Our database now contains whois records of 634 Million (634,867,686) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [634 Million Domains] $10,000 Details

Keyword: SEPTIC

Reverse Whois » KEYWORD [septic ]  { 9,528 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1septic.coDynadot, LLC23 Jul 201020 Aug 202522 Jul 2026
2septic.expertNamesilo, LLC26 Jun 202324 Aug 202526 Jun 2026
3septic.suppliesGoDaddy.com, LLC25 Aug 20143 Nov 202025 Aug 2021
4septic.companyDynadot, LLC17 Sep 202228 Jan 202417 Sep 2025
5septic.supplyNameKing.com Inc.31 May 20247 May 202531 May 2026
6septic.constructionGoDaddy.com, LLC6 Dec 202428 May 20256 Dec 2025
7septic.moscowLimited Liability Company "Registrar of domain nam…1 Dec 201416 Nov 20241 Dec 2025
8septic.linkTucows Domains Inc.9 Dec 20147 Dec 20169 Dec 2017
9septic.helpGoDaddy.com, LLC7 Dec 201421 Jan 20177 Dec 2017
10septic.softwareGoDaddy.com, LLC27 Sep 201727 Sep 201727 Sep 2018
11septic.property101domain, Inc.6 Feb 2015-6 Feb 2016
12septic.workTucows Domains Inc.19 Mar 20249 Mar 202519 Mar 2026
13septic.casa101domain, Inc.10 Feb 201510 Feb 201510 Feb 2016
14septic.plumbingGoDaddy.com, LLC27 Apr 20181 Aug 202427 Apr 2026
15septic.land101domain, Inc.23 Feb 20146 Mar 201523 Feb 2016
16septic.ninjaGoDaddy.com, LLC3 Apr 201515 May 20253 Apr 2025
17septic.servicesGoDaddy.com, LLC18 Nov 20162 Jan 202518 Nov 2026
18septic.clubRegional Network Information Center, JSC dba RU-CE…8 Apr 201513 Apr 20257 Apr 2026
19septic.house101domain, Inc.9 Apr 20142 May 20159 Apr 2016
20septic.worksGoDaddy.com, LLC5 May 201516 Jul 20175 May 2017
21septic.designGoDaddy.com, LLC2 Dec 202223 Jul 20242 Dec 2025
22septic.bioPorkbun, LLC9 Sep 201518 Aug 20259 Sep 2026
23septic.newsRegional Network Information Center, JSC dba RU-CE…17 Sep 201518 Sep 201517 Sep 2016
24septic.forsaleEpik Inc.21 Jan 20154 Feb 201621 Jan 2017
25septic.siteMesh Digital Limited24 Jan 202024 Apr 202524 Jan 2026
26septic.topNamesilo, LLC12 Apr 202412 Apr 202412 Apr 2026
27septic.comDynadot, LLC28 Nov 199512 May 202527 Nov 2031
28septic.solutionsGoDaddy.com, LLC26 Mar 202411 Oct 202426 Mar 2026
29septic.directGoDaddy.com, LLC2 Apr 201617 May 20172 Apr 2018
30septic.onlineMesh Digital Limited24 Jan 202024 Apr 202524 Jan 2026
31septic.guruGoDaddy.com, LLC4 Jan 201816 Mar 20244 Jan 2024
32septic.systemsGoDaddy.com, LLC8 Dec 202322 Jan 20258 Dec 2025
33septic.durbanInstra Corporation Pty Ltd.4 Nov 201414 Jul 20164 Nov 2016
34septic.joburgInstra Corporation Pty Ltd.4 Nov 201414 Jul 20164 Nov 2016
35septic.repairGoDaddy.com, LLC2 Apr 201416 Apr 20252 Apr 2026
36septic.cleaningGoDaddy.com, LLC18 Jun 201412 May 202518 Jun 2026
37septic.bizGoogle, Inc.13 Mar 20234 Apr 202313 Mar 2024
38septic.centerGoDaddy.com, LLC9 Aug 201623 Sep 20249 Aug 2026
39septic.oneGoDaddy.com, LLC9 Aug 201623 Aug 20259 Aug 2025
40septic.storeGoDaddy.com, LLC9 Aug 201614 Aug 20259 Aug 2026
41septic.infoGoDaddy.com, LLC9 Dec 20109 Dec 20249 Dec 2025
42septic.mobiGoDaddy.com, LLC28 Feb 201125 May 201228 Feb 2021
43septic.orgGoDaddy.com, LLC10 Aug 200417 Jul 202410 Aug 2026
44septic.usFastDomain Inc.16 Jul 200916 Jul 201715 Jul 2018
45septic.techAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Feb 20191 Mar 20252 Feb 2026
46septic.xyz-27 Oct 20201 Feb 202527 Oct 2026
47septic.world-6 Feb 202421 Mar 20256 Feb 2025
48septic.express-17 May 202430 Jun 202517 May 2025
49septic.co.uk-13 May 201410 May 202513 May 2026
50septic.org.uk-17 Oct 20054 Oct 202417 Oct 2025
51septic.marketRegional Network Information Center, JSC dba RU-CE…4 Aug 20193 Aug 20254 Aug 2026
52septic.tipsGoDaddy.com, LLC27 Mar 201811 May 202527 Mar 2026
53septic.todayGoDaddy.com, LLC27 Apr 20181 Aug 202427 Apr 2026
54septic.reportMelbourne IT, Ltd25 Jul 201825 Jul 201825 Jul 2019
55septic.cityRegtime Ltd.30 Sep 201830 Sep 201830 Sep 2019
56septic.businessNamesilo, LLC18 Dec 201819 Feb 202518 Dec 2024
57septic.plusChengdu West Dimension Digital Technology Co., Ltd…27 Sep 202320 Dec 202427 Sep 2025
58septic.ltdNameCheap, Inc.1 Apr 20206 Apr 20201 Apr 2021
59septic.groupRegional Network Information Center, JSC dba RU-CE…16 Apr 202029 Mar 202516 Apr 2026
60septic.proNameCheap, Inc.17 Jul 200917 Jun 202517 Jul 2026
61septic.partsGoDaddy.com, LLC3 Jun 202015 Jul 20243 Jun 2024
62septic.homesGlobal Domains International, Inc. DBA DomainCostC…8 Sep 20197 Nov 20198 Sep 2020
63septic.contractorsNamesilo, LLC26 Jun 202324 Aug 202526 Jun 2026
64septic.icuNameCheap, Inc.25 Feb 202110 Apr 202525 Feb 2025
65septic.websiteGoogle, Inc.3 Feb 20235 Mar 20243 Feb 2024
66septic.lifeCommuniGal Communication Ltd.--28 Aug 2025
67septic.fansGoogle, Inc.25 Sep 202131 Aug 202325 Sep 2024
68septic.spaceLimited Liability Company "Registrar of domain nam…13 Feb 202213 Feb 202213 Feb 2023
69septic.ru.comNameKing.com Inc.13 Mar 202218 Mar 202213 Mar 2023
70septic.appGoogle, Inc.23 Aug 202213 Aug 202523 Aug 2026
71septic.reviews-4 Nov 20234 Nov 20234 Nov 2024
72septic.bidNameCheap, Inc.6 Dec 201622 Nov 20235 Dec 2028
73septic.be-19 Jun 2014--
74septic.blogTucows Domains Inc.10 Nov 201810 Dec 202410 Nov 2025
75septic.by-28 Mar 201117 Mar 20256 Apr 2026
76septic.md-21 Aug 2017-21 Aug 2026
77septic.com.pl-5 May 20188 May 20255 May 2026
78septic.llcGoDaddy.com, LLC9 Jul 201814 Jun 20259 Jul 2026
79septic.it-11 Apr 201020 May 20254 May 2026
80septic.liveNameKing.com Inc.8 Jun 202513 Jun 20258 Jun 2026
81septic.meGoDaddy.com, LLC12 Jan 201126 Feb 202512 Jan 2026
82septic.netPDR Ltd. d/b/a PublicDomainRegistry.com10 Jun 20013 Jun 202510 Jun 2026
83septic.cloudChengdu West Dimension Digital Technology Co., Ltd…6 Jul 20246 Jul 20256 Jul 2026
84septic.engineerNamesilo, LLC26 Jun 202324 Aug 202526 Jun 2026
85septic.winHosting Ukraine LLC28 Jan 20252 Feb 202528 Jan 2026
86septic.telName.com, Inc.18 Aug 202311 Aug 202518 Aug 2026
87septic.lol-17 Dec 202430 May 202517 Dec 2025
88septic.careName.com, Inc.28 Nov 202322 Dec 202428 Nov 2024
89septic.io-11 Mar 201825 Apr 202511 Mar 2026
90septic.nl-26 Jan 200711 Jun 2025-
91septic.ru-22 May 2001-24 May 2026
92septic.sk-3 Apr 201616 Jun 202530 May 2026
93septic.se-28 Dec 200816 Dec 202428 Dec 2025
94septic.shopXiamen ChinaSource Internet Service Co., Ltd.18 May 202411 Jul 202418 May 2025
95septic.eu----
96septic.com.au--9 Jul 2025-
97septic.inDynadot, LLC31 Jan 201422 Jul 202531 Jan 2026
98septic.aiNameCheap, Inc.29 Jul 20253 Aug 202529 Jul 2027
99septic.greenGoDaddy.com, LLC11 Sep 202416 Sep 202411 Sep 2025
100septic.de--8 Oct 2013-
101septic.schoolNameCheap, Inc.21 Nov 202426 Nov 202421 Nov 2025
102septic.partnersGoogle, Inc.16 Jan 20253 Jun 202516 Jan 2026
103septic.ie-5 Oct 20112 Nov 20246 Oct 2025
104septic.ccDynadot, LLC1 Apr 20251 Apr 20251 Apr 2026
105septic.cn-29 Dec 2024-29 Dec 2025
106septic.marketingNameCheap, Inc.5 Mar 2025-5 Mar 2026
107septic.doctorGoogle, Inc.7 May 20253 Jun 20257 May 2026
108septic.cfdNamesilo, LLC24 May 202510 Jun 202524 May 2026
109septic.rocksNameCheap, Inc.24 Jun 2025-24 Jun 2026
110septic.earthNameCheap, Inc.29 Jul 202529 Jul 202529 Jul 2026
111septictankbiofit.comCV. Rumahweb Indonesia28 Jun 20119 Aug 202427 Jun 2027
112septicarthritis.bizGMO Internet Inc.21 Oct 2014-20 Oct 2015
113septicscompanion.comGoDaddy.com, LLC8 Oct 20089 Oct 20238 Oct 2028
114septic-dks.ru-3 Apr 2009-3 Apr 2026
115septic-s.ru-15 Jul 2025-15 Jul 2026
116septick.ru-11 Nov 2009-11 Nov 2025
117septictanksga.comeNom, Inc.23 Oct 20145 Dec 202423 Oct 2024
118septicsystemcalgary.comGoDaddy.com, LLC27 May 201027 May 201527 May 2016
119septicsystemscalgary.comGoDaddy.com, LLC27 May 20107 Aug 202527 May 2025
120septicfieldcalgary.comGoDaddy.com, LLC27 May 201027 May 201527 May 2016
121septicfieldscalgary.comGoDaddy.com, LLC27 May 201027 May 201527 May 2016
122septiccalgary.comGoDaddy.com, LLC27 May 201027 May 201527 May 2016
123septicseo.netGoDaddy.com, LLC27 May 201428 May 201527 May 2016
124septicseo.orgGoDaddy.com, LLC27 May 20148 Jun 201527 May 2016
125septiclasvegas.comGoDaddy.com, LLC15 Mar 202316 Mar 202515 Mar 2026
126septic911.netGoDaddy.com, LLC28 May 201429 May 201528 May 2016
127septictankbio.orgPDR Ltd. d/b/a PublicDomainRegistry.com24 Oct 201424 Oct 201424 Oct 2015
128septicemiainfection.comGoDaddy.com, LLC9 Jun 20159 Jun 20159 Jun 2016
129septicscience.comMelbourne IT, Ltd8 Sep 202129 Nov 20248 Sep 2025
130septickansascity.comGoDaddy.com, LLC31 Jul 201915 Aug 202531 Jul 2026
131septiclid.comGoDaddy.com, LLC3 Jun 20084 Jun 20153 Jun 2016
132septiccover.comDNC Holdings, Inc.16 Jun 202226 May 202516 Jun 2026
133septicemic.comGoDaddy.com, LLC4 Jan 20155 Jan 20254 Jan 2026
134septicwizard.comGoDaddy.com, LLC5 Mar 200421 May 20255 Mar 2026
135septiccertification.comGoDaddy.com, LLC15 Oct 201516 Oct 202415 Oct 2025
136septicinspection.comeNom, Inc.29 Nov 200122 Nov 202429 Nov 2025
137septiclandscaping.comeNom, Inc.28 Aug 201221 Dec 201628 Aug 2017
138septicspecialist.comAnnulet LLC25 Jan 202314 Mar 202525 Jan 2026
139septiccentral.comGoDaddy.com, LLC22 Feb 202123 Feb 202522 Feb 2026
140septicservicefranklin.comNameCheap, Inc.28 Oct 201428 Sep 202428 Oct 2025
141septicwounds.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
142septicodor.comTurnCommerce, Inc. DBA NameBright.com12 Mar 201624 May 202412 Mar 2024
143septicsmell.comDreamHost, LLC16 Dec 202114 Nov 202416 Dec 2025
