshop.com | TurnCommerce, Inc. DBA NameBright.com | 25 Dec 2018 | 19 Dec 2020 | 25 Dec 2025 |
| 535 | septictank911.com | NameCheap, Inc. | 10 Jul 2011 | 10 Jun 2025 | 10 Jul 2026 |
| 536 | septictanksmells.com | NameCheap, Inc. | 29 Jul 2011 | 29 Jun 2025 | 29 Jul 2026 |
| 537 | septictanksoakaway.com | TurnCommerce, Inc. DBA NameBright.com | 20 Jun 2018 | 22 Jul 2024 | 20 Jun 2024 |
| 538 | septictankspecialist.com | Dynadot, LLC | 21 Feb 2023 | 11 Feb 2025 | 21 Feb 2026 |
| 539 | septictankbioasahi.com | CV. Rumahweb Indonesia | 18 May 2020 | - | 18 May 2021 |
| 540 | septictankservicerockmart.com | eNom, Inc. | 29 Jul 2014 | 30 Jun 2015 | 29 Jul 2018 |
| 541 | septictanksystems.com | eNom, Inc. | 28 Mar 2002 | 27 Mar 2025 | 28 Mar 2026 |
| 542 | septictankpumpingtulare.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 543 | septictankinspectionnj.com | GoDaddy.com, LLC | 12 Apr 2011 | 13 Apr 2016 | 12 Apr 2017 |
| 544 | septictankbiotechbaik.com | CV. Rumahweb Indonesia | 1 Jul 2013 | 17 Jul 2024 | 1 Jul 2027 |
| 545 | septictankbroker.com | GoDaddy.com, LLC | 19 Nov 2013 | 20 Nov 2015 | 19 Nov 2017 |
| 546 | septictanksmeltonmowbray.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 547 | septictankservicefl.com | eNom, Inc. | 24 Sep 2013 | 25 Sep 2016 | 24 Sep 2016 |
| 548 | septictankcleaningineasternnc.com | eNom, Inc. | 12 Jun 2014 | 14 May 2016 | 12 Jun 2017 |
| 549 | septictankfix.com | GoDaddy.com, LLC | 15 Apr 2022 | 3 May 2025 | 15 Apr 2026 |
| 550 | septictankpumpingrepairtampa.com | register.com, Inc. | 25 Jul 2013 | 4 Jul 2014 | 25 Jul 2017 |
| 551 | septictankenzyme.com | 1&1 Internet AG | 7 Jan 2008 | 8 Jan 2025 | 7 Jan 2026 |
| 552 | septictankinstallationstampadadecityfl.com | - | 6 Aug 2023 | 19 Aug 2025 | 6 Aug 2025 |
| 553 | septictanksrussellville.com | NameCheap, Inc. | 16 Apr 2014 | 16 Mar 2019 | 16 Apr 2020 |
| 554 | septictankpage.com | GoDaddy.com, LLC | 16 Dec 1999 | 16 Dec 2024 | 16 Dec 2025 |
| 555 | septictankguide.com | NameCheap, Inc. | 20 Aug 2006 | 21 Aug 2025 | 20 Aug 2026 |
| 556 | septictanksupply.com | GoDaddy.com, LLC | 2 Mar 2014 | 14 Dec 2024 | 2 Mar 2027 |
| 557 | septictankinspectionsireland.com | Blacknight Internet Solutions Ltd. | 12 May 2013 | 23 May 2017 | 12 May 2019 |
| 558 | septictankers.com | GoDaddy.com, LLC | 29 Jan 2004 | 21 Jan 2025 | 29 Jan 2026 |
| 559 | septictanktruckssales.com | GoDaddy.com, LLC | 1 Mar 2012 | 2 Mar 2015 | 1 Mar 2017 |
| 560 | septictankpumpingfresno.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 561 | septictankinstallationgranadahills.com | eNom, Inc. | 30 Jun 2010 | 1 Jun 2017 | 30 Jun 2018 |
| 562 | septictankswarehouse.com | eNom, Inc. | 8 Nov 2012 | 9 Nov 2017 | 8 Nov 2017 |
| 563 | septictankpumpingeastbethel.com | Tucows Domains Inc. | 14 Apr 2011 | 18 Apr 2017 | 14 Apr 2017 |
| 564 | septictanksmemphis.com | GoDaddy.com, LLC | 9 Jan 2014 | 9 Jan 2016 | 9 Jan 2017 |
| 565 | septictanksorlando.com | GoDaddy.com, LLC | 9 Jan 2014 | 9 Jan 2016 | 9 Jan 2017 |
| 566 | septictankcleaningoh.com | eNom, Inc. | 10 Apr 2013 | 12 Mar 2016 | 10 Apr 2017 |
| 567 | septictanksinspection.com | eNom, Inc. | 18 Sep 2009 | 22 Sep 2016 | 18 Sep 2016 |
| 568 | septictankpros.com | GoDaddy.com, LLC | 2 Mar 2011 | 4 Feb 2025 | 2 Mar 2026 |
| 569 | septictankbiotechsystem.com | CV. Rumahweb Indonesia | 20 Mar 2013 | 5 Mar 2024 | 20 Mar 2026 |
| 570 | septictankservicefayettevillenc.com | register.com, Inc. | 23 Jan 2012 | 23 Jan 2012 | 23 Jan 2018 |
| 571 | septictankpumpingarizona.com | GoDaddy.com, LLC | 12 Apr 2010 | 13 Apr 2016 | 12 Apr 2017 |
| 572 | septictankga.com | GoDaddy.com, LLC | 25 Jul 2013 | 29 Jul 2016 | 25 Jul 2017 |
| 573 | septictankinspector.com | Blacknight Internet Solutions Ltd. | 13 Sep 2011 | 15 Oct 2014 | 13 Sep 2021 |
| 574 | septictankcleaningbroward.com | GoDaddy.com, LLC | 14 Apr 2013 | 26 May 2024 | 14 Apr 2024 |
| 575 | septictankchemicals.com | GoDaddy.com, LLC | 20 Mar 2006 | 17 Mar 2025 | 20 Mar 2026 |
| 576 | septictanksireland.com | Tucows Domains Inc. | 11 Nov 2013 | 22 Dec 2023 | 11 Nov 2023 |
| 577 | septictankramahlingkungan.com | Web Commerce Communications Limited dba WebNic.cc | 1 Aug 2013 | 22 Jul 2019 | 2 Aug 2026 |
| 578 | septictankpumpinggilbert.com | GoDaddy.com, LLC | 6 Mar 2010 | 7 Mar 2016 | 6 Mar 2017 |
| 579 | septictankpumpingclovis.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 580 | septictankprices.com | TurnCommerce, Inc. DBA NameBright.com | 17 Mar 2020 | 18 Apr 2024 | 17 Mar 2024 |
| 581 | septictankyeovil.com | Mesh Digital Limited | 2 Aug 2011 | 18 Jul 2016 | 2 Aug 2017 |
| 582 | septictankpumpings.com | GoDaddy.com, LLC | 13 Feb 2014 | 18 Feb 2025 | 13 Feb 2027 |
| 583 | septictankreplacementandrepair.com | GoDaddy.com, LLC | 17 Jul 2014 | 18 Jul 2024 | 17 Jul 2029 |
| 584 | septictankstampa.com | GoDaddy.com, LLC | 9 Jan 2014 | 9 Jan 2016 | 9 Jan 2017 |
| 585 | septictanktreatmentproducts.com | GoDaddy.com, LLC | 3 Apr 2023 | 14 Jun 2025 | 3 Apr 2025 |
| 586 | septictankservicedothanal.com | Wild West Domains, LLC | 5 Mar 2014 | 5 Mar 2016 | 5 Mar 2017 |
| 587 | septictankssavannah.com | Namesilo, LLC | 23 Oct 2019 | 24 Oct 2019 | 23 Oct 2020 |
| 588 | septictanksrutland.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 589 | septictankriser.com | Tucows Domains Inc. | 9 Jan 2009 | 10 Dec 2024 | 9 Jan 2026 |
| 590 | septictankcleaninginsurance.com | TierraNet Inc. d/b/a DomainDiscover | 3 Feb 2008 | 5 Dec 2022 | 4 Feb 2026 |
| 591 | septictanktreatmentreviews.com | NameCheap, Inc. | 20 Jul 2011 | 20 Jun 2025 | 20 Jul 2026 |
| 592 | septictankbiofilmodern.com | CV. Rumahweb Indonesia | 24 Jun 2013 | 23 Jun 2023 | 23 Jun 2026 |
| 593 | septictankbiotech-biotechseptictank.com | CV. Rumahweb Indonesia | 7 May 2013 | - | 6 May 2018 |
| 594 | septictankcleaningsalinas.com | DropCatch.com 1278 LLC | 3 Jun 2024 | 4 Jun 2024 | 3 Jun 2026 |
| 595 | septictankinstallationbeaverton.com | eNom, Inc. | 12 Oct 2010 | 12 Sep 2017 | 12 Oct 2018 |
| 596 | septictankservicing.com | Dynadot, LLC | 22 Jun 2025 | 22 Jun 2025 | 22 Jun 2026 |
| 597 | septictankcleanersoh.com | eNom, Inc. | 11 Apr 2014 | 13 Mar 2016 | 11 Apr 2017 |
| 598 | septictankcleaningokc.com | Tucows Domains Inc. | 25 Apr 2011 | 29 Apr 2017 | 25 Apr 2017 |
| 599 | septictanksoregon.com | GoDaddy.com, LLC | 2 Aug 2011 | 14 Oct 2025 | 2 Aug 2025 |
| 600 | septictankinstallers.com | GoDaddy.com, LLC | 12 Aug 2008 | 12 Aug 2025 | 12 Aug 2026 |
| 601 | septictankinstall.com | GoDaddy.com, LLC | 12 Aug 2008 | 12 Aug 2025 | 12 Aug 2026 |
| 602 | septictankssouthlouisiana.com | Tucows Domains Inc. | 20 Feb 2014 | 24 Feb 2019 | 20 Feb 2019 |
| 603 | septictankserviceeatonton.com | eNom, Inc. | 8 Aug 2014 | 10 Jul 2015 | 8 Aug 2018 |
| 604 | septictankstaunton.com | Mesh Digital Limited | 2 Aug 2011 | 18 Jul 2016 | 2 Aug 2017 |
| 605 | septictanknj.com | Tucows Domains Inc. | 4 Oct 2010 | 14 Sep 2025 | 4 Oct 2026 |
| 606 | septictankspaducahky.com | GoDaddy.com, LLC | 16 Jun 2014 | 15 Jun 2016 | 16 Jun 2017 |
| 607 | septictankbiotechindonesia.com | CV. Rumahweb Indonesia | 8 Jul 2013 | 17 Jul 2024 | 7 Jul 2027 |
| 608 | septictanksandcesspits.com | 1&1 Internet AG | 17 Aug 2012 | 9 Oct 2025 | 17 Aug 2026 |
| 609 | septictankinspections.com | GoDaddy.com, LLC | 27 Feb 2008 | 28 Feb 2025 | 27 Feb 2026 |
| 610 | septictankwestsussex.com | GoDaddy.com, LLC | 17 Nov 2021 | 17 Nov 2021 | 17 Nov 2022 |
| 611 | septictankservicesdecaturga.com | eNom, Inc. | 21 Oct 2014 | 22 Sep 2016 | 21 Oct 2016 |
| 612 | septictanksrus.com | TurnCommerce, Inc. DBA NameBright.com | 4 Nov 2012 | 14 Dec 2024 | 4 Nov 2024 |
| 613 | septictankpumpingmadera.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 614 | septictanktreatments.com | NameCheap, Inc. | 11 Mar 2012 | 9 Feb 2025 | 11 Mar 2026 |
| 615 | septictankcleaning.com | Namesilo, LLC | 19 Jan 2002 | 6 Sep 2025 | 19 Jan 2026 |
| 616 | septictankcleaninghollywood.com | GoDaddy.com, LLC | 9 Dec 2012 | 10 Dec 2024 | 9 Dec 2026 |
| 617 | septictankpumpingmesa.com | GoDaddy.com, LLC | 6 Mar 2010 | 7 Mar 2016 | 6 Mar 2017 |
| 618 | septictankpumpingnj.com | Tucows Domains Inc. | 4 Oct 2010 | 14 Sep 2025 | 4 Oct 2026 |
| 619 | septictankcompany.com | GoDaddy.com, LLC | 28 Dec 2012 | 30 Nov 2024 | 28 Dec 2025 |
| 620 | septictankfood.com | Topsystem, LLC | 9 Oct 2010 | 10 Oct 2015 | 9 Oct 2016 |
| 621 | septictankpumpinglemoore.com | eNom, Inc. | 24 Aug 2010 | 27 Aug 2016 | 24 Aug 2016 |
| 622 | septictanktrucks.com | GoDaddy.com, LLC | 23 Jun 2010 | 4 Jun 2025 | 23 Jun 2026 |
| 623 | septictankconsultants.com | Tucows Domains Inc. | 11 Feb 2014 | 15 Feb 2020 | 11 Feb 2020 |
| 624 | septictankproblems.com | NameCheap, Inc. | 29 Jul 2004 | 28 Jun 2025 | 28 Jul 2026 |
| 625 | septictankpumping.com | GoDaddy.com, LLC | 18 Sep 2000 | 19 Sep 2025 | 18 Sep 2026 |
| 626 | septictanks.com | Network Solutions, LLC | 14 Jan 1997 | 3 Jan 2023 | 13 Jan 2027 |
| 627 | septictankservicesfl.com | eNom, Inc. | 29 Jan 2013 | 31 Dec 2015 | 29 Jan 2017 |
| 628 | septictankempty.com | TurnCommerce, Inc. DBA NameBright.com | 13 Dec 2018 | 23 Aug 2022 | 13 Dec 2025 |
| 629 | septictanksnear.com | GoDaddy.com, LLC | 23 Feb 2012 | 2 Feb 2025 | 23 Feb 2027 |
| 630 | septictankchlorinators.com | GoDaddy.com, LLC | 4 May 2012 | 12 Mar 2015 | 12 Mar 2017 |
| 631 | septictankworms.com | Dynadot, LLC | 12 May 2019 | 7 May 2025 | 12 May 2032 |
| 632 | septictankbiosafe.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Mar 2013 | 15 Mar 2017 | 20 Mar 2019 |
| 633 | septictankbiofilbaik.com | CV. Rumahweb Indonesia | 8 Jul 2013 | 17 Sep 2025 | 8 Jul 2025 |
| 634 | septictankbiocell.com | Namesilo, LLC | 31 Jul 2019 | 31 Jul 2019 | 31 Jul 2020 |
| 635 | septictankserviceclarksvilletn.com | Tucows Domains Inc. | 15 Nov 2010 | 19 Nov 2016 | 15 Nov 2016 |
| 636 | septictankemptied.com | Webfusion Ltd. | 5 Jun 2013 | 29 May 2017 | 5 Jun 2019 |
| 637 | septictankcleaningnicholasville.com | eNom, Inc. | 14 Feb 2014 | 31 Jan 2015 | 14 Feb 2017 |
| 638 | septictankservicerosenberg.com | GoDaddy.com, LLC | 7 Feb 2013 | 19 Mar 2024 | 7 Feb 2024 |
| 639 | septictankserviceringwood.com | Name.com, Inc. | 8 Jul 2011 | 4 Aug 2016 | 8 Jul 2017 |
| 640 | septictankpumpingaugusta.com | NameCheap, Inc. | 1 Oct 2013 | 1 Sep 2025 | 1 Oct 2026 |
| 641 | septictankpumpingmerced.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 642 | septictankemptyingstafford.com | Namesilo, LLC | 31 Aug 2017 | 1 Sep 2017 | 31 Aug 2018 |
| 643 | septictankcovers.com | DNC Holdings, Inc. | 15 Nov 2023 | 20 Nov 2023 | 15 Nov 2026 |
| 644 | septictankbio.com | TurnCommerce, Inc. DBA NameBright.com | 28 Apr 2019 | 22 Apr 2021 | 28 Apr 2026 |
| 645 | septictankscorby.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 646 | septictankspumping.com | GoDaddy.com, LLC | 3 May 2025 | 3 May 2025 | 3 May 2026 |
| 647 | septictankpumpingpro.com | GoDaddy.com, LLC | 24 Mar 2010 | 21 May 2020 | 24 Mar 2021 |
| 648 | septictankhelper.com | GoDaddy.com, LLC | 30 Jun 2013 | 1 Jul 2016 | 30 Jun 2017 |
| 649 | septictankpumpingphoenix.com | GoDaddy.com, LLC | 2 Apr 2012 | 3 Apr 2016 | 2 Apr 2017 |