144septicsponge.comTierraNet Inc. d/b/a DomainDiscover5 Dec 200610 Nov 20145 Dec 2015
145septicsystemaerator.comTierraNet Inc. d/b/a DomainDiscover11 Sep 200530 Aug 201411 Sep 2015
146septictankaerator.comDynadot, LLC25 Jan 202025 Jan 202025 Jan 2021
147septictankfilter.comGoDaddy.com, LLC18 Nov 201512 May 202511 May 2026
148septictankodor.comNameCheap, Inc.23 Sep 201524 Aug 202423 Sep 2025
149septictankproblem.comP.A. Viet Nam Company Limited25 Jan 202325 Jan 202325 Jan 2024
150septicventfilter.com----
151septicventfilters.comTierraNet Inc. d/b/a DomainDiscover28 May 200429 May 201528 May 2016
152septicventpipefilter.com----
153septictanksusa.comGoDaddy.com, LLC21 Feb 201822 Feb 201921 Feb 2020
154septicatlanta.comNameCheap, Inc.29 Jun 202529 Jun 202529 Jun 2026
155septicadvisor.comGoDaddy.com, LLC24 Feb 20187 Mar 202524 Feb 2029
156septicdoctor.comDynadot, LLC10 Jul 20118 Jul 202510 Jul 2026
157septicdoctors.com-24 May 202318 May 202524 May 2026
158septiclife.comTurnCommerce, Inc. DBA NameBright.com17 Jul 201611 Jul 202017 Jul 2025
159septichouse.comeNom, Inc.14 Mar 20148 Mar 201714 Mar 2018
160septictankservices.comGoDaddy.com, LLC8 Jun 20059 Jun 20258 Jun 2026
161septicservicegallatintn.comLaunchpad, Inc.29 Oct 201429 Oct 201429 Oct 2015
162septictankindia.comGoDaddy.com, LLC26 Mar 20146 Mar 202526 Mar 2026
163septicsystemnj.comGoDaddy.com, LLC31 Mar 201212 May 202531 Mar 2025
164septicsupplier.comGoDaddy.com, LLC13 Jul 202513 Jul 202513 Jul 2026
165septic-tanks.mobiGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
166septictankplumbing.com-15 Apr 201416 May 202515 Apr 2026
167septictanktoilet.comCV. Rumahweb Indonesia31 Oct 2014-31 Oct 2017
168septicsolutions1.comregister.com, Inc.31 Oct 20145 Apr 201731 Oct 2020
169septictankpumping.ca-12 Jan 200410 Jan 202512 Jan 2026
170septicairaid.comFastDomain Inc.6 May 201120 Apr 20256 May 2026
171septictanksforsale.comTucows Domains Inc.24 Jan 201725 Dec 202424 Jan 2026
172septicleanse.comDNC Holdings, Inc.4 Jan 201210 Jan 20234 Jan 2026
173septicyellowpages.comPDR Ltd. d/b/a PublicDomainRegistry.com11 May 200030 May 202511 May 2026
174septictankodors.comNameCheap, Inc.7 Dec 20077 Nov 20247 Dec 2025
175septicbomb.comGoDaddy.com, LLC6 Jul 20256 Jul 20256 Jul 2026
176septicsystems.infoNameCheap, Inc.30 Mar 202228 Feb 202530 Mar 2026
177septicsystemfix.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Oct 200929 Nov 202423 Oct 2025
178septictankrepair911.orgPDR Ltd. d/b/a PublicDomainRegistry.com31 Oct 201431 Oct 201431 Oct 2015
179septicrepair911.orgPDR Ltd. d/b/a PublicDomainRegistry.com31 Oct 201431 Oct 201431 Oct 2015
180septicdesign.comTucows Domains Inc.2 Feb 200026 Jan 20252 Feb 2027
181septicdesignservices.comTucows Domains Inc.17 Mar 200910 Mar 202517 Mar 2026
182septictankshoustontx.comeNom, Inc.7 Aug 20139 Jul 20157 Aug 2016
183septichelper2000.comNetwork Solutions, LLC28 Dec 200428 Oct 202428 Dec 2025
184septicaeration.comGoDaddy.com, LLC16 Aug 202416 Aug 202416 Aug 2034
185septictankalarm.comTucows Domains Inc.10 Jul 200910 Jun 202510 Jul 2026
186septicsolution.comGoDaddy.com, LLC12 Sep 200213 Sep 202412 Sep 2025
187septicgopro.comTucows Domains Inc.25 Jan 201823 Jan 202525 Jan 2026
188septicforyou.comRegister NV dba Register.eu1 Nov 20141 Nov 20141 Nov 2015
189septichelp.orgGoDaddy.com, LLC30 Jan 201214 Mar 201730 Jan 2018
190septicsavior.comGoDaddy.com, LLC4 Sep 20055 Sep 20244 Sep 2026
191septicking.comTurnCommerce, Inc. DBA NameBright.com9 Jul 20153 Jul 20209 Jul 2026
192septics.coGoDaddy.com, LLC9 Feb 20156 Jul 20158 Feb 2016
193septicdreams.comKey-Systems GmbH4 Sep 20216 Sep 20214 Sep 2022
194septicservices.netGoDaddy.com, LLC18 Jan 20233 May 202518 Jan 2026
195septicsolutions.comGoDaddy.com, LLC14 Nov 20038 Nov 202414 Nov 2029
196septic-tank-maintenance.netNameCheap, Inc.28 Feb 201129 Jan 202528 Feb 2026
197septictankcare.netNameCheap, Inc.28 May 201028 Apr 202528 May 2026
198septictankparts.comeNom, Inc.15 May 20072 May 202315 May 2026
199septic-1.comNetwork Solutions, LLC29 Apr 200317 Apr 202429 Apr 2029
200septicsystemexperts.comCloudFlare, Inc.13 Mar 202520 Mar 202513 Mar 2026
201septiccare.com.auTPP Wholesale Pty Ltd.-21 Nov 2013-
202septicsnooper.comDropCatch.com 493 LLC23 Jul 202523 Jul 202523 Jul 2026
203septic-problems-fixed.comGoDaddy.com, LLC23 Oct 200916 Oct 201323 Oct 2015
204septictankemptyingswansea.comGoDaddy.com, LLC11 Jun 201112 Jun 201511 Jun 2016
205septicdrainer.comGoDaddy.com, LLC22 Jan 200919 Dec 202422 Jan 2026
206septictankemptyingoxfordshire.comDropFall.com, Inc.13 Jan 202213 Jan 202213 Jan 2023
207septicsystemsaver.netTucows Domains Inc.9 Oct 200924 Sep 20249 Oct 2025
208septicservicewillcox.comGoDaddy.com, LLC11 Jun 201312 Jun 201511 Jun 2016
209septictankemptyingcwmbran.comGoDaddy.com, LLC11 Jun 201112 Jun 201511 Jun 2016
210septictankemptyingbristol.comGoDaddy.com, LLC11 Jun 201112 Jun 201511 Jun 2016
211septictankfixer.comGoDaddy.com, LLC16 Oct 201011 Dec 202410 Dec 2025
212septiccovers.comTucows Domains Inc.9 Jan 200910 Dec 20249 Jan 2026
213septicpreservationri.comregister.com, Inc.13 Oct 200917 Aug 202313 Oct 2025
214septicflushsolutions.com-19 Oct 201619 Oct 201619 Oct 2017
215septicsense.comeNom, Inc.16 May 200026 May 202516 May 2026
216septicaerator.comGoDaddy.com, LLC12 Jan 200512 Jan 202512 Jan 2027
217septicshark.comGoDaddy.com, LLC27 Sep 201128 Sep 202427 Sep 2025
218septicsystem.comDynadot, LLC1 Aug 19982 Sep 202431 Jul 2027
219septicprotector.comGoDaddy.com, LLC28 Apr 19971 Jul 202529 Apr 2026
220septicgenie.comGoDaddy.com, LLC1 Feb 20059 Sep 20241 Feb 2026
221septicsolutionstexas.comGoDaddy.com, LLC8 Oct 20039 Oct 20248 Oct 2025
222septicsolutions.netGoDaddy.com, LLC9 Apr 200210 Apr 20259 Apr 2026
223septicsystemsakron.comGoDaddy.com, LLC14 Jun 201215 Jun 201514 Jun 2016
224septictankseverett.comGoDaddy.com, LLC14 Jun 201215 Jun 201514 Jun 2016
225septictankemptyingherefordshire.comGoDaddy.com, LLC14 Jun 201115 Jun 201514 Jun 2016
226septictankmankent.comGoDaddy.com, LLC14 Jun 201115 Jun 201514 Jun 2016
227septicyank.comGoDaddy.com, LLC5 Jan 200727 Jun 201516 Jun 2016
228septictanksmetropolisil.comGoDaddy.com, LLC16 Jun 201417 Jun 201516 Jun 2016
229septicstratford.comHebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.…18 Aug 201418 Aug 201418 Aug 2015
230septicdoc.comGoDaddy.com, LLC20 Dec 201521 Dec 202420 Dec 2025
231septicqueen.comGoDaddy.com, LLC31 Jul 202531 Jul 202531 Jul 2028
232septictankpumpinginsavannahga.comGoDaddy.com, LLC26 Sep 202426 Sep 202426 Sep 2025
233septictankcleaningomaha.comGoDaddy.com, LLC6 Nov 20147 Nov 20166 Nov 2018
234septicsystemsmartin.comeNom, Inc.6 Nov 20145 Oct 20156 Nov 2016
235septicservices-ga.comregister.com, Inc.6 Nov 20146 Nov 20146 Nov 2015
236septicliftstations.comGoogle, Inc.20 Jun 201720 Jun 201720 Jun 2018
237septictankpumpingatlanta.neteNom, Inc.25 May 201625 May 201625 May 2017
238septicsystemservicesgeorgetown.comeNom, Inc.21 Aug 201421 Aug 201421 Aug 2015
239septicexpress.netDynadot, LLC6 Mar 202016 May 20246 Mar 2024
240septicinstallationoklahomacityok.comeNom, Inc.6 Feb 20156 Feb 20156 Feb 2016
241septictankinstallationasheville.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2016
242septictankfibreglass.comWest263 International Limited7 Oct 20207 Oct 20207 Oct 2021
243septicareclock.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2015
244septicpartsstore.comGoDaddy.com, LLC3 Jun 202015 Jul 20243 Jun 2024
245septicpartssupply.comTucows Domains Inc.28 Feb 20154 Mar 201828 Feb 2018
246septictankemptyingscotland.comMesh Digital Limited7 Mar 202220 Apr 20237 Mar 2023
247septicsystemcumming.comName.com, Inc.22 Aug 201422 Aug 201422 Aug 2015
248septicsystemsgentry.comGoDaddy.com, LLC22 Aug 201422 Aug 201422 Aug 2015
249septictankandexcavationservices.comTucows Domains Inc.19 Aug 201122 Aug 201419 Aug 2015
250septicprocleaning.netGoDaddy.com, LLC14 Apr 201514 Apr 201514 Apr 2016
251septictankcleaners.netRebel.com Corp.12 Nov 201525 Sep 201712 Nov 2018
252septictankemptyingnorfolk.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Jan 201627 Jan 202526 Jan 2026
253septicpumpinginacton.comTucows Domains Inc.9 Aug 201112 Aug 20149 Aug 2015
254septicservicesgrassvalley.comeNom, Inc.12 Aug 201412 Aug 201412 Aug 2015
255septicdrainfields.comDNC Holdings, Inc.13 Aug 201420 Aug 202513 Aug 2026
256septicsysteminstallsnewmilford.comeNom, Inc.13 Aug 201430 Aug 201613 Aug 2017
257septicsystemserviceswyoming.comNameCheap, Inc.13 Aug 201415 Jul 201913 Aug 2020
258septichinspection.comGoDaddy.com, LLC6 Nov 20201 Nov 20236 Nov 2025
259septicpumpingmarionoh.comTLDs LLC dba SRSplus26 Aug 201431 Mar 201726 Aug 2017
260septictankpumpingorlando.comGoDaddy.com, LLC12 Mar 201924 May 202412 Mar 2024
261septictankserviceopelikaal.comLaunchpad, Inc.26 Aug 201426 Aug 201426 Aug 2015
262septicguardwarranty.comGoDaddy.com, LLC27 Aug 201428 Aug 201627 Aug 2017
263septicpumpersonline.comGoDaddy.com, LLC27 Aug 201415 Aug 202427 Aug 2025
264septicservicesonline.comGoDaddy.com, LLC27 Aug 201419 Aug 202527 Aug 2026
265septictank-system.comGoDaddy.com, LLC10 Nov 20148 Nov 201610 Nov 2017
266septictankssouthwales.comMesh Digital Limited15 Aug 201415 Aug 201415 Aug 2015
267septictankemptyingsouthwales.comMesh Digital Limited28 Aug 201428 Aug 201428 Aug 2015