| 650 | septictankbiotechmodern.com | - | 7 Sep 2024 | 8 Sep 2025 | 7 Sep 2026 |
| 651 | septictankexpert.com | Dynadot13 LLC | 5 Aug 2024 | 14 Sep 2025 | 5 Aug 2025 |
| 652 | septictankpumpingwilsoncountytn.com | Tucows Domains Inc. | 31 Jan 2012 | 4 Feb 2017 | 31 Jan 2017 |
| 653 | septictankworm.com | PresidentialDomains LLC | 12 May 2013 | 13 May 2017 | 12 May 2018 |
| 654 | septictankpeople.com | GoDaddy.com, LLC | 26 Apr 2013 | 15 Apr 2015 | 26 Apr 2017 |
| 655 | septictanksrepair.com | eNom, Inc. | 18 Sep 2009 | 22 Sep 2016 | 18 Sep 2016 |
| 656 | septictanksnottingham.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 657 | septictankrepair.com | GoDaddy.com, LLC | 25 Oct 2004 | 26 Oct 2024 | 25 Oct 2025 |
| 658 | septictankcornwall.com | 1&1 Internet AG | 17 Jun 2013 | 20 Mar 2018 | 17 Jun 2026 |
| 659 | septictankcompanyopelika.com | eNom, Inc. | 15 Oct 2013 | 16 Sep 2016 | 15 Oct 2016 |
| 660 | septictankmodernbaik.com | CV. Rumahweb Indonesia | 5 Aug 2013 | 14 Sep 2024 | 4 Aug 2024 |
| 661 | septictankowner.com | GoDaddy.com, LLC | 13 Jul 2006 | 23 Aug 2025 | 13 Jul 2025 |
| 662 | septictankshock.com | Name.com, Inc. | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2017 |
| 663 | septictanklids.com | Tucows Domains Inc. | 9 Jan 2009 | 10 Dec 2024 | 9 Jan 2026 |
| 664 | septictanktreatmentflorida.com | GoDaddy.com, LLC | 8 Dec 2012 | 8 Dec 2015 | 8 Dec 2016 |
| 665 | septictankpumpingvisalia.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 666 | septictankemptyinghereford.com | GoDaddy.com, LLC | 13 May 2011 | 14 May 2015 | 13 May 2017 |
| 667 | septictanktemecula.com | GoDaddy.com, LLC | 1 Aug 2014 | 16 Nov 2015 | 11 Nov 2018 |
| 668 | septictankcleaningnj.com | register.com, Inc. | 16 May 2012 | 2 Jan 2019 | 16 May 2026 |
| 669 | septictank-biotech.com | West263 International Limited | 8 Oct 2020 | 8 Oct 2020 | 8 Oct 2021 |
| 670 | septictanksomerset.com | Mesh Digital Limited | 2 Aug 2011 | 18 Jul 2016 | 2 Aug 2017 |
| 671 | septictanksandsewagetreatmentplants.com | Tucows Domains Inc. | 20 Apr 2012 | 17 Apr 2024 | 20 Apr 2026 |
| 672 | septictankbali.com | - | 26 Aug 2025 | 19 Sep 2025 | 26 Aug 2026 |
| 673 | septictankpalmbeach.com | GoDaddy.com, LLC | 5 Jun 2012 | 6 Jun 2016 | 5 Jun 2018 |
| 674 | septictankairdrie.com | GoDaddy.com, LLC | 6 Jan 2012 | 7 Jan 2016 | 6 Jan 2018 |
| 675 | septictanksdestinfl.com | register.com, Inc. | 15 Feb 2011 | 15 Feb 2011 | 15 Feb 2017 |
| 676 | septictankcleaningseymour.com | NameCheap, Inc. | 12 Nov 2013 | 12 Oct 2024 | 12 Nov 2025 |
| 677 | septictankcleaningmendon.com | Key-Systems GmbH | 17 Apr 2021 | 30 Jun 2025 | 17 Apr 2025 |
| 678 | septictankcleaningcharlottemi.com | - | 28 Sep 2010 | 28 Sep 2010 | 28 Sep 2017 |
| 679 | septictankslosangeles.com | GoDaddy.com, LLC | 9 Jan 2014 | 9 Jan 2016 | 9 Jan 2017 |
| 680 | septictankinstallations.com | GoDaddy.com, LLC | 1 Nov 2004 | 12 Oct 2024 | 1 Nov 2025 |
| 681 | septictankbiofive.com | CV. Rumahweb Indonesia | 21 Nov 2013 | 8 Nov 2024 | 20 Nov 2026 |
| 682 | septictankemptyingshropshire.com | GoDaddy.com, LLC | 11 Jun 2011 | 12 Jun 2015 | 11 Jun 2017 |
| 683 | septictankdanger.com | Tucows Domains Inc. | 13 Jul 2007 | 28 Jun 2025 | 13 Jul 2026 |
| 684 | septictankbiosys.com | - | 27 Mar 2025 | 28 Sep 2025 | 27 Mar 2026 |
| 685 | septictankbiotechjakarta.com | CV. Rumahweb Indonesia | 5 Aug 2013 | 14 Sep 2024 | 4 Aug 2024 |
| 686 | septictankconsulting.com | eNom, Inc. | 18 Sep 2009 | 22 Sep 2016 | 18 Sep 2016 |
| 687 | septictankcalgary.com | GoDaddy.com, LLC | 6 Jan 2012 | 7 Jan 2016 | 6 Jan 2018 |
| 688 | septictankinstallationportland.com | eNom, Inc. | 12 Oct 2010 | 12 Sep 2017 | 12 Oct 2018 |
| 689 | septictanksdallas.com | GoDaddy.com, LLC | 9 Jan 2014 | 9 Jan 2016 | 9 Jan 2017 |
| 690 | septictanksgrantham.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 691 | septictankbiosistem.com | CV. Rumahweb Indonesia | 1 May 2013 | 5 Jun 2025 | 1 May 2026 |
| 692 | septictankpumpingapachejunction.com | GoDaddy.com, LLC | 6 Mar 2010 | 7 Mar 2016 | 6 Mar 2017 |
| 693 | septictanknear.com | GoDaddy.com, LLC | 23 Feb 2012 | 2 Feb 2025 | 23 Feb 2027 |
| 694 | septictankinstallationnorthridge.com | eNom, Inc. | 30 Jun 2010 | 1 Jun 2017 | 30 Jun 2018 |
| 695 | septictankrepairorlando.com | GoDaddy.com, LLC | 8 Dec 2012 | 8 Dec 2015 | 8 Dec 2016 |
| 696 | septictankcleaned.com | 1&1 Internet AG | 11 Jan 2008 | 12 Jan 2025 | 11 Jan 2026 |
| 697 | septictankpumpingocala.com | Namesilo, LLC | 15 Nov 2021 | 15 Jan 2024 | 15 Nov 2023 |
| 698 | septictanksolutionsfl.com | Tucows Domains Inc. | 18 Mar 2008 | 17 Feb 2025 | 18 Mar 2026 |
| 699 | septictankssummitstation.com | DropCatch.com 1130 LLC | 5 Oct 2022 | 16 Dec 2023 | 5 Oct 2023 |
| 700 | septictankcleaningcost.com | GoDaddy.com, LLC | 5 Dec 2013 | 1 Oct 2015 | 5 Dec 2016 |
| 701 | septictankrepairlexington.com | eNom, Inc. | 14 Mar 2014 | 13 Feb 2017 | 14 Mar 2018 |
| 702 | septictanksmiami.com | Dynadot, LLC | 15 Nov 2018 | 15 Nov 2018 | 15 Nov 2019 |
| 703 | septictankman.com | Key-Systems GmbH | 10 May 2007 | 15 Jun 2025 | 10 May 2026 |
| 704 | septictankcleaningindiana.com | NameCheap, Inc. | 28 Oct 2022 | 9 Dec 2023 | 28 Oct 2023 |
| 705 | septictankpumpingchandler.com | GoDaddy.com, LLC | 6 Mar 2010 | 7 Mar 2016 | 6 Mar 2017 |
| 706 | septictankoverflowing.com | GoDaddy.com, LLC | 5 Dec 2011 | 5 Dec 2014 | 5 Dec 2016 |
| 707 | septictankcleaner.com | GoDaddy.com, LLC | 19 Mar 2002 | 28 Feb 2025 | 19 Mar 2026 |
| 708 | septictankcleanerreviews.com | NameCheap, Inc. | 17 Aug 2011 | 18 Jul 2025 | 17 Aug 2026 |