268septictankinstallationsouthwales.comMesh Digital Limited28 Aug 201428 Aug 201428 Aug 2015
269septictankservicescumbria.comMesh Digital Limited11 Nov 201431 Oct 201711 Nov 2018
270septictankscumbria.comCSL Computer Service Langenbach GmbH d/b/a joker.c…11 Nov 201423 Jun 202411 Nov 2025
271septictankcleaningcumbria.comMesh Digital Limited11 Nov 201431 Oct 201711 Nov 2018
272septicmanagementny.comGoDaddy.com, LLC12 Nov 201412 Nov 202412 Nov 2025
273septic-emergency.com-22 Jul 201622 Jul 201622 Jul 2017
274septicservicemiami.comName.com, Inc.7 Nov 201716 Oct 20247 Nov 2025
275septictankjacksonville.comGoDaddy.com, LLC12 Sep 201412 Sep 202412 Sep 2025
276septicssouthjersey.comregister.com, Inc.12 Sep 201412 Sep 201412 Sep 2015
277septictankremediation.comTierraNet Inc. d/b/a DomainDiscover30 Aug 201430 Aug 201430 Aug 2015
278septico.bizPDR Ltd. d/b/a PublicDomainRegistry.com14 Nov 201414 Nov 201713 Nov 2017
279septicpumpingnow.comGoDaddy.com, LLC24 Jul 202025 Jul 202524 Jul 2026
280septicbusinesssoftware.comNameCheap, Inc.15 Jan 202528 Mar 202515 Jan 2026
281septictanksmonroecounty.comGoDaddy.com, LLC16 Sep 201416 Sep 201416 Sep 2015
282septictanksrandolphcounty.comGoDaddy.com, LLC16 Sep 201416 Sep 201416 Sep 2015
283septictanksstclaircounty.comGoDaddy.com, LLC16 Sep 201416 Sep 201416 Sep 2015
284septiccleaningoverlandpark.comeNom, Inc.2 Sep 20145 Sep 20172 Sep 2017
285septicsystemcertification.comGoDaddy.com, LLC2 Sep 20142 Sep 20142 Sep 2015
286septictankterbaik.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Sep 20142 Sep 20142 Sep 2015
287septicpumpingchatsworth.comGoDaddy.com, LLC15 Sep 20142 Sep 202415 Sep 2025
288septicpumpingmalibu.comGoDaddy.com, LLC15 Sep 20142 Sep 202415 Sep 2025
289septicpumpingpalosverdes.comGoDaddy.com, LLC15 Sep 20142 Sep 202415 Sep 2025
290septicpumpingtopanga.comGoDaddy.com, LLC15 Sep 20142 Sep 202415 Sep 2025
291septictankpumpinginfo.comWild West Domains, LLC16 Nov 201416 Nov 201416 Nov 2015
292septico.orgPDR Ltd. d/b/a PublicDomainRegistry.com14 Nov 20142 Nov 201614 Nov 2017
293septicinspectionwa.comTucows Domains Inc.1 Sep 20104 Sep 20141 Sep 2015
294septicinspectionwa.netTucows Domains Inc.1 Sep 20104 Sep 20141 Sep 2015
295septicsystemsmanitowoc.comTucows Domains Inc.1 Sep 20104 Sep 20141 Sep 2015
296septicservicescorona.comGoDaddy.com, LLC18 Sep 201418 Sep 201418 Sep 2015
297septicairaid.netDynadot, LLC2 Oct 20152 Oct 20152 Oct 2016
298septictankservicesbreckenridge.comeNom, Inc.5 Sep 20145 Sep 20145 Sep 2015
299septictankpumpingresults.comGoDaddy.com, LLC17 Nov 201413 Nov 201617 Nov 2017
300septictanksatlantaga.comName.com, Inc.19 Sep 201416 Oct 201619 Sep 2017
301septicservicesmaryville.comeNom, Inc.19 Sep 201419 Sep 201419 Sep 2015
302septictankinspectioncapecod.comEranet International Limited4 Apr 20254 Apr 20254 Apr 2026
303septicsystemscleaningnewbern.comeNom, Inc.18 Nov 201418 Nov 201418 Nov 2015
304septicagroup.comregister.com, Inc.18 Nov 201418 Nov 201418 Nov 2015
305septic-co.comGoDaddy.com, LLC19 Nov 201419 Nov 201419 Nov 2015
306septictank-fibreglass.comCV. Rumahweb Indonesia8 Sep 20148 Sep 20148 Sep 2015
307septictankcleaningtraversecity.comWild West Domains, LLC8 Sep 20149 Sep 20248 Sep 2025
308septictrenches.com-9 Sep 20149 Sep 20149 Sep 2017
309septictrenches.net-9 Sep 20149 Sep 20149 Sep 2017
310septicsystemsportcharlotte.comeNom, Inc.19 Nov 201419 Nov 201419 Nov 2015
311septicrepairdelmarva.comGoDaddy.com, LLC3 Oct 201412 Sep 20163 Oct 2017
312septic-tankdepot.comTucows Domains Inc.29 Sep 20093 Oct 201429 Sep 2015
313septicsystemsgrantspass.comNameCheap, Inc.2 Oct 20142 Sep 20242 Oct 2025
314septicsbyjohnson.comTucows Domains Inc.21 Nov 20141 Jan 202421 Nov 2023
315septicservicesalemil.comHosting Concepts B.V. dba Openprovider16 Jan 201816 Jan 201816 Jan 2019
316septiccleaningwappingersfalls.comeNom, Inc.22 Sep 201422 Sep 201422 Sep 2015
317septictankemptying.netWebfusion Ltd.15 Apr 20158 Apr 201715 Apr 2019
318septicservicesmissoula.comeNom, Inc.23 Sep 201423 Sep 201423 Sep 2015
319septicserviceswa.comeNom, Inc.23 Sep 201423 Sep 201423 Sep 2015
320septicservices-wa.comeNom, Inc.23 Sep 201423 Sep 201423 Sep 2015
321septicsystemsminocqua.comTucows Domains Inc.18 Nov 201322 Nov 201418 Nov 2015
322septictanksemptiedpenrith.comMesh Digital Limited24 Sep 201429 Sep 201924 Sep 2019
323septictanksinpenrith.comMesh Digital Limited24 Sep 201429 Sep 201924 Sep 2019
324septictankemptyingpenrith.comMesh Digital Limited24 Sep 201429 Aug 201824 Sep 2019
325septictankcleaningpenrith.comMesh Digital Limited24 Sep 201429 Aug 201824 Sep 2019
326septicservicespriorlakemn.comWild West Domains, LLC8 Oct 20149 Oct 20248 Oct 2025
327septictankservice.netGoDaddy.com, LLC8 Apr 20258 Apr 20258 Apr 2026
328septictanksoakawayworms.comGoDaddy.com, LLC24 Feb 202024 Feb 202024 Feb 2021
329septicsystemsgrantpass.comNameCheap, Inc.29 Sep 201429 Aug 201829 Sep 2019
330septic360.neteNom, Inc.21 Nov 201421 Nov 201421 Nov 2015
331septicsystemcontractorsstjoseph.comeNom, Inc.10 Oct 201410 Oct 201410 Oct 2015
332septicsystemservice.comTurnCommerce, Inc. DBA NameBright.com27 Jul 201711 Jul 202527 Jul 2026
333septictankbacteriapackets.comGoDaddy.com, LLC10 Oct 201411 Oct 201610 Oct 2017
334septictankserviceschilo.comGoDaddy.com, LLC10 Oct 201410 Oct 201410 Oct 2015
335septictanktreatment.orgNameCheap, Inc.5 Apr 202216 Jun 20245 Apr 2024
336septicserviceaustin.comName.com, Inc.7 Nov 201716 Oct 20247 Nov 2025
337septicmatters.comGoDaddy.com, LLC4 May 20224 May 20254 May 2026
338septictankemptying.bizTucows Domains Inc.14 Oct 201217 Oct 201413 Oct 2014
339septicservicetx.comName.com, Inc.29 Jan 202113 Apr 202429 Jan 2024
340septictankerservices.com----
341septictankbiotech.bizGMO Internet Inc.15 Oct 201415 Oct 201414 Oct 2015
342septictankcontractors.comDropCatch.com 1408 LLC15 Feb 201815 Feb 201815 Feb 2019
343septicbay.comLaunchpad, Inc.1 Dec 20141 Dec 20141 Dec 2015
344septicsecurity.comTurnCommerce, Inc. DBA NameBright.com15 Feb 20159 Feb 202115 Feb 2026
345septicas.comDinahosting s.l.3 Dec 201426 Nov 20243 Dec 2025
346septicsystemsmaui.comGoDaddy.com, LLC4 Dec 201430 Sep 202215 Nov 2026
347septictank-depot.comTucows Domains Inc.3 Dec 20087 Dec 20143 Dec 2015
348septicfriendlytoiletpaper.comGoDaddy.com, LLC6 Dec 20147 Dec 20146 Dec 2015
349septicdesignnh.comNameCheap, Inc.25 Aug 202326 Jul 202525 Aug 2026
350septicdesignnewhampshire.comTucows Domains Inc.3 Dec 20097 Dec 20143 Dec 2015
351septic-cleaning.comGoDaddy.com, LLC8 Jan 20189 Jan 20258 Jan 2026
352septicisle.comTurnCommerce, Inc. DBA NameBright.com7 Dec 201426 Aug 20217 Dec 2025
353septicservicesoftware.comGoDaddy.com, LLC8 Dec 201423 Oct 20248 Dec 2025
354septicstar.comGoDaddy.com, LLC9 Dec 201410 Dec 20249 Dec 2025
355septicpumpingbrookings.comeNom, Inc.9 Dec 20147 Nov 20159 Dec 2016
356septic-star.comGoDaddy.com, LLC9 Dec 201410 Dec 20249 Dec 2025
357septicsafestore.com1&1 Internet AG10 Dec 201411 Dec 201610 Dec 2017
358septic-safe.comGoDaddy.com, LLC8 Aug 20248 Aug 20248 Aug 2027
359septicsystemslewisburg.comNameCheap, Inc.12 Dec 201412 Nov 202412 Dec 2025
360septicsystemservicewharton.comGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2015
361septicpumpinggrasslakemi.comLaunchpad, Inc.12 Dec 201427 Nov 202412 Dec 2025
362septicpumpingalbionmi.comLaunchpad, Inc.12 Dec 201427 Nov 202312 Dec 2025
363septicsystemproj.comGoDaddy.com, LLC1 Apr 20221 Apr 20221 Apr 2023
364septicollection.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
365septicservicemarion.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
366septicserviceabingdon.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
367septic-system-niagara-region.com-5 Mar 20247 May 20255 Mar 2025
368septicmetrics.comGoDaddy.com, LLC17 Dec 201417 Dec 201417 Dec 2015
369septictanksc.comGoDaddy.com, LLC18 Dec 20145 Apr 202518 Dec 2034
370septicpumpingca.comInlandDomains, LLC28 Aug 202128 Aug 202128 Aug 2022
371septictanktablets.comGoDaddy.com, LLC4 Nov 20215 Nov 20244 Nov 2025
372septicsearchplus.comGoDaddy.com, LLC19 Dec 201419 Dec 201419 Dec 2016
373septictimer.netregister.com, Inc.19 Dec 201419 Dec 201419 Dec 2015
374septiceye.comNameCheap, Inc.10 Nov 202222 Jan 202510 Nov 2024
375septico.infoPDR Ltd. d/b/a PublicDomainRegistry.com22 Dec 20147 Dec 201622 Dec 2017
376septico.netInfomaniak Network SA20 Sep 202420 Sep 202420 Sep 2034
377septic-t.comNetwork Solutions, LLC25 Dec 201425 Dec 201425 Dec 2015
378septictankserviceal.comGoDaddy.com, LLC30 Dec 201430 Dec 201430 Dec 2015
379septicsystemscharlestown.comeNom, Inc.30 Dec 201430 Dec 201430 Dec 2015
380septicdesign.bizTucows Domains Inc.29 Dec 20101 Jan 201528 Dec 2014
381septicdesign.usTucows Domains Inc.29 Dec 20101 Jan 201528 Dec 2014
382septicdesign.infoTucows Domains Inc.29 Dec 20102 Jan 201529 Dec 2015
383septice.comHostinger, UAB2 Apr 202313 May 20242 Apr 2024
384septicmedics.plumbing-27 Jun 201427 Jun 201427 Jun 2015
385septicmaxx.systemsGoDaddy.com, LLC7 Jul 201421 Aug 20197 Jul 2020
386septicproblem.xyzNetwork Solutions, LLC20 Jul 201421 Jul 201420 Jul 2015
387septicsupplyshop.xyzNetwork Solutions, LLC30 Jun 20141 Jul 201430 Jun 2015
388septictanks.xyzGoDaddy.com, LLC2 Jun 20143 Jun 20252 Jun 2026
389septicskeptic.xyzNetwork Solutions, LLC1 Jul 20142 Jul 20141 Jul 2015