| 709 | septictanksloughborough.com | 1&1 Internet AG | 28 Nov 2013 | 20 Mar 2018 | 28 Nov 2019 |
| 710 | septictankconversion.com | GoDaddy.com, LLC | 15 Mar 2023 | 16 Mar 2025 | 15 Mar 2026 |
| 711 | septictankemptying.com | 1&1 Internet AG | 1 May 2013 | 3 May 2025 | 1 May 2026 |
| 712 | septictanksdirect.com | Webfusion Ltd. | 29 Jan 2010 | 29 Jan 2025 | 29 Jan 2026 |
| 713 | septictankin.com | GoDaddy.com, LLC | 23 Feb 2012 | 2 Feb 2025 | 23 Feb 2027 |
| 714 | septictankswiltshire.com | eNom, Inc. | 4 Oct 2011 | 4 Sep 2025 | 4 Oct 2026 |
| 715 | septictankcleaningmarshallms.com | Tucows Domains Inc. | 19 Mar 2010 | 23 Mar 2017 | 19 Mar 2017 |
| 716 | septictankcayman.com | GoDaddy.com, LLC | 5 Sep 2012 | 9 Dec 2015 | 5 Sep 2017 |
| 717 | septictankcleaning1.com | register.com, Inc. | 19 Nov 2012 | 1 Feb 2025 | 19 Nov 2024 |
| 718 | septictankstpbiotech.com | - | 28 Mar 2023 | 29 Apr 2024 | 28 Mar 2024 |
| 719 | septictanktruckforsale.com | Domain.com, LLC | 10 Dec 2005 | 10 Apr 2017 | 10 Dec 2017 |
| 720 | septictanksussellville.com | NameCheap, Inc. | 5 Mar 2014 | 6 Feb 2019 | 5 Mar 2020 |
| 721 | septictankpumpingqueencreek.com | GoDaddy.com, LLC | 6 Mar 2010 | 7 Mar 2016 | 6 Mar 2017 |
| 722 | septictankdoctor.com | GoDaddy.com, LLC | 19 Dec 2006 | 4 Sep 2022 | 19 Dec 2030 |
| 723 | septictankbiotank.com | CV. Rumahweb Indonesia | 21 Mar 2013 | 13 Jun 2024 | 27 Jun 2026 |
| 724 | septictankssystems-ok.com | eNom, Inc. | 25 Jun 2012 | 7 Aug 2019 | 25 Jun 2019 |
| 725 | septictankpumpingcosthq.com | OnlineNIC, Inc. | 13 Mar 2012 | 14 Mar 2017 | 13 Mar 2018 |
| 726 | septictanktreatment.com | eNom, Inc. | 31 Aug 2001 | 30 Aug 2025 | 31 Aug 2026 |
| 727 | septictankenzymes.com | 1&1 Internet AG | 19 Aug 2008 | 20 Mar 2018 | 19 Aug 2026 |
| 728 | septictanksystemsco.com | Tucows Domains Inc. | 12 Mar 2010 | 31 Aug 2025 | 12 Mar 2027 |
| 729 | septictankoverflowed.com | 1&1 Internet AG | 11 Jan 2008 | 20 Mar 2018 | 11 Jan 2026 |
| 730 | septictankcleaningcantonmi.com | GoDaddy.com, LLC | 22 Feb 2013 | 16 Dec 2024 | 22 Feb 2025 |
| 731 | septictankstallahassee.com | Namesilo, LLC | 23 Oct 2019 | 1 Jan 2025 | 23 Oct 2024 |
| 732 | septictanksinstallation.com | Mesh Digital Limited | 13 Nov 2024 | 12 Mar 2025 | 13 Nov 2025 |
| 733 | septictankfilters.com | Network Solutions, LLC | 4 Nov 2011 | 5 Sep 2021 | 4 Nov 2026 |
| 734 | septictankpumpinggrasslakemi.com | Launchpad, Inc. | 17 Jan 2014 | 2 Jan 2025 | 17 Jan 2026 |
| 735 | septictankproducts.com | Wix.com Ltd. | 7 Oct 2023 | 11 Oct 2024 | 7 Oct 2025 |
| 736 | septictanksoklahoma.com | Tucows Domains Inc. | 14 Jul 2011 | 15 Jun 2017 | 14 Jul 2018 |
| 737 | septictankbiofil.com | CV. Rumahweb Indonesia | 14 Apr 2011 | 3 Apr 2024 | 13 Apr 2026 |
| 738 | septictankpumps.com | Tucows Domains Inc. | 9 Jan 2009 | 10 Dec 2024 | 9 Jan 2026 |
| 739 | septictankadditive.com | GoDaddy.com, LLC | 29 Oct 2002 | 9 Oct 2025 | 29 Oct 2026 |
| 740 | septictankpumpingtampa.com | GoDaddy.com, LLC | 16 Jan 2024 | 16 Jan 2025 | 16 Jan 2026 |
| 741 | septictankmaintenance.com | NameCheap, Inc. | 21 Mar 2002 | 19 Feb 2025 | 21 Mar 2026 |
| 742 | septictanksystemanswers.com | GoDaddy.com, LLC | 22 Nov 2006 | 22 Nov 2024 | 22 Nov 2026 |
| 743 | septictankpumpingbakersfield.com | NameCheap, Inc. | 2 Sep 2024 | 3 Aug 2025 | 2 Sep 2026 |
| 744 | septictankstp.com | CV. Rumahweb Indonesia | 16 May 2012 | 15 May 2025 | 16 May 2026 |
| 745 | septictankfrance.com | GoDaddy.com, LLC | 6 Jan 2011 | 7 Jan 2023 | 6 Jan 2028 |
| 746 | septictankshouston.com | GoDaddy.com, LLC | 9 Jan 2014 | 9 Jan 2016 | 9 Jan 2017 |
| 747 | septictankinstallationmalibu.com | eNom, Inc. | 30 Jun 2010 | 1 Jun 2017 | 30 Jun 2018 |
| 748 | septictankrescue.com | NameCheap, Inc. | 30 Mar 2025 | 30 Mar 2025 | 30 Mar 2026 |
| 749 | septictanklocator.com | GoDaddy.com, LLC | 23 Jan 2002 | 21 Jan 2025 | 23 Jan 2026 |
| 750 | septictankcleaninglexington.com | eNom, Inc. | 10 Mar 2014 | 24 Feb 2015 | 10 Mar 2017 |
| 751 | septictankbiotech-stpbiotech.com | CV. Rumahweb Indonesia | 7 May 2013 | - | 6 May 2018 |
| 752 | septictankpensacolafl.com | register.com, Inc. | 14 Feb 2012 | 14 Feb 2012 | 14 Feb 2018 |
| 753 | septictankphoenix.com | eNom, Inc. | 9 Oct 2012 | 24 Sep 2016 | 9 Oct 2016 |
| 754 | septictankgreasetrapenzymes.com | GoDaddy.com, LLC | 24 Apr 2012 | 25 Apr 2016 | 24 Apr 2017 |
| 755 | septictankpermit.com | FastDomain Inc. | 4 Apr 2013 | 20 Mar 2025 | 4 Apr 2026 |
| 756 | septictankpumpinglamont.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 757 | septictankpumpingrivesjunctionmi.com | Launchpad, Inc. | 17 Jan 2014 | 2 Jan 2025 | 17 Jan 2026 |
| 758 | septictankserviceandmore.com | GoDaddy.com, LLC | 24 Oct 2010 | 24 Oct 2015 | 24 Oct 2016 |
| 759 | septictankshampshire.com | 1&1 Internet AG | 20 Jun 2025 | 20 Jun 2025 | 20 Jun 2027 |
| 760 | septictanksystemscleaning.com | eNom, Inc. | 18 Sep 2009 | 22 Sep 2016 | 18 Sep 2016 |
| 761 | septictankservicebrownsville.com | eNom, Inc. | 9 Jul 2014 | 25 Jun 2015 | 9 Jul 2017 |
| 762 | septictankinfo.com | NameCheap, Inc. | 3 Mar 2006 | 1 Feb 2025 | 3 Mar 2030 |
| 763 | septictankpumpinghanford.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 764 | septictanktv.com | Google, Inc. | 27 Jan 2022 | 10 Mar 2025 | 27 Jan 2025 |
| 765 | septictanksin.com | GoDaddy.com, LLC | 23 Feb 2012 | 2 Feb 2025 | 23 Feb 2027 |
| 766 | septictankpumpingscottsdale.com | GoDaddy.com, LLC | 6 Mar 2010 | 7 Mar 2016 | 6 Mar 2017 |
| 767 | septictanks-fl.com | eNom, Inc. | 11 May 2011 | 30 Oct 2017 | 11 May 2018 |
| 768 | septictank-pumping-palmbeach.com | GoDaddy.com, LLC | 5 Jun 2012 | 6 Jun 2016 | 5 Jun 2018 |
| 769 | septictankinspectors.com | Blacknight Internet Solutions Ltd. | 13 Sep 2011 | 15 Oct 2014 | 13 Sep 2021 |
| 770 | septictanksupermarket.com | GoDaddy.com, LLC | 18 Jun 2023 | 1 Aug 2025 | 18 Jun 2026 |
| 771 | septictankpumpinghanovermi.com | Launchpad, Inc. | 17 Jan 2014 | 2 Jan 2025 | 17 Jan 2026 |
| 772 | septictankscrestview.com | register.com, Inc. | 3 May 2013 | 3 May 2013 | 3 May 2017 |
| 773 | septictankhelp.com | Network Solutions, LLC | 30 Dec 2019 | 7 Dec 2024 | 30 Dec 2025 |
| 774 | septictankpump.com | GoDaddy.com, LLC | 3 Dec 2018 | 7 Dec 2024 | 3 Dec 2025 |
| 775 | septictankmarkers.com | GoDaddy.com, LLC | 14 Nov 2007 | 4 Sep 2022 | 14 Nov 2025 |
| 776 | septictanksolutions.com | GoDaddy.com, LLC | 2 Jun 2006 | 2 Jun 2025 | 2 Jun 2026 |
| 777 | septictanksocalafl.com | Xin Net Technology Corporation | 22 Feb 2019 | 24 Dec 2019 | 22 Feb 2021 |
| 778 | septictankpumpinc.com | FastDomain Inc. | 12 Sep 2013 | 15 Oct 2017 | 12 Sep 2017 |
| 779 | septictanksrome.com | eNom, Inc. | 4 Apr 2014 | 21 Mar 2015 | 4 Apr 2017 |
| 780 | septictankcleaningservice.com | Easyspace LTD | 30 Dec 2012 | 30 Dec 2024 | 30 Dec 2025 |
| 781 | septictankssystems-ks.com | eNom, Inc. | 6 Aug 2012 | 7 Aug 2019 | 6 Aug 2019 |
| 782 | septictankinstallationla.com | eNom, Inc. | 30 Jun 2010 | 1 Jun 2017 | 30 Jun 2018 |
| 783 | septictanktruck.com | GoDaddy.com, LLC | 24 Jul 2011 | 18 Jun 2025 | 24 Jul 2026 |
| 784 | septictankrepairs.com | - | 18 Jul 2020 | 6 Jul 2024 | 18 Jul 2026 |
| 785 | septictankoverflow.com | 1&1 Internet AG | 11 Jan 2008 | 20 Mar 2018 | 11 Jan 2026 |
| 786 | septictanksanantonio.com | GoDaddy.com, LLC | 30 Aug 2013 | 31 Aug 2025 | 30 Aug 2026 |
| 787 | septictanklid.com | DNC Holdings, Inc. | 16 Jun 2022 | 26 May 2025 | 16 Jun 2026 |
| 788 | septictankupgrades.com | Realtime Register B.V. | 9 Feb 2012 | 10 Feb 2025 | 9 Feb 2026 |
| 789 | septictankmurah.com | Gransy s.r.o. d/b/a subreg.cz | 1 Jun 2023 | 2 Jun 2024 | 1 Jun 2025 |
| 790 | septictankcleaningsmithfield.com | eNom, Inc. | 19 May 2014 | 20 Apr 2015 | 19 May 2017 |
| 791 | septictankfiber.com | Gransy s.r.o. d/b/a subreg.cz | 14 Feb 2023 | 6 Mar 2024 | 14 Feb 2024 |
| 792 | septictankpumpingservice.com | GoDaddy.com, LLC | 27 Dec 2023 | 28 Dec 2024 | 27 Dec 2025 |
| 793 | septictankproduct.com | GoDaddy.com, LLC | 14 Feb 2011 | 15 Feb 2016 | 14 Feb 2018 |
| 794 | septictankchemical.com | GoDaddy.com, LLC | 14 Oct 2005 | 29 Sep 2025 | 14 Oct 2026 |
| 795 | septictankcleaningservices.com | GoDaddy.com, LLC | 5 Oct 2024 | 6 Oct 2025 | 5 Oct 2026 |
| 796 | septictankcleaninggreensburgpa.com | register.com, Inc. | 6 Jun 2012 | 3 Jul 2014 | 6 Jun 2018 |
| 797 | septictankrichmond.com | Wild West Domains, LLC | 9 Dec 2010 | 10 Jun 2016 | 9 Dec 2017 |
| 798 | septictanksnc.com | eNom, Inc. | 9 Aug 2010 | 4 Aug 2017 | 9 Aug 2018 |
| 799 | septictankcleaningaustin.com | eNom, Inc. | 22 Aug 2012 | 30 Oct 2017 | 22 Aug 2018 |
| 800 | septictanksbrunswickga.com | Tucows Domains Inc. | 3 Mar 2010 | 7 Mar 2020 | 3 Mar 2020 |
| 801 | septictanksla.com | Tucows Domains Inc. | 23 Jun 2011 | 27 Jun 2017 | 23 Jun 2017 |
| 802 | septictanksmaintenance.com | Mesh Digital Limited | 18 Dec 2012 | 25 Jul 2017 | 18 Dec 2017 |
| 803 | septictankpumpinglahabraheights.com | NameCheap, Inc. | 12 Nov 2013 | 12 Oct 2019 | 12 Nov 2020 |
| 804 | septictankcleaningmiami.com | NameCheap, Inc. | 11 Feb 2024 | 28 Nov 2024 | 11 Feb 2026 |
| 805 | septictankcleaningbrunswickme.com | register.com, Inc. | 26 Sep 2011 | 27 Sep 2025 | 26 Sep 2026 |
| 806 | septictankinspectionsllc.com | GoDaddy.com, LLC | 22 Jun 2021 | 22 Jun 2021 | 22 Jun 2022 |
| 807 | septictankpumper.com | GoDaddy.com, LLC | 21 Nov 2007 | 23 Nov 2023 | 21 Nov 2025 |
| 808 | septictankabbotsford.com | Wild West Domains, LLC | 9 Dec 2010 | 10 Jun 2016 | 9 Dec 2017 |
| 809 | septictankservice.com | GoDaddy.com, LLC | 7 Feb 2002 | 6 Feb 2025 | 7 Feb 2026 |
| 810 | septictankrisers.com | Tucows Domains Inc. | 9 Jan 2009 | 10 Dec 2024 | 9 Jan 2026 |
| 811 | septictanktaunton.com | Mesh Digital Limited | 2 Aug 2011 | 18 Jul 2016 | 2 Aug 2017 |
| 812 | septictankproblemspro.com | eNom, Inc. | 23 Aug 2010 | 24 Aug 2016 | 23 Aug 2016 |
| 813 | septictankscharlotte.com | GoDaddy.com, LLC | 9 Jan 2014 | 9 Jan 2016 | 9 Jan 2017 |
| 814 | septictankmiami.com | NameCheap, Inc. | 9 Sep 2010 | 10 Aug 2025 | 9 Sep 2026 |
| 815 | septictankcertification.com | GoDaddy.com, LLC | 7 Apr 2001 | 7 Apr 2024 | 7 Apr 2026 |
| 816 | septictankdealers.com | eNom, Inc. | 18 Sep 2009 | 22 Sep 2016 | 18 Sep 2016 |
| 817 | septictankinstaller.com | GoDaddy.com, LLC | 12 Aug 2008 | 12 Aug 2025 | 12 Aug 2026 |
| 818 | septictankskelowna.com | Wild West Domains, LLC | 3 Sep 2008 | 4 Sep 2019 | 3 Sep 2020 |
| 819 | septictank-uk.com | 1&1 Internet AG | 15 Sep 2013 | 16 Sep 2016 | 15 Sep 2017 |
| 820 | septictankanddraincleaning.com | - | 18 Jul 2025 | 21 Sep 2025 | 18 Jul 2026 |
| 821 | septictankrepairmarietta.com | eNom, Inc. | 12 Dec 2012 | 29 Oct 2017 | 12 Dec 2017 |
| 822 | septictanksyeovil.com | Mesh Digital Limited | 2 Aug 2011 | 18 Jul 2016 | 2 Aug 2017 |
| 823 | septictankbooster.com | GoDaddy.com, LLC | 2 Jun 2006 | 2 Jun 2025 | 2 Jun 2026 |
| 824 | septictankcheshire.com | Mesh Digital Limited | 12 Jun 2012 | 26 Jul 2017 | 12 Jun 2018 |
| 825 | septictankadditives.com | GoDaddy.com, LLC | 29 Oct 2002 | 9 Oct 2025 | 29 Oct 2026 |
| 826 | septictankcleaningphuket.com | FastDomain Inc. | 19 Sep 2009 | 4 Sep 2025 | 19 Sep 2026 |