390septicproducts.xyzNetwork Solutions, LLC29 Jul 201430 Jul 201429 Jul 2015
391septictank.limitedTucows Domains Inc.6 Aug 201410 Aug 20196 Aug 2020
392septicprofessor.companyGoDaddy.com, LLC25 Aug 20149 Oct 201925 Aug 2020
393septictank.guideeNom, Inc.18 Sep 201418 Sep 201418 Sep 2015
394septicsystem.supplieseNom, Inc.21 Oct 201415 Oct 201921 Oct 2020
395septictankcleaningmetropolisil.comGoDaddy.com, LLC11 Aug 201510 Aug 202111 Aug 2022
396septictankcleaningmarionil.comGoDaddy.com, LLC11 Aug 201511 Aug 201511 Aug 2016
397septictankcleaningcarbondaleil.comGoDaddy.com, LLC11 Aug 201511 Aug 201511 Aug 2016
398septicare.ovhOVH sas27 Oct 201427 Oct 201427 Oct 2015
399septicsystems.melbourneKey-Systems, LLC14 Nov 201419 Dec 202414 Nov 2024
400septicplus.servicesUniregistrar Corp30 Nov 201411 Nov 201730 Nov 2018
401septicsystem.guruGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
402septictracking.helpGoDaddy.com, LLC16 Dec 201416 Dec 201416 Dec 2015
403septicsoftware.helpGoDaddy.com, LLC16 Dec 201415 Sep 201516 Dec 2018
404septicservicespringfield.comGoDaddy.com, LLC12 Aug 20151 Aug 202512 Aug 2026
405septiccleaningspringfield.comGoDaddy.com, LLC12 Aug 201512 Aug 201512 Aug 2016
406septictank.helpUniregistrar Corp31 Jan 201531 Jan 201531 Jan 2016
407septictank.careNameCheap, Inc.20 May 20184 Jun 202420 May 2025
408septic-topas.moscowRegional Network Information Center, JSC dba RU-CE…6 Feb 20156 Feb 20156 Feb 2017
409septicinspection.servicesGoDaddy.com, LLC25 Feb 201511 Apr 202525 Feb 2026
410septictanks.kiwiWeb Drive Ltd24 Nov 201629 Nov 201624 Nov 2017
411septictanks.cymruMesh Digital Limited8 Mar 201511 Sep 20188 Mar 2020
412septictankcleaning.kiwiTucows Domains Inc.18 Nov 201623 Nov 201618 Nov 2017
413septictanks.walesMesh Digital Limited8 Mar 201511 Sep 20188 Mar 2020
414septictank.walesMesh Digital Limited2 Mar 20152 Mar 20172 Mar 2018
415septictanks.scot1&1 Internet AG27 Mar 2015-27 Mar 2016
416septictanksanbernardino.comGoDaddy.com, LLC14 Aug 201514 Aug 202314 Aug 2025
417septictankorangecounty.comGoDaddy.com, LLC14 Aug 201514 Aug 202514 Aug 2027
418septictanklosangeles.comGoDaddy.com, LLC14 Aug 201514 Aug 202514 Aug 2027
419septicriverside.comGoDaddy.com, LLC14 Aug 201514 Aug 202514 Aug 2027
420septics.directGoDaddy.com, LLC15 Apr 20156 Jan 201715 Apr 2020
421septictanks.directGoDaddy.com, LLC15 Apr 20152 Nov 201515 Apr 2020
422septicsystems.directGoDaddy.com, LLC15 Apr 20156 Jan 201715 Apr 2020
423septic-tank.moscowRegional Network Information Center, JSC dba RU-CE…20 Apr 201520 Apr 201520 Apr 2016
424septictank.solutionsNameCheap, Inc.27 Jul 202327 Jul 202527 Jul 2026
425septicsystem.solutionsGoDaddy.com, LLC15 Apr 201527 Apr 202015 Apr 2021
426septictankpumpingplattsmouthne.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2017
427septictankplumbingplattsmouthne.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2017
428septicpumpingomahane.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2017
429septictanksemptying.comMesh Digital Limited6 Jan 201530 Oct 20196 Jan 2020
430septictanksandsystemsuniongrove.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2016
431septictankguys.comPorkbun, LLC24 Jul 202323 Jul 202524 Jul 2026
432septictanksemptied.netMesh Digital Limited6 Jan 201514 Dec 20166 Jan 2018
433septicbrookhaven.comeNom, Inc.8 Jan 20158 Jan 20158 Jan 2016
434septic-tanks-maintenance.comeNom, Inc.8 Jan 20158 Jan 20158 Jan 2016
435septicyte.comGoogle, Inc.10 Feb 201727 Jan 202510 Feb 2026
436septicsystemx.comDomain.com, LLC20 Aug 20059 Jan 201520 Aug 2015
437septicsystemscontractor.comGoDaddy.com, LLC11 Jan 201512 Jan 202511 Jan 2027
438septicservicesma.comTucows Domains Inc.8 Jan 201412 Jan 20158 Jan 2016
439septicpumpplumber.comGoDaddy.com, LLC11 Jan 201511 Jan 201511 Jan 2016
440septicpumpingma.netTucows Domains Inc.8 Jan 201412 Jan 20158 Jan 2016
441septicexpress.comTurnCommerce, Inc. DBA NameBright.com2 Apr 201627 Mar 20212 Apr 2026
442septicmanagement.infoGoDaddy.com, LLC14 Jan 201528 Feb 202514 Jan 2027
443septictankcleaninginanderson.comGoDaddy.com, LLC16 Jan 201530 Mar 202516 Jan 2025
444septicsbystarkworks.comWild West Domains, LLC15 Aug 201515 Aug 201515 Aug 2016
445septictank.xyzGoogle, Inc.17 Jun 202129 May 202517 Jun 2030
446septictank.servicesGoDaddy.com, LLC30 Jul 201530 Jul 202530 Jul 2026
447septictankneo.comTucows Domains Inc.15 Jan 201419 Jan 201515 Jan 2016
448septicsystemcompanybigspring.comregister.com, Inc.21 Jan 201521 Jan 201521 Jan 2016
449septicinspectionlacrosse.comTucows Domains Inc.21 Jan 201525 Jan 201721 Jan 2017
450septicserviceaiken.comWild West Domains, LLC22 Jan 201522 Jan 201522 Jan 2016
451septicsystemalarms.comeNom, Inc.23 Jan 201525 Dec 202423 Jan 2026
452septicrisers.comNameCheap, Inc.25 Jul 202525 Jul 202525 Jul 2026
453septicreplacementpumps.comeNom, Inc.23 Jan 201525 Dec 202423 Jan 2026
454septicpumpdiffusers.comeNom, Inc.23 Jan 201513 Dec 201723 Jan 2023
455septicaeratorpumps.comeNom, Inc.23 Jan 201525 Dec 202423 Jan 2026
456septic-express.comGransy s.r.o. d/b/a subreg.cz10 Mar 202420 May 202510 Mar 2025
457septic-shock.comGoDaddy.com, LLC13 Dec 202013 Dec 202013 Dec 2021
458septictankcleaninginmountpoconopa.comeNom, Inc.18 Aug 201518 Aug 201518 Aug 2018
459septically.comregister.com, Inc.18 Aug 201518 Aug 201518 Aug 2016
460septictankprice.comGoDaddy.com, LLC6 Jul 20256 Jul 20256 Jul 2026
461septictankfailure.comDreamHost, LLC15 Nov 202315 Oct 202415 Nov 2025
462septicpumpingbristol.comGoDaddy.com, LLC3 Feb 20153 Feb 20153 Feb 2016
463septictankprice.neteNom, Inc.2 Feb 20152 Feb 20152 Feb 2016
464septictank-bonamite9.comGMO Internet Inc.5 Feb 20155 Feb 20155 Feb 2016
465septicrepairmountvernonwa.comeNom, Inc.5 Feb 20155 Feb 20155 Feb 2016
466septic-tank-services.comeNom, Inc.31 May 201631 May 201631 May 2017
467septictankmilkopal.comGMO Internet Inc.5 Feb 20155 Feb 20155 Feb 2016
468septictankcleaningloysburgpa.comeNom, Inc.6 Feb 20155 Jan 20166 Feb 2018
469septic-tankbiotech.comInterweb Advertising D.B.A. Profile Builder5 Feb 20155 Feb 20155 Feb 2016
470septictankunderstanding.netGMO Internet Inc.5 Feb 20155 Feb 20155 Feb 2016
471septictank-hyalite.netGMO Internet Inc.5 Feb 20155 Feb 20155 Feb 2016
472septictankelaeolite.orgGMO Internet Inc.5 Feb 2015-5 Feb 2016
473septictank-reliable.orgGMO Internet Inc.5 Feb 2015-5 Feb 2016
474septictanktreatmentlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
475septictankservicelocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
476septictankpumpinglocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
477septictankmaintenancelocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
478septictanklocalexperts.comGoDaddy.com, LLC20 Aug 201511 May 201620 Aug 2016
479septictankinstallationlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
480septictankcleaninglocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
481septictankbiotun.comCV. Rumahweb Indonesia20 Aug 201513 Sep 201520 Aug 2016
482septicsystemlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
483septicsystemdesignlocalexperts.comGoDaddy.com, LLC20 Aug 20151 Nov 202320 Aug 2023
484septicservicelocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
485septicrepairlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
486septicpumpinglocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
487septiclakelandfl.comGoDaddy.com, LLC19 Feb 201619 Feb 201619 Feb 2017
488septicinspectionlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
489septicfieldlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
490septiccompanylocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
491septiccleaninglocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
492septictankssystems.comTLDs LLC dba SRSplus9 Feb 201524 Mar 20179 Feb 2018
493septictankdonegal.comBlacknight Internet Solutions Ltd.10 Feb 201526 Mar 202510 Feb 2025
494septic-medic.comBeijing Lanhai Jiye Technology Co., Ltd1 Apr 20222 Apr 20231 Apr 2024
495septictankpumpingcost.comGoDaddy.com, LLC12 Feb 201513 Feb 202412 Feb 2026
496septictankfrost10.comGMO Internet Inc.13 Feb 201513 Feb 201513 Feb 2016
497septictankcleaningmiamifl.com-9 Jan 20259 Jan 20259 Jan 2026
498septicbombs.comregister.com, Inc.17 Apr 202330 Jun 202517 Apr 2025
499septicpumpingtampabay.comGoDaddy.com, LLC13 Feb 201514 Feb 201913 Feb 2021
500septictrucksused.comGoDaddy.com, LLC15 Feb 201529 Apr 202515 Feb 2025
501septicservicenorwalk.comeNom, Inc.21 Aug 201521 Aug 201521 Aug 2016
502septictank.infoNameCheap, Inc.21 Jul 202421 Jul 202521 Jul 2026
503septicwarrantynj.comTucows Domains Inc.17 Feb 201521 Feb 202017 Feb 2020
504septicstatus.comGoDaddy.com, LLC9 Jul 202122 Jul 20259 Jul 2026
505septicreview.comGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2016
506septicgeeks.comDropcatch Auction LLC6 May 201619 Jun 20176 May 2018
507septicgeek.comGoDaddy.com, LLC17 Feb 201513 Feb 202517 Feb 2026
508septicconnection.comGoDaddy.com, LLC4 Jan 20195 Jan 20244 Jan 2026
509septicservicesburleson.comGoDaddy.com, LLC18 Feb 20151 Apr 202518 Feb 2025
510septicpumpingmeadowlakes.comGoDaddy.com, LLC19 Feb 201519 Feb 201519 Feb 2016
511septicpumpingmat-suborough.comGoDaddy.com, LLC19 Feb 201519 Feb 201519 Feb 2016