| 827 | septictankcleaners.com | GoDaddy.com, LLC | 3 Mar 2006 | 11 Feb 2025 | 3 Mar 2026 |
| 828 | septictanksvancouver.com | Wild West Domains, LLC | 3 Sep 2008 | 4 Sep 2019 | 3 Sep 2020 |
| 829 | septictankregistration.com | Tucows Domains Inc. | 24 Mar 2012 | 28 Mar 2018 | 24 Mar 2018 |
| 830 | septictankmodern.com | CV. Rumahweb Indonesia | 31 May 2013 | 4 Dec 2024 | 1 Jan 2026 |
| 831 | septictankpumpingporterville.com | eNom, Inc. | 6 Aug 2010 | 17 Sep 2016 | 6 Aug 2016 |
| 832 | septictankbacteria.com | eNom, Inc. | 12 May 2006 | 6 May 2025 | 12 May 2026 |
| 833 | septictankshutchinson.com | Tucows Domains Inc. | 10 Dec 2010 | 14 Dec 2016 | 10 Dec 2016 |
| 834 | septictankissues.com | NameCheap, Inc. | 26 Jul 2011 | 26 Jun 2025 | 26 Jul 2026 |
| 835 | septictankfriendly.com | 1&1 Internet AG | 9 Oct 2003 | 20 Mar 2018 | 9 Oct 2026 |
| 836 | septictankanswers.com | Tucows Domains Inc. | 25 Feb 1998 | 24 Feb 2025 | 24 Feb 2026 |
| 837 | septictankcleaningwashingtonpa.com | register.com, Inc. | 5 Jun 2012 | 3 Jul 2014 | 5 Jun 2018 |
| 838 | septictankmodernindonesia.com | GMO Internet Inc. | 21 Oct 2022 | 1 Jan 2024 | 21 Oct 2023 |
| 839 | septictankpumpingcostlist.com | GMO Internet Inc. | 16 Jul 2014 | 12 Jul 2016 | 16 Jul 2017 |
| 840 | septictankbiotdf.com | Realtime Register B.V. | 27 Sep 2016 | 8 Nov 2017 | 27 Sep 2017 |
| 841 | septictankswestmidlands.com | Mesh Digital Limited | 27 Sep 2016 | 5 Oct 2017 | 27 Sep 2018 |
| 842 | septictanksdevon.com | Tucows Domains Inc. | 10 Sep 2025 | 10 Sep 2025 | 10 Sep 2026 |
| 843 | septictankmodernbiotech.com | CV. Rumahweb Indonesia | 5 Jul 2013 | 17 Jul 2024 | 4 Jul 2027 |
| 844 | septictankflowerybranch.com | NameCheap, Inc. | 6 Oct 2016 | 6 Sep 2025 | 6 Oct 2026 |
| 845 | septictankbirmingham.com | eNom, Inc. | 7 Oct 2016 | 30 Oct 2017 | 7 Oct 2018 |
| 846 | septictankservice.company | Network Solutions, LLC | 8 Oct 2016 | 12 Nov 2017 | 8 Oct 2017 |
| 847 | septictankservice.info | Blacknight Internet Solutions Ltd. | 4 Oct 2013 | 11 Oct 2016 | 4 Oct 2017 |
| 848 | septictankfibreglass.info | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 May 2012 | 15 Aug 2015 | 31 May 2018 |
| 849 | septictanks.info | Dynadot, LLC | 29 Nov 2005 | 30 Dec 2024 | 29 Nov 2034 |
| 850 | septictankcleaner.info | GoDaddy.com, LLC | 22 Mar 2012 | 23 Mar 2016 | 22 Mar 2017 |
| 851 | septictankproblemsurrey.info | Mesh Digital Limited | 12 May 2010 | 5 May 2016 | 12 May 2018 |
| 852 | septictankinfo.info | eNom, Inc. | 7 Nov 2005 | 7 Nov 2017 | 7 Nov 2018 |
| 853 | septictankemptying.info | 1&1 Internet AG | 28 Oct 2010 | 12 Dec 2024 | 28 Oct 2025 |
| 854 | septictanktreatment.info | GoDaddy.com, LLC | 2 Jan 2007 | 8 May 2013 | 2 Jan 2022 |
| 855 | septictankinstaller.info | GoDaddy.com, LLC | 14 Jul 2009 | 11 Jul 2016 | 14 Jul 2017 |
| 856 | septictankwarranty.info | GoDaddy.com, LLC | 7 Jul 2013 | 8 Jul 2017 | 7 Jul 2018 |
| 857 | septictankinstallations.info | GoDaddy.com, LLC | 26 Feb 2013 | 12 Apr 2025 | 26 Feb 2026 |
| 858 | septictankinstallation.mobi | GoDaddy.com, LLC | 6 Dec 2013 | 1 Dec 2016 | 6 Dec 2017 |
| 859 | septictankmanhattanenvelopes.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 860 | septictanknewyorkflyers.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 861 | septictanknewyorkbrochures.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 862 | septictankmanhattanbrochures.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 863 | septictanknewyorkposters.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 864 | septictankmanhattanbusinesscards.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 865 | septictanknewyorkpostcards.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 866 | septictanknewyorkbrochures.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 867 | septictankmanhattanenvelopes.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 868 | septictanknewyorkenvelopes.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 869 | septictankmanhattanbrochures.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 870 | septictanknewyorkposters.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 871 | septictanknewyorkenvelopes.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 872 | septictankmanhattanpostcards.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 873 | septictankmanhattanflyers.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 874 | septictanknewyorkflyers.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 875 | septictankmanhattanletterhead.site | register.com, Inc. | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 876 | septictanknewyorkpostcards.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 877 | septictanknewyorkletterhead.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 878 | septictankmanhattanflyers.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 879 | septictankmanhattanposters.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 880 | septictankmanhattanletterhead.store | register.com, Inc. | 12 Oct 2016 | 12 Oct 2016 | 12 Oct 2017 |
| 881 | septictanknewyorkbusinesscards.store | register.com, Inc. | 12 Oct 2016 | 12 Oct 2016 | 12 Oct 2017 |
| 882 | septictanknewyorkletterhead.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 883 | septictankmanhattanbusinesscards.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 884 | septictankmanhattanposters.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 885 | septictanknewyorkbusinesscards.site | register.com, Inc. | 11 Oct 2016 | 15 Nov 2017 | 11 Oct 2017 |