512septicpumpingbiglake.comGoDaddy.com, LLC19 Feb 201519 Feb 201519 Feb 2016
513septiccleaningpro.comGoDaddy.com, LLC18 Feb 201518 Feb 201518 Feb 2016
514septicgeeks.usGoDaddy.com, LLC17 Feb 201517 Feb 201516 Feb 2016
515septicgeek.usGoDaddy.com, LLC17 Feb 201517 Feb 201516 Feb 2016
516septicpumpingwnc.comTucows Domains Inc.16 Feb 201120 Feb 201516 Feb 2016
517septicxatlanta.com-20 Feb 20156 May 202520 Feb 2025
518septictanksinscotland.comTucows Domains Inc.18 Feb 201422 Feb 201518 Feb 2016
519septictankbiohitech.comGMO Internet Inc.23 Feb 201528 Feb 201722 Feb 2018
520septictankservicesinsc.comGoDaddy.com, LLC24 Feb 201524 Feb 201524 Feb 2016
521septicprosnm.comGoDaddy.com, LLC23 Feb 201523 Feb 201523 Feb 2016
522septicpronm.comGoDaddy.com, LLC23 Feb 201523 Feb 201523 Feb 2016
523septictec.comGoDaddy.com, LLC22 Aug 20157 Oct 202422 Aug 2025
524septicservicesava.comName.com, Inc.24 Feb 201524 Feb 201524 Feb 2016
525septicbox.comName.com, Inc.19 Aug 202119 Aug 202119 Aug 2022
526septicsysteminspections.comNameCheap, Inc.21 May 20222 Aug 202321 May 2023
527septic-inspections.comSquarespace Domains LLC5 Aug 202322 Jul 20255 Aug 2026
528septicmonkey.comGoDaddy.com, LLC26 Feb 201526 Feb 201526 Feb 2016
529septicinstallationalpinetx.comGoDaddy.com, LLC26 Feb 201526 Feb 201526 Feb 2016
530septicinspect.usWild West Domains, LLC25 Feb 201525 Feb 201724 Feb 2018
531septictanksclitheroe.comMesh Digital Limited27 Feb 201527 Feb 201527 Feb 2016
532septictanksblackburn.comMesh Digital Limited27 Feb 201527 Feb 201527 Feb 2016
533septicpumpingolympia.comLaunchpad, Inc.28 Feb 201528 Feb 201528 Feb 2016
534septicwarx.comGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2020
535septicsystemssocorro.comregister.com, Inc.2 Mar 20153 Mar 20252 Mar 2026
536septicserviceincolumbiamd.comeNom, Inc.2 Mar 20152 Mar 20152 Mar 2016
537septiclevelalarm.com1&1 Internet AG3 Mar 201520 Mar 20183 Mar 2026
538septiccleaningbybaumanns.comNetwork Solutions, LLC2 Mar 20152 Mar 20152 Mar 2016
539septicfetus.comGoDaddy.com, LLC23 Aug 201523 Aug 201523 Aug 2016
540septictankpumpingcost.orgNameCheap, Inc.7 Jun 201822 Jul 20257 Jun 2026
541septictankneedletin9.comGMO Internet Inc.4 Mar 20154 Mar 20154 Mar 2016
542septictank-dynamic.comGMO Internet Inc.3 Mar 20153 Mar 20153 Mar 2016
543septictank-azure8.comGMO Internet Inc.3 Mar 20153 Mar 20153 Mar 2016
544septicinspect.comGoDaddy.com, LLC31 Oct 201919 Jun 202531 Oct 2026
545septictankthankful.netGMO Internet Inc.4 Mar 20154 Mar 20154 Mar 2016
546septictankametrine9.net----
547septictank-happy.netGMO Internet Inc.4 Mar 20154 Mar 20154 Mar 2016
548septictank-great.netGMO Internet Inc.4 Mar 20154 Mar 20154 Mar 2016
549septictank-amatrix10.netGMO Internet Inc.4 Mar 20154 Mar 20154 Mar 2016
550septicworksdesign.comGoDaddy.com, LLC5 Mar 20155 Mar 20155 Mar 2016
551septiconecleaning.comGoDaddy.com, LLC5 Mar 20155 Mar 20155 Mar 2016
552septicflush.comGoDaddy.com, LLC5 Mar 20156 Mar 20255 Mar 2027
553septictankdeepskyblue.orgGMO Internet Inc.6 Mar 2015-6 Mar 2016
554septictank-emery9.orgGMO Internet Inc.6 Mar 2015-6 Mar 2016
555septicheroes.comTucows Domains Inc.19 Nov 202419 Nov 202419 Nov 2025
556septicgreen.comAzdomainz LLC19 May 20184 Jul 202519 May 2026
557septictankservicemodesto.comGoDaddy.com, LLC24 Aug 201524 Aug 201524 Aug 2016
558septictankpumpingpalmsprings.comGoDaddy.com, LLC24 Aug 201524 Aug 201524 Aug 2016
559septictankpumpingpalmdale.comGoDaddy.com, LLC24 Aug 201524 Aug 201524 Aug 2016
560septictankpumpingmodesto.comGoDaddy.com, LLC24 Aug 201524 Aug 201524 Aug 2016
561septictankpumpinglancaster.comGoDaddy.com, LLC24 Aug 201524 Aug 201524 Aug 2016
562septictankpumpinghemet.comGoDaddy.com, LLC24 Aug 201524 Aug 201524 Aug 2016
563septicheroes.neteNom, Inc.8 Mar 20158 Mar 20158 Mar 2016
564septicrepairbismarck.comGoDaddy.com, LLC9 Mar 20159 Mar 20159 Mar 2016
565septicassurancega.comGoDaddy.com, LLC9 Mar 20159 Mar 20159 Mar 2016
566septicgreen.neteNom, Inc.8 Mar 20157 Feb 20178 Mar 2018
567septictankcleaningchennai.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
568septictankwhiteopal.orgGMO Internet Inc.9 Mar 2015-9 Mar 2016
569septictank-gymnite8.orgGMO Internet Inc.9 Mar 2015-9 Mar 2016
570septicguys.netPDR Ltd. d/b/a PublicDomainRegistry.com18 Jun 202330 Jul 202418 Jun 2024
571septicmax.comGoDaddy.com, LLC11 Mar 20154 Mar 202511 Mar 2026
572septicinspectors.comGoDaddy.com, LLC29 May 202424 Mar 202529 May 2026
573septictanksscotland.comGoDaddy.com, LLC18 Dec 201819 Dec 202418 Dec 2026
574septictankcleaningwilsonnc.comeNom, Inc.13 Mar 201513 Feb 201613 Mar 2017
575septicmaintenancebrysoncitync.comeNom, Inc.13 Mar 201513 Feb 201613 Mar 2017
576septicmontana.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Aug 201517 Jun 201625 Aug 2018
577septicwaco.com----
578septicserviceknoxtn.comTucows Domains Inc.12 Mar 201316 Mar 201512 Mar 2016
579septicsystemsmi.comTucows Domains Inc.16 Mar 201520 Mar 202116 Mar 2021
580septicserviceseo.comGoDaddy.com, LLC14 Apr 20209 Apr 202514 Apr 2026
581septicservicemarketing.comGoogle, Inc.19 Feb 20234 Feb 202519 Feb 2026
582septictankcare.orgeNom, Inc.15 Mar 201516 Mar 201515 Mar 2016
583septictankcleaningjasper.comGoDaddy.com, LLC17 Mar 201517 Mar 201517 Mar 2016
584septicremediation.comRegister.it SPA17 Mar 201517 Mar 201517 Mar 2016
585septicpumpinginmonticellomn.comeNom, Inc.17 Mar 201517 Feb 201617 Mar 2017
586septicservicesinhoustontx.comeNom, Inc.18 Mar 201518 Mar 201518 Mar 2016
587septicpumper.comGoDaddy.com, LLC13 Feb 200724 Mar 202513 Feb 2026
588septictankservicemerced.comGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2016
589septicorlando.comDynadot, LLC15 Nov 202227 Dec 202415 Nov 2025
590septicmusic.comTucows Domains Inc.30 Apr 201630 Apr 201630 Apr 2017
591septic-apps.comTucows Domains Inc.24 Mar 20154 May 202424 Mar 2024
592septictoilets.comGoDaddy.com, LLC24 Mar 201524 Mar 201524 Mar 2016
593septic-tank-options.comeNom, Inc.24 Mar 201523 Feb 201724 Mar 2018
594septicfixes.comDomainPeople, Inc.26 Mar 20158 May 202526 Mar 2025
595septictankfayetteville.comGoDaddy.com, LLC27 Aug 20151 Aug 202427 Aug 2025
596septictankcleaningatlanta.com-3 May 20253 May 20253 May 2026
597septictankcleaners.orgRebel.com Corp.1 Aug 20152 Aug 20161 Aug 2017
598septiccolusa.comTucows Domains Inc.24 Aug 201228 Aug 201524 Aug 2016
599septicu.comNamesilo, LLC27 Mar 20154 Aug 202527 Mar 2026
600septictoilet.comTucows Domains Inc.25 Mar 201429 Mar 201525 Mar 2016
601septictankbio-green.comTucows Domains Inc.25 Mar 201429 Mar 201525 Mar 2016
602septictanksuk.netAbove.com Pty Ltd.6 Jun 202317 Jul 20256 Jun 2025
603septicservicesfortlupton.comName.com, Inc.30 Mar 201530 Mar 201530 Mar 2016
604septiccleaningmountvernon.comGoDaddy.com, LLC30 Mar 201530 Mar 201530 Mar 2016
605septicsystemsinaltamontny.comeNom, Inc.31 Mar 201531 Mar 201531 Mar 2016
606septicsystemsincoalcityil.comeNom, Inc.1 Apr 20151 Apr 20151 Apr 2018
607septicfinger.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
608septicandirrigationsystems.comGoDaddy.com, LLC2 Apr 20152 Apr 20152 Apr 2018
609septicandirrigation.comGoDaddy.com, LLC2 Apr 20152 Apr 20152 Apr 2018
610septictankpumpingredding.comTucows Domains Inc.3 Apr 20157 Apr 20183 Apr 2018
611septicpumpinginminneapolismn.comeNom, Inc.3 Apr 20153 Apr 20153 Apr 2016
612septicrestorationservices.comGoDaddy.com, LLC4 Apr 201517 May 20174 Apr 2018
613septicrestorationservice.comGoDaddy.com, LLC4 Apr 201517 May 20174 Apr 2018
614septichq.comDynadot, LLC7 Jul 202512 Jul 20257 Jul 2026
615septicsalvation.comDomain.com, LLC6 Apr 20156 Apr 20156 Apr 2017
616septictankbiosystem.comNameCheap, Inc.15 Mar 201913 Feb 202515 Mar 2026
617septiccontractorwestminstermd.comeNom, Inc.7 Apr 201521 Apr 20177 Apr 2018
618septictankpumpingredding.netTucows Domains Inc.6 Apr 201510 Apr 20176 Apr 2017
619septic-inspection.comGoDaddy.com, LLC28 Jun 20239 Aug 202528 Jun 2025
620septicoverflowspill.comGoDaddy.com, LLC1 Sep 20151 Sep 20151 Sep 2020
621septicsvcs.comeNom, Inc.6 Sep 201619 Oct 20176 Sep 2017
622septicandplumbinglakelandfl.comTucows Domains Inc.26 Aug 201030 Aug 201526 Aug 2016
623septictankserviceocala.comBeijing Lanhai Jiye Technology Co., Ltd25 Jul 202416 Aug 202525 Jul 2026
624septictanksoptions.comName.com, Inc.8 Apr 20154 May 20178 Apr 2018
625septicinstallationmanawa.comGoDaddy.com, LLC8 Apr 20158 Apr 20158 Apr 2016
626septicgods.comDynadot, LLC8 Apr 20158 Apr 20158 Apr 2016
627septicgod.comDynadot, LLC8 Apr 20158 Apr 20158 Apr 2016
628septictanks.orgGoDaddy.com, LLC22 Jun 201922 Jun 202522 Jun 2026
629septicservicecleaning.netTucows Domains Inc.7 Apr 20159 Mar 20177 Apr 2018
630septicprocleaning.comGoDaddy.com, LLC9 Apr 20159 Apr 20159 Apr 2016
631septicleads.comCloudFlare, Inc.9 Apr 201527 Apr 20259 Apr 2026
632septictanksoptions.neteNom, Inc.8 Apr 20158 Apr 20158 Apr 2016
633septictanktreatmentguys.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
634septictankserviceguys.comGoDaddy.com, LLC10 Apr 20151 Apr 201910 Apr 2020
635septictankpumpingguys.comGoDaddy.com, LLC10 Apr 201522 May 202510 Apr 2025
636septictankproblemguys.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
637septictankmaintenanceguys.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
638septictankinstallationguys.comDynadot, LLC10 Aug 202211 Aug 202510 Aug 2026
639septicsystemguys.com-28 Jun 20255 Aug 202528 Jun 2026
640septicsystemdesignguys.comGoDaddy.com, LLC10 Apr 20151 Apr 201910 Apr 2020
641septicrepairguys.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
642septicinspectionguys.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
643septicfieldguys.comBeijing Lanhai Jiye Technology Co., Ltd24 Jul 202225 Aug 202424 Jul 2024
644septiccompanyguys.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…10 Apr 201510 Apr 202510 Apr 2026
645septiccleaningguys.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
646septicwatch.comTurnCommerce, Inc. DBA NameBright.com12 Apr 20156 Apr 202112 Apr 2026
647septicvision.comTurnCommerce, Inc. DBA NameBright.com12 Apr 20156 Apr 202112 Apr 2026
648septictanktreatment.bizGMO Internet Inc.13 Apr 201513 Apr 201512 Apr 2016
649septictanksstclaircountyil.comGoDaddy.com, LLC4 Sep 201529 Aug 20194 Sep 2020
650septictanksrandolphcountyil.comGoDaddy.com, LLC4 Sep 201529 Aug 20194 Sep 2020
651septictanksmonroecountyil.comGoDaddy.com, LLC4 Sep 201529 Aug 20194 Sep 2020
652septictankandexcavating.comTucows Domains Inc.1 Sep 20105 Sep 20151 Sep 2016
653septicsystemssheboygan.comTucows Domains Inc.1 Sep 20105 Sep 20151 Sep 2016
654septicsystemnh.comGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2016
655septicsystemdesignnh.comGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2016
656septicserviceandsales.comGoDaddy.com, LLC4 Sep 20154 Sep 20154 Sep 2017
657septicinstallnh.comGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2016
658septictankcleaningutah.comFastDomain Inc.15 Apr 201515 Apr 201515 Apr 2016
659septicpumpinginsidneyme.comeNom, Inc.14 Apr 201514 Apr 201514 Apr 2016
660septicprocleaningtx.comTucows Domains Inc.15 Apr 201515 Apr 201515 Apr 2017
661septiconsultores.comGoDaddy.com, LLC14 Apr 201514 Apr 201514 Apr 2016
662septicinstallationinburnettx.comeNom, Inc.14 Apr 201514 Apr 201514 Apr 2016
663septiccleaninginlumbertonnc.comeNom, Inc.14 Apr 201514 Apr 201514 Apr 2016
664septictankbiotechnology.comCV. Jogjacamp16 Apr 201524 Apr 202516 Apr 2026
665septicpumpingincamanoislandwa.comeNom, Inc.16 Apr 201516 Apr 201516 Apr 2016
666septictankriverside.comTucows Domains Inc.2 Sep 20106 Sep 20152 Sep 2016
667septicnhsystem.comGoDaddy.com, LLC5 Sep 20156 Sep 20175 Sep 2019
668septicnhservice.comGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2017
669septicnhpumping.comGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2017
670septicnewhampshire.comGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2017
671septicsystemcedarcity.comTucows Domains Inc.16 Apr 201320 Apr 201716 Apr 2017
672septicmaintenance.netNameCheap, Inc.16 Apr 201517 Mar 202516 Apr 2026
673septicservicesonkitsappennsula.com----
674septictankprofessionals.comeNom, Inc.3 Aug 20223 Aug 20233 Aug 2026
675septicpumpco.comGoDaddy.com, LLC19 Apr 201526 Apr 202413 Feb 2024
676septicbid.comPorkbun, LLC30 Oct 202430 Oct 202430 Oct 2025
677septicsuperheroes.comGoDaddy.com, LLC21 Apr 201521 Apr 201521 Apr 2016
678septicserviceguys.comBeijing Lanhai Jiye Technology Co., Ltd25 Sep 202326 Sep 202425 Sep 2025
679septicplumbingservices.netTucows Domains Inc.17 Apr 201021 Apr 201517 Apr 2016
680septictankinspection.comFabulous.com Pty Ltd.15 Apr 200118 Apr 202515 Apr 2026
681septiccompanies.comGoDaddy.com, LLC23 Apr 201513 Apr 202523 Apr 2026
682septicpumpingonline.comGoDaddy.com, LLC27 Apr 201517 Apr 202527 Apr 2026
683septicmedic.comTurnCommerce, Inc. DBA NameBright.com27 Apr 201521 Apr 202127 Apr 2026
684septic-tank-problems.orgTucows Domains Inc.23 Apr 201324 Mar 201723 Apr 2018
685septictankssomerset.com1&1 Internet AG20 Jun 202520 Jun 202520 Jun 2027
686septictankservicesinasburyia.comeNom, Inc.28 Apr 201527 Mar 201628 Apr 2017
687septicservicewinterhaven.comNamesilo, LLC28 Apr 201528 Apr 201528 Apr 2016
688septicservicelakeland.comName.com, Inc.7 Nov 201716 Oct 20247 Nov 2025
689septicsysteminstaller.netTucows Domains Inc.24 Apr 201428 Apr 202124 Apr 2021
690septictankcleaningguide.netName.com, Inc.29 Apr 201529 Apr 201529 Apr 2016
691septicservicesofiowa.netGoDaddy.com, LLC8 Sep 20159 Sep 20248 Sep 2025
692septicservicesofiowa.comGoDaddy.com, LLC8 Sep 20159 Sep 20248 Sep 2025
693septicsystemrepairsnaples.comGoDaddy.com, LLC30 Apr 201530 Apr 201530 Apr 2016
694septicasdelvalle.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Apr 201530 Apr 201530 Apr 2016
695septicsystemsinlivingstontx.comeNom, Inc.1 May 20151 May 20151 May 2016
696septicprocleaninghouston.comTucows Domains Inc.1 May 20155 May 20181 May 2018
697septicmedicsnd.comeNom, Inc.1 May 20151 May 20151 May 2016
698septicanswers.orgGoDaddy.com, LLC30 Apr 201511 Jun 201730 Apr 2018
699septictankcompanies.comGoDaddy.com, LLC23 Aug 202523 Aug 202523 Aug 2026
700septicproclean.comregister.com, Inc.4 May 20154 May 20154 May 2016
701septicflesh.net-7 May 202521 May 20257 May 2026
702septicsystemservices.comDynadot, LLC5 May 20153 Jun 20255 May 2026
703septicquest.com1&1 Internet AG7 May 20157 May 20157 May 2016
704septicservicescochrane.comGoDaddy.com, LLC7 May 20157 May 20157 May 2016
705septicservicescalgary.comGoDaddy.com, LLC7 May 20157 May 20157 May 2016
706septiconcept.comNetEarth One Inc. d/b/a NetEarth8 May 201517 Apr 20258 May 2026
707septiccure.orgGoDaddy.com, LLC8 May 201519 Jun 20178 May 2018
708septicnews.comGoDaddy.com, LLC20 Aug 202520 Aug 202520 Aug 2026
709septicsystemsolutionsinc.comGoDaddy.com, LLC11 May 201511 May 201511 May 2016
710septicandoiltanks.comGoDaddy.com, LLC12 May 201512 May 202512 May 2026
711septicandoil.comGoDaddy.com, LLC12 May 201512 May 202512 May 2026
712septictank-pros.comTLD Registrar Solutions Ltd.12 May 201512 May 201512 May 2016
713septic-tankservices.comNameCheap, Inc.15 Oct 202115 Sep 202315 Oct 2024
714septicinspectionswa.comGoDaddy.com, LLC13 May 201524 Jun 202413 May 2024
715septicswny.comGoDaddy.com, LLC12 Sep 201512 Sep 201512 Sep 2016
716septicmelbournefl.comBeijing Lanhai Jiye Technology Co., Ltd11 Sep 201512 Sep 202311 Sep 2024
717septicservicesorlando.comGoDaddy.com, LLC23 Feb 20226 Apr 202523 Feb 2025
718septicandoilnj.comGoDaddy.com, LLC14 May 201515 May 202514 May 2026
719septiccleaning.orgRebel.com Corp.24 Apr 201512 May 201724 Apr 2018
720septicproblemslakecounty.comGoDaddy.com, LLC15 May 201515 May 201515 May 2016
721septic-register.comTucows Domains Inc.9 Sep 201113 Sep 20159 Sep 2016
722septicserviceshudson.comGoDaddy.com, LLC19 May 201519 May 201519 May 2016
723septicinstallationinwallertx.comeNom, Inc.19 May 201519 May 201519 May 2016
724septichip.comDropCatch.com 511 LLC19 May 201520 May 201719 May 2018
725septictankinstallationinbedfordva.comeNom, Inc.20 May 201518 Apr 201620 May 2017
726septictankbiogift.comCV. Rumahweb Indonesia20 May 20156 May 202520 May 2027
727septicsocial.comTierraNet Inc. d/b/a DomainDiscover22 Aug 202522 Aug 202522 Aug 2026
728septicalternative.comGoDaddy.com, LLC20 May 201520 May 201520 May 2016
729septicservicesofcentralflorida.comTucows Domains Inc.18 May 201122 May 201518 May 2016
730septiczone.comTLD Registrar Solutions Ltd.21 May 201520 May 202521 May 2026
731septiccharger.comNetwork Solutions, LLC22 May 201523 Mar 202422 May 2026
732septicseep.orgGoDaddy.com, LLC21 May 201522 May 201521 May 2016
733septicwi.comTucows Domains Inc.22 May 201226 May 201922 May 2019
734septicmaintenancegalloway.comeNom, Inc.26 May 201528 Apr 201726 May 2018
735septictankpro.comNameCheap, Inc.16 Nov 201617 Oct 202416 Nov 2025
736septictankcontractor.comGoDaddy.com, LLC6 Jun 20256 Jun 20256 Jun 2026
737septicsolutionguys.comBeijing Lanhai Jiye Technology Co., Ltd14 Aug 202216 Oct 202414 Aug 2024
738septicdigest.com-4 Oct 20164 Oct 20164 Oct 2018
739septicanddrains.comGoDaddy.com, LLC25 Oct 201826 Oct 202425 Oct 2025
740septicon.net1API GmbH9 May 201410 May 20259 May 2026
741septicpumpingingeorgetowntx.comNameCheap, Inc.14 Sep 201514 Aug 201914 Sep 2020
742septicinstallationinsalemor.comeNom, Inc.28 May 201529 Apr 201628 May 2017
743septicenvironmentalservices.comregister.com, Inc.28 May 201515 May 202428 May 2026
744septicin.comTurnCommerce, Inc. DBA NameBright.com26 Aug 202126 Aug 202126 Aug 2026
745septic-tanks.com-29 May 20158 May 202529 May 2026
746septicchem.comGoDaddy.com, LLC31 May 20151 Jun 202531 May 2026
747septicmarketing.comNamesilo, LLC21 Apr 201821 Apr 202521 Apr 2026
748septictankpumpingpros.comNameCheap, Inc.20 Mar 20241 Jun 202520 Mar 2025
749septicri.comTurnCommerce, Inc. DBA NameBright.com21 Aug 20162 Oct 202421 Aug 2024
750septicservicenh.comNameCheap, Inc.23 Jun 2019-23 Jun 2020
751septicclear.comGoDaddy.com, LLC4 Jun 20152 Jul 20244 Jun 2026
752septictankinstallationinmooresvillenc.comNameCheap, Inc.5 Jun 20156 Jun 20255 Jun 2026
753septicology.comTucows Domains Inc.5 Jun 201521 May 20255 Jun 2026
754septicdigestcompany.comGoDaddy.com, LLC5 Jun 20155 Jun 20155 Jun 2016
755septicsociety.comGoDaddy.com, LLC16 Sep 201516 Sep 201516 Sep 2016
756septico.proName.com, Inc.16 Sep 201513 Sep 201916 Sep 2020
757septicology.infoGoDaddy.com, LLC5 Jun 2015-5 Jun 2017
758septicology.orgGoDaddy.com, LLC1 Feb 202318 Mar 20251 Feb 2027
759septicology.netTucows Domains Inc.26 Jul 201711 Jul 202526 Jul 2026
760septicpercplus.comGoDaddy.com, LLC6 Jun 20152 Jul 20246 Jun 2026