| 886 | septictankmanhattanpostcards.store | register.com, Inc. | 12 Oct 2016 | 16 Nov 2017 | 12 Oct 2017 |
| 887 | septictanksbuffalo.com | - | 14 Oct 2016 | 14 Oct 2016 | 14 Oct 2017 |
| 888 | septictanktreatments.net | NameCheap, Inc. | 12 Jul 2012 | 12 Jun 2025 | 12 Jul 2026 |
| 889 | septictanks.net | GoDaddy.com, LLC | 14 Mar 2014 | 2 Apr 2025 | 14 Mar 2026 |
| 890 | septictankproblems.net | GoDaddy.com, LLC | 27 Jan 2010 | 15 Jan 2025 | 27 Jan 2026 |
| 891 | septictankcleaningmiami.net | GoDaddy.com, LLC | 13 Jul 2012 | 13 Jul 2024 | 13 Jul 2026 |
| 892 | septictankbioasahi.net | CV. Rumahweb Indonesia | 10 Jan 2014 | - | 10 Jan 2018 |
| 893 | septictankcleaning.net | GoDaddy.com, LLC | 25 Apr 2022 | 5 Jun 2024 | 25 Apr 2024 |
| 894 | septictankodor.net | GoDaddy.com, LLC | 1 Feb 2012 | 23 Feb 2015 | 1 Feb 2017 |
| 895 | septictankinspections.net | Blacknight Internet Solutions Ltd. | 13 Sep 2011 | 16 Oct 2014 | 13 Sep 2021 |
| 896 | septictankrepair.net | GoDaddy.com, LLC | 27 Jan 2012 | 27 Jan 2016 | 27 Jan 2018 |
| 897 | septictanksoakaway.net | GoDaddy.com, LLC | 5 Oct 2013 | 10 Oct 2016 | 5 Oct 2016 |
| 898 | septictankinspectors.net | Blacknight Internet Solutions Ltd. | 13 Sep 2011 | 16 Oct 2014 | 13 Sep 2021 |
| 899 | septictankbiotech.net | Cloud Yuqu LLC | 11 Dec 2021 | 11 Dec 2021 | 11 Dec 2022 |
| 900 | septictankpumper.net | GoDaddy.com, LLC | 24 May 2001 | 24 May 2023 | 24 May 2024 |
| 901 | septictankbiofive.net | CV. Rumahweb Indonesia | 19 May 2014 | 28 Jun 2024 | 19 May 2024 |
| 902 | septictankadditives.net | NameCheap, Inc. | 1 Jul 2011 | 1 Jun 2025 | 1 Jul 2026 |
| 903 | septictanktreatmentproducts.net | NameCheap, Inc. | 4 Oct 2011 | 4 Sep 2025 | 4 Oct 2026 |
| 904 | septictankchemicals.net | NameCheap, Inc. | 17 Dec 2010 | 17 Nov 2024 | 17 Dec 2025 |
| 905 | septictankservices.net | GoDaddy.com, LLC | 9 Jun 2009 | 4 Jun 2025 | 9 Jun 2026 |
| 906 | septictankbiotech-biotechseptictank.net | CV. Rumahweb Indonesia | 7 May 2013 | - | 6 May 2018 |
| 907 | septictankwarranty.net | GoDaddy.com, LLC | 7 Jul 2013 | 8 Jul 2016 | 7 Jul 2017 |
| 908 | septictanktreatment.net | NameCheap, Inc. | 19 Apr 2007 | 20 Mar 2025 | 19 Apr 2026 |
| 909 | septictanktreatmentreviews.net | NameCheap, Inc. | 4 Oct 2011 | 4 Sep 2025 | 4 Oct 2026 |
| 910 | septictankaerator.net | Tucows Domains Inc. | 30 Dec 2008 | 30 Nov 2024 | 30 Dec 2025 |
| 911 | septictankpeople.net | GoDaddy.com, LLC | 26 Apr 2013 | 15 Apr 2015 | 26 Apr 2017 |
| 912 | septictank-biofil.net | Cronon AG | 22 Jul 2017 | 22 Jul 2017 | 22 Jul 2018 |
| 913 | septictanksystem.net | Webfusion Ltd. | 19 Oct 2011 | 12 Oct 2019 | 19 Oct 2020 |
| 914 | septictankbio.net | Beijing Lanhai Jiye Technology Co., Ltd | 6 May 2021 | 7 May 2024 | 6 May 2025 |
| 915 | septictankssaintjosephmo.net | Tucows Domains Inc. | 20 Jun 2014 | 31 Jul 2024 | 20 Jun 2024 |
| 916 | septictankinstaller.net | GoDaddy.com, LLC | 14 Jul 2009 | 14 Jul 2025 | 14 Jul 2026 |
| 917 | septictankenzymes.net | NameCheap, Inc. | 17 Dec 2010 | 17 Nov 2024 | 17 Dec 2025 |
| 918 | septictankcertification.net | GoDaddy.com, LLC | 24 May 2001 | 24 May 2016 | 24 May 2017 |
| 919 | septictankinstallation.net | GoDaddy.com, LLC | 20 Feb 2007 | 17 Feb 2025 | 20 Feb 2026 |
| 920 | septictankmiami.net | GMO Internet Inc. | 12 Aug 2024 | 13 Aug 2024 | 12 Aug 2025 |
| 921 | septictankmaintenance.net | GoDaddy.com, LLC | 20 Feb 2007 | 17 Feb 2025 | 20 Feb 2026 |
| 922 | septictankcompany.net | GoDaddy.com, LLC | 29 Dec 2012 | 30 Nov 2024 | 29 Dec 2025 |
| 923 | septictanksolution.net | Wild West Domains, LLC | 22 Feb 2014 | 20 Feb 2015 | 22 Feb 2017 |
| 924 | septictanksdirect.net | GoDaddy.com, LLC | 13 May 2011 | 9 May 2017 | 13 May 2020 |
| 925 | septictankemptyinghereford.net | GoDaddy.com, LLC | 13 May 2011 | 14 May 2015 | 13 May 2017 |
| 926 | septictankpump.net | Tucows Domains Inc. | 3 Apr 2012 | 4 Mar 2025 | 3 Apr 2026 |
| 927 | septictankinspector.net | Blacknight Internet Solutions Ltd. | 13 Sep 2011 | 16 Oct 2014 | 13 Sep 2021 |
| 928 | septictankpumpingcost.net | GoDaddy.com, LLC | 25 Jun 2011 | 6 Aug 2023 | 25 Jun 2023 |
| 929 | septictankbacteria.net | NameCheap, Inc. | 17 Dec 2010 | 17 Nov 2024 | 17 Dec 2025 |
| 930 | septictankcleaner.net | NameCheap, Inc. | 13 Mar 2009 | 11 Feb 2025 | 13 Mar 2026 |
| 931 | septictankcleanerreviews.net | NameCheap, Inc. | 17 Aug 2011 | 18 Jul 2025 | 17 Aug 2026 |
| 932 | septictankpumpingorlando.net | GoDaddy.com, LLC | 8 Dec 2012 | 8 Dec 2015 | 8 Dec 2016 |
| 933 | septictankcovers.net | GoDaddy.com, LLC | 24 Feb 2014 | 25 Feb 2016 | 24 Feb 2017 |
| 934 | septictankadditive.net | NameCheap, Inc. | 12 Aug 2011 | 13 Jul 2025 | 12 Aug 2026 |
| 935 | septictanknewyorkbusinesscards.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 936 | septictankmanhattanflyers.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 937 | septictanknewyorkbrochures.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 938 | septictankmanhattanbusinesscards.info | - | 18 Oct 2016 | 18 Oct 2016 | 18 Oct 2017 |
| 939 | septictanknewyorkflyers.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 940 | septictankmanhattanposters.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 941 | septictanknewyorkenvelopes.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 942 | septictanknewyorkpostcards.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 943 | septictankmanhattanenvelopes.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 944 | septictanknewyorkposters.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 945 | septictankmanhattanbrochures.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 946 | septictankmanhattanpostcards.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 947 | septictankmanhattanletterhead.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 948 | septictanknewyorkletterhead.info | register.com, Inc. | 18 Oct 2016 | 30 Nov 2017 | 18 Oct 2018 |