761septicnation.comDomain.com, LLC7 Oct 202320 Oct 20237 Oct 2025
762septickure.comGoDaddy.com, LLC6 Jun 20152 Jul 20246 Jun 2026
763septictankpumpingvt.comNameCheap, Inc.22 Mar 202522 Mar 202522 Mar 2026
764septictankpumpingnh.comNameCheap, Inc.22 Mar 202522 Mar 202522 Mar 2026
765septicsolutionsgroup.comSquarespace Domains LLC14 Dec 202414 Dec 202414 Dec 2027
766septiccleanig.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jun 20158 Jun 20158 Jun 2016
767septichora.comDropCatch.com 849 LLC27 Aug 202527 Aug 202527 Aug 2026
768septic-tanks.xyzNameCheap, Inc.3 Aug 202314 Sep 20243 Aug 2024
769septictankreplacement.comGoDaddy.com, LLC17 Sep 20153 May 202517 Sep 2025
770septictankpumpingsanluisobispo.comTucows Domains Inc.17 Sep 201521 Sep 201917 Sep 2019
771septicservicepaintsvilleky.comTucows Domains Inc.17 Sep 201521 Sep 202117 Sep 2021
772septicpumpouthollywood.comTucows Domains Inc.14 Sep 201018 Sep 201514 Sep 2016
773septicboise.comWild West Domains, LLC10 Jun 201510 Jun 201510 Jun 2016
774septictankhub.comNameCheap, Inc.23 Feb 20236 May 202423 Feb 2024
775septicspecialists.netDNC Holdings, Inc.13 Oct 201614 Oct 202413 Oct 2025
776septictankovate.comBlacknight Internet Solutions Ltd.13 Jun 201523 May 201713 Jun 2018
777septictankbioipal.comDynadot, LLC31 Aug 202210 Oct 202331 Aug 2023
778septicsystemmanitowoc.comTucows Domains Inc.15 Sep 201119 Sep 201515 Sep 2016
779septic-overlandpark-ks.comGoDaddy.com, LLC18 Sep 201518 Sep 201518 Sep 2016
780septic-leessummit-mo.comGoDaddy.com, LLC18 Sep 201518 Sep 201518 Sep 2016
781septic-kansascity-mo.comGoDaddy.com, LLC18 Sep 201518 Sep 201518 Sep 2016
782septictankcontractors.usMisk.com, Inc.10 May 20022 Jun 20259 May 2026
783septictankcleaning.usMisk.com, Inc.10 May 200231 May 20179 May 2018
784septictankservicesbrooks.comName.com, Inc.15 Jun 201515 Jun 201515 Jun 2016
785septicassuranceco.comGoDaddy.com, LLC17 Jun 201517 Jun 201517 Jun 2016
786septicservicetwentyninepalms.comGoDaddy.com, LLC18 Jun 201523 Jun 202518 Jun 2026
787septico.comTucows Domains Inc.17 Jun 200018 May 202517 Jun 2026
788septicworksav.comTucows Domains Inc.19 Jun 201519 Jun 201519 Jun 2017
789septicpumping.orgGoDaddy.com, LLC8 Oct 202222 Nov 20248 Oct 2026
790septicserviceocal.comTucows Domains Inc.17 Sep 201021 Sep 201517 Sep 2016
791septic-dks.comNetwork Solutions, LLC22 Jun 201524 Jun 201722 Jun 2018
792septicsafetoiletpaper.comGoDaddy.com, LLC19 Sep 202119 Sep 202119 Sep 2022
793septictankcleaningtips.comGMO Internet Inc.3 Nov 201619 Oct 20173 Nov 2018
794septic-tank.netHiChina Zhicheng Technology Limited13 Aug 202013 Aug 202513 Aug 2025
795septicsystemsinphelanca.comeNom, Inc.25 Jun 201525 May 201625 Jun 2018
796septicsams.comGoDaddy.com, LLC26 Jun 201526 Jun 201526 Jun 2016
797septicsam.comGoDaddy.com, LLC31 May 202116 Oct 202231 May 2026
798septicleader.comGoDaddy.com, LLC8 Mar 20218 Mar 20218 Mar 2022
799septictankrepairguys.comGoDaddy.com, LLC29 Jun 201529 Jun 201529 Jun 2016
800septictankcleaningguys.comSliceofHeaven Domains, LLC16 Sep 202017 Sep 202016 Sep 2021
801septicpumpingguys.comHiChina Zhicheng Technology Limited16 Sep 202017 Sep 202016 Sep 2021
802septic-loans.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Jul 20151 Jul 20151 Jul 2016
803septictanksanluisobispo.comGoDaddy.com, LLC13 Dec 201913 Dec 201913 Dec 2020
804septicservicepensacola.comTucows Domains Inc.20 Sep 201024 Sep 201520 Sep 2016
805septic-tankemptying.comMesh Digital Limited23 Sep 201524 Sep 202423 Sep 2025
806septicsales.comeNom, Inc.5 Mar 20186 Mar 20255 Mar 2022
807septicsale.com----
808septicnh.comregister.com, Inc.1 Jul 20152 Jul 20251 Jul 2026
809septicandgreasetraps.comTucows Domains Inc.1 Jul 20155 Jul 20171 Jul 2017
810septicsystemschattanoogaarea.comTucows Domains Inc.29 Jun 20113 Jul 201529 Jun 2016
811septictankworms.netWebfusion Ltd.1 Jul 201524 Jun 20171 Jul 2018
812septictankworms.infoMesh Digital Limited1 Jul 201524 Jun 20171 Jul 2018
813septictankrescue.neteNom, Inc.25 Sep 201524 Aug 201625 Sep 2017
814septic-pump.comTucows Domains Inc.4 Jul 20154 Jul 20154 Jul 2017
815septictanksinmaconga.comeNom, Inc.7 Jul 20157 Jul 20157 Jul 2016
816septicserviceswestshokan.comGoDaddy.com, LLC7 Jul 20157 Jul 20157 Jul 2016
817septictankpumpinginmarionva.comeNom, Inc.8 Jul 20156 Jun 20168 Jul 2018
818septicauthority.comGoDaddy.com, LLC20 Aug 202520 Aug 202520 Aug 2027
819septictankatl.comGoDaddy.com, LLC1 Jun 20202 Jun 20251 Jun 2026
820septicservicehermitage.comGoDaddy.com, LLC9 Jul 20159 Jul 20159 Jul 2016
821septictankswilmington.comTucows Domains Inc.10 Jul 201514 Jul 201910 Jul 2019
822septicsoul.com----
823septictankinstallationinleesburgfl.comeNom, Inc.13 Jul 201511 Jun 201613 Jul 2018
824septiccleaninginocalafl.comeNom, Inc.14 Jul 201512 Jun 201614 Jul 2017
825septicsystemcontractors.comGoDaddy.com, LLC15 Jul 201516 Jul 202515 Jul 2026
826septictankdraincleaning.comProtocol Internet Technology Limited T/A Hosting I…16 Jul 201517 Jul 201716 Jul 2017
827septicservicesonoma.com1&1 Internet AG17 Jul 201527 Jul 201717 Jul 2018
828septicdouglasville.comTucows Domains Inc.14 Jul 201018 Jul 201514 Jul 2016
829septiccleaningmansfield.comTucows Domains Inc.14 Jul 201018 Jul 201514 Jul 2016
830septiccarrollton.comTucows Domains Inc.14 Jul 201018 Jul 201514 Jul 2016
831septictanksonline.comWebfusion Ltd.20 Jul 201510 Jul 201920 Jul 2020
832septictanksca11.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Oct 201713 Dec 201713 Oct 2018
833septictankemptyingca11.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Oct 201713 Dec 201713 Oct 2018
834septictankcleaningca11.comMesh Digital Limited24 Jan 201824 Jan 201824 Jan 2019
835septictank-repairatlanta.comTucows Domains Inc.20 Jul 201524 Jul 201820 Jul 2018
836septicontrol.comGoDaddy.com, LLC20 Jul 201520 Jul 201520 Jul 2016
837septicbegone.netGoDaddy.com, LLC19 Jul 201530 Aug 202419 Jul 2024
838septicbegone.infoGoDaddy.com, LLC19 Jul 201525 Jul 201719 Jul 2018
839septicsolutionsinc.todayGoDaddy.com, LLC28 Sep 20156 Jan 201728 Sep 2018
840septicpvp.comMedia Elite Holdings Limited23 Aug 202224 Aug 202323 Aug 2023
841septictracker.comGoDaddy.com, LLC22 Jul 201523 Jul 202522 Jul 2026
842septictankpumpinginabingdonva.comeNom, Inc.22 Jul 201522 Jul 201522 Jul 2016
843septicpumpertrucks.comTucows Domains Inc.22 Jul 20157 Jul 202522 Jul 2026
844septicpumpout.infoGoDaddy.com, LLC21 Jul 2015-21 Jul 2016
845septic-contractors.net-29 Jul 201629 Jul 201629 Jul 2017
846septictankpumpinginblackstonema.comeNom, Inc.23 Jul 201521 Jun 201623 Jul 2018
847septictankplastic.comGMO Internet Inc.28 Apr 20124 Apr 201728 Apr 2018
848septicrepairri.comGoDaddy.com, LLC23 Jul 201524 Jul 201523 Jul 2017
849septicpumpinginperaltanm.comNameCheap, Inc.24 Jul 201512 Jul 201924 Jul 2020
850septictankbioguna.comRealtime Register B.V.30 Sep 201530 Sep 201530 Sep 2016
851septictankpumpingwisconsin.comTucows Domains Inc.25 Jul 201129 Jul 201525 Jul 2016
852septictankdesignandrepair.comTucows Domains Inc.26 Jul 201030 Jul 201526 Jul 2016
853septicrepairsantamaria.comGoDaddy.com, LLC1 Oct 20151 Oct 20151 Oct 2016
854septictankpumpingmiami.comGoDaddy.com, LLC4 Aug 20254 Aug 20254 Aug 2026
855septictankpumpingatlanta.comNamesilo, LLC20 May 202021 May 202020 May 2021
856septiccleaninggalvestoncounty.comTucows Domains Inc.27 Jul 201131 Jul 201527 Jul 2016
857septicsolutionssc.comDropCatch.com 1282 LLC18 Oct 201818 Oct 201818 Oct 2019
858septicsolutionssc.netGoDaddy.com, LLC31 Jul 201531 Jul 201531 Jul 2016
859septicsc.netGoDaddy.com, LLC31 Jul 201531 Jul 201531 Jul 2016
860septictankdesign.netPDR Ltd. d/b/a PublicDomainRegistry.com4 Aug 20155 Aug 20164 Aug 2017
861septicguys.orgeNom, Inc.3 Aug 2015-3 Aug 2016
862septictankcleaningtrichy.comWild West Domains, LLC6 Aug 20156 Aug 20156 Aug 2016
863septicandexcavating.comGoogle, Inc.15 May 201930 Apr 202515 May 2026
864septictankcover.comGoDaddy.com, LLC4 Oct 20151 Feb 202522 Feb 2027
865septichealth.comGoDaddy.com, LLC10 Jul 202411 Jul 202510 Jul 2026
866septicservicetexas.comTucows Domains Inc.9 Aug 201513 Aug 20189 Aug 2018
867septicserviceflorida.comGransy s.r.o. d/b/a subreg.cz16 May 20252 Jun 202517 May 2026
868septicguystx.comTucows Domains Inc.9 Aug 201513 Aug 20189 Aug 2018
869septicguysfl.comTucows Domains Inc.9 Aug 201513 Aug 20189 Aug 2018
870septictanksolution.comGoDaddy.com, LLC26 Apr 202227 Apr 202526 Apr 2027
871septicpaducahky.comGoDaddy.com, LLC10 Aug 201510 Aug 201510 Aug 2016
872septicmayfieldky.comGoDaddy.com, LLC10 Aug 201510 Aug 201510 Aug 2016
873septicbentonky.comGoDaddy.com, LLC10 Aug 201510 Aug 201510 Aug 2016
874septictankcleaningcork.comBlacknight Internet Solutions Ltd.6 Oct 201519 Dec 20246 Oct 2024
875septiccleaningofillinois.comTucows Domains Inc.6 Oct 20157 Sep 20166 Oct 2017
876septictanksinspringhillfl.comeNom, Inc.7 Oct 20158 Sep 20167 Oct 2017
877septictanksinclearwaterfl.comeNom, Inc.7 Oct 20158 Sep 20167 Oct 2017
878septictankcenter.comUniregistrar Corp7 Oct 20157 Oct 20157 Oct 2016
879septicservicesincoloradospringsco.comeNom, Inc.7 Oct 20157 Oct 20157 Oct 2016
880septicserviceinthoreaunm.comeNom, Inc.9 Oct 201510 Sep 20169 Oct 2017
881septictank.workGoDaddy.com, LLC17 Apr 202522 Apr 202517 Apr 2026
882septictankpros.xyzNameCheap, Inc.11 Oct 201511 Oct 201511 Oct 2016
883septicrecords.comGoogle, Inc.9 Nov 202225 Oct 20249 Nov 2025
884septicserviceredding.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Oct 201514 Oct 201612 Oct 2017
885septicrepairindoverde.comeNom, Inc.13 Oct 201511 Sep 201613 Oct 2017
886septic-service.moscowRegional Network Information Center, JSC dba RU-CE…13 Oct 201513 Oct 201513 Oct 2016
887septictankssurrey.comMesh Digital Limited14 Oct 201529 Sep 201914 Oct 2020
888septictanknews.comeNom, Inc.14 Oct 201514 Oct 201514 Oct 2016
889septicalscience.comGoDaddy.com, LLC14 Oct 201514 Oct 201514 Oct 2016
890septicals.comGoDaddy.com, LLC30 May 201730 May 201730 May 2018
891septictankfortlauderdale.comTucows Domains Inc.12 Oct 201016 Oct 201512 Oct 2016
892septictank.feedbackReserved for non-billable transactions where Regis…15 Oct 201530 Nov 202415 Oct 2025
893septicservicers.feedbackReserved for non-billable transactions where Regis…15 Oct 201530 Nov 202415 Oct 2025
894septictankcleaners.xyzNameCheap, Inc.16 Oct 201516 Oct 201516 Oct 2016
895septicsystemshouston.comGoDaddy.com, LLC16 Oct 201517 Oct 202416 Oct 2025
896septicpros.orgWild West Domains, LLC16 Apr 202521 Apr 202516 Apr 2026
897septicinstallationcolumbus.comGoDaddy.com, LLC16 Oct 201517 Oct 202416 Oct 2025
898septicservicecolumbus.comGoDaddy.com, LLC16 Oct 201517 Oct 202416 Oct 2025
899septicfox.comTucows Domains Inc.16 Oct 201520 Oct 202116 Oct 2021
900septictanktc.comTucows Domains Inc.14 Oct 201118 Oct 201514 Oct 2016
901septictanksinphoenixaz.comeNom, Inc.19 Oct 201519 Oct 201519 Oct 2016
902septicservicesredding.comWild West Domains, LLC19 Oct 201519 Oct 201519 Oct 2016
903septicthomasbyrd.orgLaunchpad, Inc.20 Oct 20159 Oct 201620 Oct 2017
904septicthomasbyrd.netLaunchpad, Inc.20 Oct 20159 Oct 201620 Oct 2017
905septicthomasbyrd.comLaunchpad, Inc.20 Oct 20159 Oct 201620 Oct 2017
906septicsystemsj.orgLaunchpad, Inc.20 Oct 20159 Oct 201620 Oct 2017
907septicsystemsj.netLaunchpad, Inc.20 Oct 20159 Oct 201620 Oct 2017
908septicsystemsj.comLaunchpad, Inc.20 Oct 20159 Oct 201620 Oct 2017
909septicsouthjersey.orgLaunchpad, Inc.20 Oct 20159 Oct 201620 Oct 2017
910septicsouthjersey.netLaunchpad, Inc.20 Oct 20159 Oct 201620 Oct 2017
911septicsj.orgLaunchpad, Inc.20 Oct 201510 Oct 201620 Oct 2017
912septicsj.netLaunchpad, Inc.20 Oct 201510 Oct 201620 Oct 2017
913septicsj.comPresidentialDomains LLC7 Jan 20197 Jan 20197 Jan 2020
914septicnewjersey.orgLaunchpad, Inc.20 Oct 201510 Oct 201620 Oct 2017
915septicnewjersey.netLaunchpad, Inc.20 Oct 201510 Oct 201620 Oct 2017
916septicworx.comGoDaddy.com, LLC22 Oct 201523 Oct 202422 Oct 2025
917septictank.linkUniregistrar Corp14 Jul 201720 Jul 201714 Jul 2018
918septictanksocala.comTucows Domains Inc.29 Jun 20238 Jul 202429 Jun 2025
919septictankfertilizer.orgTucows Domains Inc.24 Oct 20154 Oct 201624 Oct 2017
920septictankfertilizer.netTucows Domains Inc.24 Oct 201528 Oct 201824 Oct 2018
921septictankfertilizer.infoTucows Domains Inc.24 Oct 201528 Oct 201824 Oct 2019
922septictankfertilizer.comTucows Domains Inc.24 Oct 201528 Oct 201924 Oct 2019
923septictankfertiliser.orgTucows Domains Inc.24 Oct 20154 Oct 201624 Oct 2017
924septictankfertiliser.netTucows Domains Inc.24 Oct 201528 Oct 201824 Oct 2018
925septictankfertiliser.infoTucows Domains Inc.24 Oct 201528 Oct 201824 Oct 2019
926septictankfertiliser.comNamecroc.com LLC10 Jan 202011 Jan 202010 Jan 2021
927septictankcleaningandpumping.comTucows Domains Inc.22 Oct 201026 Oct 201522 Oct 2016
928septicempty.comTPP Wholesale Pty Ltd.26 Oct 201526 Oct 201526 Oct 2017
929septictankrepaircompany.comeNom1010, Inc.16 Jan 202521 Jan 202516 Jan 2026
930septictankcleaninginpune.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Oct 20158 Nov 201628 Oct 2017
931septicsmartaustralia.comCrazy Domains FZ-LLC29 Oct 20151 Aug 201729 Oct 2017
932septicwesleychapel.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
933septicthonotosassa.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Jan 201627 Jan 201627 Jan 2017
934septicsolutions.solutionsNetwork Solutions, LLC29 Oct 201524 Oct 201929 Oct 2020
935septicseffner.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
936septicriverview.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
937septicplantcity.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
938septicpermits.comSquarespace Domains LLC15 Apr 202515 Apr 202515 Apr 2026
939septicmulberry.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
940septiclutz.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
941septiclithia.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
942septiclandolakes.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
943septiclakeland.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
944septicdover.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2017
945septictank-problems.comTucows Domains Inc.27 Oct 201131 Oct 201527 Oct 2016
946septicenergizer.comTucows Domains Inc.27 Oct 200831 Oct 201527 Oct 2016
947septictanksanglesey.comWebfusion Ltd.2 Nov 201525 Jan 20232 Nov 2026
948septicstars.comeNom, Inc.3 Nov 201520 Oct 20163 Nov 2017
949septicinformation.comGoDaddy.com, LLC4 Jun 20175 Jun 20244 Jun 2027
950septicdoctorllc.comNameCheap, Inc.5 Feb 202019 Apr 20235 Feb 2023
951septictankestimates.comGoDaddy.com, LLC6 Nov 20156 Nov 20156 Nov 2016
952septicov.netFabulous.com Pty Ltd.18 Jun 202431 Jul 202518 Jun 2025
953septicsa.comTucows Domains Inc.4 Nov 20118 Nov 20154 Nov 2016
954septictanktylertx.comNameCheap, Inc.5 Feb 20195 Feb 20195 Feb 2020
955septictankodessatx.comNameCheap, Inc.5 Feb 20195 Feb 20195 Feb 2020
956septicservicing.comNameCheap, Inc.31 Jan 20172 Jan 202531 Jan 2026
957septicrepairincorpuschristitx.comeNom, Inc.11 Nov 201511 Nov 201511 Nov 2017
958septicpumpingtucson.comGoDaddy.com, LLC13 Nov 201513 Nov 201513 Nov 2017
959septicmansc.comDropCatch.com 654 LLC30 Jan 202230 Jan 202230 Jan 2023
960septicinstallationgrayson.comTucows Domains Inc.10 Nov 201114 Nov 201510 Nov 2016
961septictankcleaning.xyzUniregistrar Corp10 May 201710 May 201710 May 2018
962septicpumpingroanoke.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
963septicpumpingponder.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
964septicpumpingpilotpoint.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
965septicpumpingkrum.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
966septictankinstallationinaustintx.comeNom, Inc.16 Nov 201515 Oct 201616 Nov 2017
967septicpumpingvalleyview.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
968septicpumpingsanger.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
969septicpumpingrhome.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
970septicpumpingprosper.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
971septicpumpingnorthlake.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
972septicpumpingmckinney.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
973septicpumpinglittleelm.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
974septicpumpinglewisville.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
975septicpumpinglakedallas.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
976septicpumpingkeller.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
977septicpumpingjustin.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
978septicpumpinghaslett.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
979septicpumpingfrisco.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
980septicpumpingflowermound.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
981septicpumpingdenton.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
982septicpumpingdecatur.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
983septicpumpingcoppercanyon.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
984septicpumpingbartonville.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
985septicpumpingaubrey.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
986septicpumpingargyle.comWild West Domains, LLC16 Nov 201516 Nov 201516 Nov 2016
987septictank-4u.comNameCheap, Inc.13 Aug 202325 Oct 202413 Aug 2024
988septicsystemalberta.comGoDaddy.com, LLC20 Nov 201520 Nov 201520 Nov 2016
989septictanksoakaway.infoGoDaddy.com, LLC12 Mar 20168 Mar 201712 Mar 2018
990septictanksemptying.infoTLD Registrar Solutions Ltd.21 Nov 201422 Nov 201521 Nov 2016
991septicsoiltest.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Nov 201520 Feb 202524 Nov 2026
992septictankcleaningcenter.xyzNameCheap, Inc.23 Nov 20159 Dec 201623 Nov 2017
993septicsysteminstallationincharlestonwv.comeNom, Inc.24 Nov 201524 Nov 201524 Nov 2016
994septicinstallandrepair.comGoDaddy.com, LLC24 Nov 201524 Nov 201524 Nov 2016
995septictankserviceco.xyzNameCheap, Inc.28 Nov 20159 Dec 201628 Nov 2017
996septicservicegeorgia.comTucows Domains Inc.25 Nov 201129 Nov 201525 Nov 2016
997septicity.comTucows Domains Inc.11 Nov 20193 Dec 202411 Nov 2025
998septicsense.netGoDaddy.com, LLC11 Mar 201911 Mar 202511 Mar 2027
999septiccontractors.netCosmotown, Inc.30 Nov 2015-30 Nov 2017
1000septicrepairs.xyzNameCheap, Inc.30 Nov 201512 Dec 201630 Nov 2017

Displaying 1,000 out of 9,528 domains starting with the keyword "SEPTIC". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=septic

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now