| 949 | septictanksystem.org | Moniker Online Services LLC | 21 Apr 2010 | 3 Jul 2023 | 21 Apr 2023 |
| 950 | septictankpumping.org | GoDaddy.com, LLC | 18 Nov 2009 | 2 Jan 2025 | 18 Nov 2025 |
| 951 | septictankservice.org | GoDaddy.com, LLC | 25 Aug 2025 | 25 Aug 2025 | 25 Aug 2026 |
| 952 | septictankservices.org | GoDaddy.com, LLC | 9 Jun 2009 | 9 Jun 2025 | 9 Jun 2026 |
| 953 | septictankcleaningmiami.org | GoDaddy.com, LLC | 13 Jul 2012 | 27 Aug 2024 | 13 Jul 2026 |
| 954 | septictankcleaner.org | GoDaddy.com, LLC | 9 Jun 2009 | 9 Jun 2025 | 9 Jun 2026 |
| 955 | septictankrisers.org | GoDaddy.com, LLC | 16 Sep 2011 | 8 Oct 2017 | 16 Sep 2018 |
| 956 | septictankadditives.org | Tucows Domains Inc. | 8 Feb 2012 | 5 Mar 2025 | 8 Feb 2026 |
| 957 | septictankwarranty.org | GoDaddy.com, LLC | 7 Jul 2013 | 16 Dec 2024 | 7 Jul 2025 |
| 958 | septictankprices.info | Blacknight Internet Solutions Ltd. | 22 Oct 2016 | 5 Dec 2017 | 22 Oct 2018 |
| 959 | septictanksdirect.org | GoDaddy.com, LLC | 13 May 2011 | 9 May 2017 | 13 May 2020 |
| 960 | septictankpumped.org | Internet Domain Services BS Corp | 5 Jul 2011 | 29 Aug 2016 | 5 Jul 2017 |
| 961 | septictankemptyinghereford.org | GoDaddy.com, LLC | 13 May 2011 | 9 May 2017 | 13 May 2020 |
| 962 | septictankpeople.org | GoDaddy.com, LLC | 26 Apr 2013 | 27 Apr 2017 | 26 Apr 2019 |
| 963 | septictankcleaning.org | Google, Inc. | 25 May 2022 | 18 Jul 2025 | 25 May 2026 |
| 964 | septictankemptying.org | Mesh Digital Limited | 15 Apr 2015 | 8 Apr 2017 | 15 Apr 2019 |
| 965 | septictankfibreglass.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 May 2012 | 15 Aug 2015 | 31 May 2018 |
| 966 | septictankregistration.org | Tucows Domains Inc. | 27 May 2014 | 19 May 2017 | 27 May 2018 |
| 967 | septictankpro.net | - | 23 Oct 2016 | 23 Oct 2016 | 23 Oct 2017 |
| 968 | septictankservicebirminghamal.xyz | Uniregistrar Corp | 1 Jun 2016 | 23 Sep 2016 | 1 Jun 2017 |
| 969 | septictankmaintenance.xyz | NameCheap, Inc. | 18 Sep 2015 | 26 Sep 2016 | 18 Sep 2017 |
| 970 | septictankemptyingbuckinghamshire.com | eNom, Inc. | 25 Oct 2016 | 3 Oct 2017 | 25 Oct 2018 |
| 971 | septictankpumping.xyz | GoDaddy.com, LLC | 1 Feb 2023 | 13 Apr 2024 | 1 Feb 2024 |
| 972 | septictankservicesnow.xyz | NameCheap, Inc. | 11 Mar 2016 | 30 Mar 2016 | 11 Mar 2017 |
| 973 | septictankcleaninghelp.xyz | NameCheap, Inc. | 11 Mar 2016 | 30 Mar 2016 | 11 Mar 2017 |
| 974 | septictankservicersandsewerpipecleaners.xyz | Uniregistrar Corp | 2 Jun 2016 | 28 Nov 2016 | 2 Jun 2017 |
| 975 | septictankinstallation.xyz | GoDaddy.com, LLC | 13 Jun 2023 | 24 Aug 2024 | 13 Jun 2024 |
| 976 | septictankpumpingservices.xyz | NameCheap, Inc. | 17 Sep 2015 | 26 Sep 2016 | 17 Sep 2017 |
| 977 | septictankprice.xyz | NameCheap, Inc. | 18 Sep 2015 | 26 Sep 2016 | 18 Sep 2017 |
| 978 | septictankservice.xyz | GMO Internet Inc. | 3 Apr 2025 | 10 Apr 2025 | 3 Apr 2026 |
| 979 | septictankguys.xyz | NameCheap, Inc. | 17 Sep 2015 | 26 Sep 2016 | 17 Sep 2017 |
| 980 | septictankcleaningjackson.com | Tucows Domains Inc. | 27 Oct 2016 | 31 Oct 2018 | 27 Oct 2018 |
| 981 | septictanks-somerset.co.uk | - | 13 Jul 2017 | 13 Jul 2017 | 13 Jul 2018 |
| 982 | septictanksbuckinghamshire.co.uk | - | 19 Nov 2010 | 21 Nov 2016 | 19 Nov 2018 |
| 983 | septictankemptynewbury.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 22 Nov 2009 | 20 Nov 2017 | 22 Nov 2019 |
| 984 | septictankmaintenance.co.uk | - | 29 Oct 2023 | 26 Jan 2025 | 29 Oct 2025 |
| 985 | septictankbiotech-stpbiotech.net | CV. Rumahweb Indonesia | 7 May 2013 | - | 6 May 2018 |
| 986 | septictankservices.xyz | Porkbun, LLC | 2 Oct 2024 | 14 Oct 2025 | 2 Oct 2026 |
| 987 | septictankpumping.net | NameCheap, Inc. | 7 Jun 2024 | 8 May 2025 | 7 Jun 2026 |
| 988 | septictankscumbria.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Nov 2016 | 14 Dec 2017 | 7 Nov 2018 |
| 989 | septictankscumbria.ltd | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Nov 2016 | 18 Dec 2017 | 7 Nov 2018 |
| 990 | septictankservices.ltd | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2016 | 21 Nov 2017 | 14 Nov 2018 |
| 991 | septictankservice.ltd | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2016 | 22 Nov 2017 | 14 Nov 2018 |
| 992 | septictankrepair.org | Realtime Register B.V. | 17 Nov 2016 | 15 Oct 2017 | 17 Nov 2018 |
| 993 | septictanks.store | GoDaddy.com, LLC | 22 Nov 2016 | 4 Dec 2017 | 22 Nov 2018 |
| 994 | septictanks.biz | GoDaddy.com, LLC | 22 Nov 2016 | 8 Dec 2017 | 21 Nov 2018 |
| 995 | septictankpumpingusa.com | Porkbun, LLC | 30 Jan 2024 | 28 Jan 2025 | 30 Jan 2026 |
| 996 | septictankcleaningservice.net | Tucows Domains Inc. | 28 Nov 2016 | 2 Dec 2017 | 28 Nov 2017 |
| 997 | septictankcleaningservice.org | Tucows Domains Inc. | 1 Dec 2016 | 5 Dec 2017 | 1 Dec 2018 |
| 998 | septictanksreading.com | eNom, Inc. | 2 Dec 2016 | 6 Dec 2017 | 2 Dec 2017 |
| 999 | septictanks.ltd | GoDaddy.com, LLC | 17 Apr 2025 | 22 Apr 2025 | 17 Apr 2026 |
| 1000 | septictankpumpingontariocali.com | Namesilo, LLC | 3 Dec 2016 | 3 Dec 2017 | 3 Dec 2017 |
Displaying 1,000 out of 2,551 domains starting with the keyword "SEPTICTANK". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=septictank
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |