With support for 
Keyword: SEAHAWK
Reverse Whois » KEYWORD [seahawk ] { 2,286 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | seahawk.com.au | - | - | 3 May 2025 | - |
| 2 | seahawk.ventures | NETIM SARL | 6 Jul 2014 | 13 Jul 2018 | 6 Jul 2019 |
| 3 | seahawk.technology | NETIM SARL | 5 Jul 2014 | 5 Jul 2014 | 5 Jul 2015 |
| 4 | seahawk.partners | NETIM SARL | 5 Jul 2014 | 5 Jul 2014 | 5 Jul 2015 |
| 5 | seahawk.management | NETIM SARL | 5 Jul 2014 | 5 Jul 2014 | 5 Jul 2015 |
| 6 | seahawk.holdings | NETIM SARL | 5 Jul 2014 | 5 Jul 2014 | 5 Jul 2015 |
| 7 | seahawk.estate | NETIM SARL | 5 Jul 2014 | 5 Jul 2014 | 5 Jul 2015 |
| 8 | seahawk.country | Minds + Machines Registrar Limited | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 9 | seahawk.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 8 Mar 2024 | 16 May 2025 | 8 Mar 2025 |
| 10 | seahawk.football | 101domain, Inc. | 25 Apr 2020 | 2 May 2025 | 25 Apr 2026 |
| 11 | seahawk.online | CommuniGal Communication Ltd. | 27 Jan 2025 | 1 Mar 2025 | 27 Jan 2026 |
| 12 | seahawk.fans | eNom, Inc. | 19 Oct 2016 | 5 Jun 2017 | 19 Oct 2017 |
| 13 | seahawk.us | Uniregistrar Corp | 9 Oct 2016 | 22 Feb 2017 | 8 Oct 2017 |
| 14 | seahawk.top | Namesilo, LLC | 23 Nov 2023 | 19 Mar 2024 | 23 Nov 2025 |
| 15 | seahawk.space | GMO Internet Inc. | 7 Mar 2016 | 28 Feb 2017 | 7 Mar 2018 |
| 16 | seahawk.site | - | 27 Sep 2024 | 2 Oct 2024 | 27 Sep 2025 |
| 17 | seahawk.website | Cronon AG | 27 Apr 2016 | 19 Jul 2017 | 27 Apr 2018 |
| 18 | seahawk.in | Porkbun, LLC | 30 May 2010 | 2 Feb 2025 | 30 May 2031 |
| 19 | seahawk.biz | GoDaddy.com, LLC | 8 Jul 2013 | 13 Jul 2024 | 7 Jul 2025 |
| 20 | seahawk.com | Tucows Domains Inc. | 4 Jan 1999 | 7 Oct 2024 | 4 Jan 2026 |
| 21 | seahawk.network | Tucows Domains Inc. | 7 Oct 2016 | 11 Oct 2024 | 7 Oct 2025 |
| 22 | seahawk.info | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Mar 2024 | 3 Jun 2025 | 27 Mar 2025 |
| 23 | seahawk.net | GoDaddy.com, LLC | 27 Sep 1999 | 28 Sep 2024 | 27 Sep 2025 |
| 24 | seahawk.org | Moniker Online Services LLC | 9 Nov 1998 | 11 Nov 2024 | 8 Nov 2025 |
| 25 | seahawk.tech | Xiamen ChinaSource Internet Service Co., Ltd. | 11 Jan 2025 | 16 Jan 2025 | 11 Jan 2026 |
| 26 | seahawk.de | - | - | 24 Nov 2017 | - |
| 27 | seahawk.studio | Gandi SAS | 7 Apr 2017 | 9 Oct 2017 | 7 Apr 2018 |
| 28 | seahawk.solutions | Network Solutions, LLC | 25 Oct 2017 | 20 Oct 2019 | 25 Oct 2020 |
| 29 | seahawk.org.uk | OVH sas | 8 May 2025 | 8 May 2025 | 8 May 2026 |
| 30 | seahawk.co.uk | - | 30 Sep 1998 | 22 Sep 2023 | 30 Sep 2025 |
| 31 | seahawk.co.in | - | 17 Jan 2011 | 6 Feb 2018 | 17 Jan 2023 |
| 32 | seahawk.pro | GMO Internet Inc. | 30 Apr 2024 | 19 Apr 2025 | 30 Apr 2026 |
| 33 | seahawk.media | - | 18 Dec 2023 | 30 Jan 2025 | 18 Dec 2024 |
| 34 | seahawk.fan | Wild West Domains, LLC | 23 Sep 2019 | 7 Nov 2024 | 23 Sep 2025 |
| 35 | seahawk.life | GoDaddy.com, LLC | 15 Aug 2024 | 20 Aug 2024 | 15 Aug 2025 |
| 36 | seahawk.guru | GoDaddy.com, LLC | 17 Jan 2020 | 22 Jan 2020 | 17 Jan 2021 |
| 37 | seahawk.company | GoDaddy.com, LLC | 2 Mar 2020 | 13 Apr 2025 | 2 Mar 2025 |
| 38 | seahawk.chat | NameCheap, Inc. | 22 Sep 2024 | 27 Sep 2024 | 22 Sep 2025 |
| 39 | seahawk.support | Porkbun, LLC | 24 Apr 2020 | 29 Apr 2020 | 24 Apr 2021 |
| 40 | seahawk.one | - | 5 Jul 2024 | 18 Sep 2024 | 5 Jul 2025 |
| 41 | seahawk.asia | GoDaddy.com, LLC | 22 May 2013 | 8 Jun 2024 | 22 May 2026 |
| 42 | seahawk.realty | Epik Inc. | 27 Sep 2020 | 16 Nov 2021 | 27 Sep 2022 |
| 43 | seahawk.group | GoDaddy.com, LLC | 12 Jul 2021 | 31 Aug 2024 | 12 Jul 2026 |
| 44 | seahawk.gold | GoDaddy.com, LLC | 5 Oct 2021 | 5 Oct 2021 | 5 Oct 2022 |
| 45 | seahawk.dk | - | 13 Jul 2018 | - | 31 Jul 2023 |
| 46 | seahawk.cloud | Hostinger, UAB | 15 Aug 2024 | 8 Dec 2024 | 15 Aug 2027 |
| 47 | seahawk.fishing | Name.com, Inc. | 18 Dec 2018 | 30 Jan 2025 | 18 Dec 2024 |
| 48 | seahawk.it | - | 9 Apr 2018 | 25 May 2025 | 9 May 2026 |
| 49 | seahawk.me | 1API GmbH | 16 Nov 2020 | 18 Nov 2023 | 16 Nov 2025 |
| 50 | seahawk.co.nz | - | 18 Oct 2011 | 15 Sep 2024 | - |
| 51 | seahawk.travel | GoDaddy.com, LLC | 2 Mar 2020 | 13 Apr 2025 | 2 Mar 2025 |
| 52 | seahawk.agency | Name.com, Inc. | 20 Jun 2023 | 4 Jan 2025 | 20 Jun 2025 |
| 53 | seahawk.uk | - | 4 Jul 2019 | 26 Sep 2024 | 4 Jul 2025 |
| 54 | seahawk.store | Namesilo, LLC | 26 May 2025 | 26 May 2025 | 26 May 2026 |
| 55 | seahawk.co.jp | - | 21 Oct 2010 | 1 Nov 2024 | - |
| 56 | seahawk.ae | - | - | - | - |
| 57 | seahawk.nl | - | 8 Feb 2011 | 11 Oct 2022 | - |
| 58 | seahawk.shop | Dynadot, LLC | 2 Dec 2023 | 1 Feb 2024 | 2 Dec 2024 |
| 59 | seahawk.se | - | 5 Oct 2018 | 3 Dec 2024 | 5 Oct 2025 |
| 60 | seahawk.ru | - | 31 Jul 2008 | - | 31 Jul 2025 |
| 61 | seahawk.app | Name.com, Inc. | 20 Jun 2024 | 25 Jun 2024 | 20 Jun 2026 |
| 62 | seahawk.bio | NameCheap, Inc. | 24 Jul 2024 | 29 Jul 2024 | 24 Jul 2025 |
| 63 | seahawk.email | GoDaddy.com, LLC | 15 Aug 2024 | 20 Aug 2024 | 15 Aug 2025 |
| 64 | seahawk.world | GoDaddy.com, LLC | 15 Aug 2024 | 20 Aug 2024 | 15 Aug 2025 |
| 65 | seahawk.energy | Namesilo, LLC | 3 Mar 2025 | 8 Mar 2025 | 3 Mar 2026 |
| 66 | seahawk.vc | Dynadot, LLC | 12 Apr 2025 | 8 Jun 2025 | 12 Apr 2026 |
| 67 | seahawk.capital | GoDaddy.com, LLC | 20 May 2025 | 20 May 2025 | 20 May 2026 |
| 68 | seahawks.com | MarkMonitor Inc. | 28 Aug 1996 | 2 Aug 2024 | 27 Aug 2026 |
| 69 | seahawks.net | GoDaddy.com, LLC | 31 Mar 1999 | 31 Mar 2025 | 31 Mar 2026 |
| 70 | seahawkblue.com | NameCheap, Inc. | 23 Apr 2025 | 23 Apr 2025 | 23 Apr 2026 |
| 71 | seahawksdraftblog.com | Easyspace LTD | 19 Jan 2009 | 20 Jan 2025 | 19 Jan 2027 |
| 72 | seahawks-12thman.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 73 | seahawkexchange.com | eNom, Inc. | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 74 | seahawksteamgear.com | GoDaddy.com, LLC | 25 Jan 2016 | 25 Jan 2016 | 25 Jan 2017 |
| 75 | seahawkepoxy.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2016 |
| 76 | seahawkssoccercamps.com | GoDaddy.com, LLC | 27 May 2013 | 27 May 2015 | 27 May 2016 |
| 77 | seahawkjerseys.com | West263 International Limited | 16 Nov 2016 | 16 Nov 2016 | 16 Nov 2017 |
| 78 | seahawktrash.com | GoDaddy.com, LLC | 1 Jun 2014 | 1 Jun 2015 | 1 Jun 2016 |
| 79 | seahawksevents.com | BigRock Solutions Ltd. | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 80 | seahawktickets.net | GoDaddy.com, LLC | 5 Jun 2009 | 6 Jun 2015 | 5 Jun 2016 |
| 81 | seahawkengr.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2016 | 28 Oct 2018 |
| 82 | seahawksjerseysstore.com | GoDaddy.com, LLC | 5 Jun 2014 | 6 Jun 2015 | 5 Jun 2016 |
| 83 | seahawkss.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Apr 2015 | 21 Aug 2015 |
| 84 | seahawkspricecompare.com | GoDaddy.com, LLC | 10 Jan 2015 | 20 May 2015 | 10 Jan 2016 |
| 85 | seahawksxlix.com | GoDaddy.com, LLC | 3 Feb 2014 | 5 May 2015 | 3 Feb 2016 |
| 86 | seahawkssuperchamps.com | GoDaddy.com, LLC | 31 Jan 2014 | 5 May 2015 | 31 Jan 2016 |
| 87 | seahawksvspatriots.com | eNom, Inc. | 31 Oct 2016 | 12 Dec 2017 | 31 Oct 2017 |
| 88 | seahawksjerseysmall.us | - | 2 Oct 2016 | 2 Oct 2016 | 1 Oct 2017 |
| 89 | seahawkbeast.com | GoDaddy.com, LLC | 25 Jan 2015 | 17 Apr 2015 | 25 Jan 2016 |
| 90 | seahawkboom.com | GoDaddy.com, LLC | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2016 |
| 91 | seahawkboom.info | GoDaddy.com, LLC | 25 Jan 2015 | 26 Jan 2017 | 25 Jan 2018 |
| 92 | seahawkboom.net | GoDaddy.com, LLC | 25 Jan 2015 | 17 Apr 2015 | 25 Jan 2016 |
| 93 | seahawkboom.org | GoDaddy.com, LLC | 25 Jan 2015 | 26 Jan 2017 | 25 Jan 2018 |
| 94 | seahawklife.com | GoDaddy.com, LLC | 4 Feb 2014 | 4 Feb 2025 | 4 Feb 2026 |
| 95 | seahawkslife.com | GoDaddy.com, LLC | 4 Feb 2014 | 4 Feb 2025 | 4 Feb 2026 |
| 96 | seahawks-bus.com | GoDaddy.com, LLC | 10 Feb 2013 | 30 Apr 2015 | 10 Feb 2018 |
| 97 | seahawksrock.com | GoDaddy.com, LLC | 17 Jan 2006 | 17 Jan 2025 | 17 Jan 2026 |
| 98 | seahawkfurnitures.com | Launchpad, Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 99 | seahawkelite.com | DomainPeople, Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 100 | seahawksforums.com | GoDaddy.com, LLC | 23 Jan 2006 | 8 Jun 2015 | 23 Jan 2016 |
| 101 | seahawksfootball.com | - | 7 Jul 2022 | 28 Feb 2025 | 7 Jul 2025 |
| 102 | seahawkstore.com | NameCheap, Inc. | 31 Jul 2024 | 31 Jul 2024 | 31 Jul 2025 |
| 103 | seahawkfurniture.com | Network Solutions, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 104 | seahawksports.com | NameCheap, Inc. | 24 Apr 2003 | 26 Mar 2025 | 24 Apr 2026 |
| 105 | seahawkscards.com | GoDaddy.com, LLC | 30 Dec 2007 | 17 Apr 2015 | 30 Dec 2015 |
| 106 | seahawksjersey.com | - | 26 Jan 2022 | 14 Feb 2024 | 26 Jan 2026 |
| 107 | seahawksgab.com | - | 21 Aug 2024 | 21 Apr 2025 | 21 Aug 2025 |
| 108 | seahawkers.org | Network Solutions, LLC | 18 Oct 1998 | 28 Sep 2023 | 17 Oct 2028 |
| 109 | seahawksconnection.com | FastDomain Inc. | 4 May 2023 | 18 Jul 2024 | 4 May 2024 |
| 110 | seahawksfanclub.com | GoDaddy.com, LLC | 18 Nov 2011 | 27 Nov 2024 | 18 Nov 2025 |
| 111 | seahawksjerseysproshop.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Jun 2014 | 10 Jun 2015 | 10 Jun 2016 |
| 112 | seahawksscore.com | GoDaddy.com, LLC | 10 Apr 2021 | 11 Apr 2025 | 10 Apr 2026 |
| 113 | seahawkspartners.com | GoDaddy.com, LLC | 8 Jun 2014 | 9 Jun 2015 | 8 Jun 2016 |
| 114 | seahawkinn-villas.com | GoDaddy.com, LLC | 26 Dec 2010 | 17 Oct 2022 | 26 Dec 2026 |
| 115 | seahawkshuddle.com | CloudFlare, Inc. | 2 May 2005 | 25 May 2025 | 19 Mar 2026 |
| 116 | seahawksquadron.org | NameCheap, Inc. | 16 Sep 2018 | 3 Nov 2024 | 16 Sep 2025 |
| 117 | seahawksmedia.com | Network Solutions, LLC | 22 Apr 2004 | 7 Aug 2024 | 22 Apr 2026 |
| 118 | seahawksshop.com | Gransy s.r.o. d/b/a subreg.cz | 2 Jan 2019 | 25 Dec 2024 | 2 Jan 2026 |
| 119 | seahawksoftware.com | GoDaddy.com, LLC | 17 May 2005 | 13 May 2025 | 17 May 2026 |
| 120 | seahawklab.com | Tucows Domains Inc. | 26 Mar 2005 | 11 Mar 2025 | 26 Mar 2026 |
| 121 | seahawkaddicts.com | GoDaddy.com, LLC | 15 Feb 2008 | 3 Dec 2024 | 15 Feb 2026 |
| 122 | seahawkpaints.com | MarkMonitor Inc. | 10 Feb 1998 | 8 Jan 2025 | 9 Feb 2027 |
| 123 | seahawktour.com | FastDomain Inc. | 8 Feb 2018 | 16 May 2023 | 8 Feb 2026 |
| 124 | seahawkrobotics.com | Network Solutions, LLC | 11 Oct 2019 | 26 May 2025 | 11 Oct 2026 |
| 125 | seahawkaerialfilm.com | DropCatch.com 1117 LLC | 6 Nov 2018 | 6 Nov 2018 | 6 Nov 2019 |
| 126 | seahawkaerialimaging.com | Tucows Domains Inc. | 20 Aug 2014 | 27 Aug 2022 | 20 Aug 2023 |
| 127 | seahawkaerialinspection.com | Tucows Domains Inc. | 20 Aug 2014 | 28 Aug 2021 | 20 Aug 2021 |
| 128 | seahawkaerialmapping.com | Tucows Domains Inc. | 20 Aug 2014 | 28 Aug 2021 | 20 Aug 2021 |
| 129 | seahawkaerialsurvey.com | Tucows Domains Inc. | 20 Aug 2014 | 28 Aug 2021 | 20 Aug 2021 |
| 130 | seahawksvspackerslivestream.org | GoDaddy.com, LLC | 8 Sep 2017 | 8 Sep 2017 | 8 Sep 2018 |
| 131 | seahawks2015superbowlchampions.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 132 | seahawkssuperbowl49champions.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 133 | seahawks1003.com | OnlineNIC, Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 134 | seahawkuav.com | Tucows Domains Inc. | 21 Aug 2014 | 28 Aug 2021 | 21 Aug 2021 |
| 135 | seahawksoftballcamp.com | GMO Internet Inc. | 28 Jan 2023 | 9 Apr 2024 | 28 Jan 2024 |
| 136 | seahawks24nikegamejerseys.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 137 | seahawksvspackers.com | Webfusion Ltd. | 6 Jan 2020 | 8 Jan 2020 | 6 Jan 2021 |
| 138 | seahawkcenturion.com | register.com, Inc. | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 139 | seahawkrepete.com | GoDaddy.com, LLC | 23 Aug 2014 | 24 Aug 2016 | 23 Aug 2017 |
| 140 | seahawksroster.com | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 141 | seahawkscompare.com | Media Elite Holdings Limited | 2 Aug 2022 | 16 Oct 2023 | 2 Aug 2023 |
| 142 | seahawksfansgear.com | PSI-USA, Inc. dba Domain Robot | 2 Dec 2020 | 2 Dec 2020 | 2 Dec 2021 |
| 143 | seahawksfairy.com | GoDaddy.com, LLC | 27 Aug 2014 | 28 Aug 2024 | 27 Aug 2025 |
| 144 | seahawkap.com | Tucows Domains Inc. | 15 Aug 2014 | 16 Jul 2024 | 15 Aug 2025 |
| 145 | seahawkapltd.com | Tucows Domains Inc. | 15 Aug 2014 | 16 Jul 2024 | 15 Aug 2025 |
| 146 | seahawkltd.com | GoDaddy.com, LLC | 15 Aug 2014 | 24 Dec 2024 | 15 Aug 2025 |
| 147 | seahawksjerseyspro.com | GMO Internet Inc. | 1 Nov 2015 | 1 Dec 2016 | 31 Oct 2017 |
| 148 | seahawksbrasil.com | Tucows Domains Inc. | 28 Aug 2014 | 1 Sep 2015 | 28 Aug 2016 |
| 149 | seahawkpaint.com | GoDaddy.com, LLC | 13 Nov 2014 | 14 Nov 2024 | 13 Nov 2025 |
| 150 | seahawkfacilities.com | GoDaddy.com, LLC | 11 Sep 2014 | 13 Jan 2025 | 11 Sep 2025 |
| 151 | seahawksjerseys.net | Network Solutions, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 152 | seahawksjerseyscheap.com | NameCheap, Inc. | 27 Feb 2018 | 27 Feb 2018 | 27 Feb 2019 |
| 153 | seahawksvspackerslivestream.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 154 | seahawkengineering.com | GoDaddy.com, LLC | 8 Mar 2025 | 8 Mar 2025 | 8 Mar 2028 |
| 155 | seahawksuk.com | GoDaddy.com, LLC | 25 May 2020 | 25 May 2020 | 25 May 2021 |
| 156 | seahawksjerseysonline.com | Shanghai Meicheng Technology Information Co., Ltd | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 157 | seahawkship.com | Nhan Hoa Software Company Ltd | 18 Mar 2021 | 28 May 2024 | 18 Mar 2024 |
| 158 | seahawklocksmith.net | GoDaddy.com, LLC | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 159 | seahawkunion.com | register.com, Inc. | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 160 | seahawkmenus.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 161 | seahawksaver.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 162 | seahawksjoe.com | GoDaddy.com, LLC | 18 Sep 2014 | 28 Aug 2024 | 18 Sep 2025 |
| 163 | seahawksmojoe.com | GoDaddy.com, LLC | 18 Sep 2014 | 28 Aug 2024 | 18 Sep 2025 |
| 164 | seahawksbandwagon.com | Wild West Domains, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2016 |
| 165 | seahawkstlalnepantla.com | 1&1 Internet AG | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 166 | seahawks3pete.com | GoDaddy.com, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2017 |
| 167 | seahawksthreepete.com | GoDaddy.com, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2017 |
| 168 | seahawkswoman.com | GoDaddy.com, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2016 |
| 169 | seahawkswomen.com | GoDaddy.com, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2016 |
| 170 | seahawkfanhate.com | Name.com, Inc. | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 171 | seahawksposters.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 172 | seahawksfeed.com | GoDaddy.com, LLC | 8 Sep 2014 | 9 Sep 2024 | 8 Sep 2025 |
| 173 | seahawkinstitute.com | Tucows Domains Inc. | 31 Mar 2023 | 31 Mar 2023 | 31 Mar 2024 |
| 174 | seahawkteam.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 175 | seahawkstunnel.com | GoDaddy.com, LLC | 4 Oct 2014 | 4 Oct 2016 | 4 Oct 2017 |
| 176 | seahawkslegends.com | Network Solutions, LLC | 21 Sep 2014 | 23 Jul 2024 | 21 Sep 2029 |
| 177 | seahawksgeardeals.com | GoDaddy.com, LLC | 20 Nov 2014 | 21 Nov 2016 | 20 Nov 2017 |
| 178 | seahawksfanfeed.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 179 | seahawksjerseys-sale.com | MarkMonitor Inc. | 22 Sep 2014 | 4 May 2017 | 22 Sep 2017 |
| 180 | seahawksecurityservices.com | Tucows Domains Inc. | 20 Jul 2021 | 24 Jul 2022 | 20 Jul 2022 |
| 181 | seahawksplayerstore.com | Xin Net Technology Corporation | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 182 | seahawksun.com | register.com, Inc. | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 183 | seahawks-web.com | register.com, Inc. | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 184 | seahawkssportsfansshop.com | Bizcn.com, Inc. | 9 Oct 2013 | 11 Oct 2014 | 9 Oct 2015 |
| 185 | seahawkobsession.com | Network Solutions, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 186 | seahawkfever.com | GoDaddy.com, LLC | 26 Sep 2014 | 7 Nov 2024 | 26 Sep 2024 |
| 187 | seahawks2015.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 188 | seahawksjerseys-vip.com | NameKing.com Inc. | 1 Mar 2016 | 22 Feb 2017 | 1 Mar 2018 |
| 189 | seahawklimo.com | GoDaddy.com, LLC | 15 Oct 2014 | 27 Dec 2024 | 15 Oct 2024 |
| 190 | seahawkslimo.com | GoDaddy.com, LLC | 15 Oct 2014 | 27 Dec 2024 | 15 Oct 2024 |
| 191 | seahawksdating.com | - | - | - | - |
| 192 | seahawkmaintenancsupply.com | GoDaddy.com, LLC | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 193 | seahawksteamprostore.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Dec 2014 | 20 Nov 2024 | 2 Dec 2025 |
| 194 | seahawksplayersstore.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Dec 2014 | 26 Nov 2017 | 2 Dec 2018 |
| 195 | seahawksfanshoponline.com | Key-Systems GmbH | 13 Jul 2021 | 13 Jul 2021 | 13 Jul 2022 |
| 196 | seahawkblues.com | Automattic Inc. | 27 Jan 2020 | 7 Jan 2025 | 27 Jan 2026 |
| 197 | seahawkcapital.com | Google, Inc. | 4 Dec 2014 | 20 Nov 2024 | 4 Dec 2025 |
| 198 | seahawksoccer.com | GoDaddy.com, LLC | 5 Sep 2024 | 5 Sep 2024 | 5 Sep 2027 |
| 199 | seahawkscheapjerseys.com | MarkMonitor Inc. | 10 Dec 2014 | 4 May 2017 | 10 Dec 2017 |
| 200 | seahawkhouse.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 201 | seahawksgear12.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 202 | seahawksbingo.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 203 | seahawksjerseysofficialshop.com | Shanghai Meicheng Technology Information Co., Ltd | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 204 | seahawkssuperbowljersey.com | MarkMonitor Inc. | 23 Jan 2014 | 22 Dec 2016 | 22 Jan 2019 |
| 205 | seahawkssuperbowlgear.com | MarkMonitor Inc. | 20 Jan 2014 | 19 Dec 2016 | 19 Jan 2019 |
| 206 | seahawksnflofficialstore.com | GoDaddy.com, LLC | 22 Mar 2019 | 22 Mar 2019 | 22 Mar 2020 |
| 207 | seahawksfansjersey.com | MarkMonitor Inc. | 27 Dec 2013 | 25 Nov 2016 | 26 Dec 2018 |
| 208 | seahawks12thfanjersey.com | MarkMonitor Inc. | 13 Jan 2014 | 12 Dec 2016 | 12 Jan 2019 |
| 209 | seahawksnfljerseysmall.com | NetRegistry Pty Ltd. | 23 Apr 2019 | 23 Apr 2019 | 23 Apr 2020 |
| 210 | seahawkersofsocal.com | GKG.NET, INC. | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 211 | seahawksinfo.com | united-domains AG | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 212 | seahawks12.xyz | Network Solutions, LLC | 21 Jul 2014 | 23 Jul 2014 | 21 Jul 2015 |
| 213 | seahawkboats.xyz | Network Solutions, LLC | 22 Jul 2014 | 23 Jul 2014 | 22 Jul 2015 |
| 214 | seahawkranch.xyz | Network Solutions, LLC | 9 Jun 2014 | 10 Jun 2014 | 9 Jun 2015 |
| 215 | seahawkdrilling.xyz | Network Solutions, LLC | 18 Jun 2014 | 19 Jun 2014 | 18 Jun 2015 |
| 216 | seahawk-systems.xyz | Network Solutions, LLC | 2 Jun 2014 | 5 Jun 2014 | 2 Jun 2015 |
| 217 | seahawks.fitness | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 218 | seahawks.rocks | Tucows Domains Inc. | 20 Oct 2023 | 10 Oct 2024 | 20 Oct 2025 |
| 219 | seahawks.social | GoDaddy.com, LLC | 10 Oct 2014 | 24 Nov 2024 | 10 Oct 2025 |
| 220 | seahawknews.com | GoDaddy.com, LLC | 11 Aug 2015 | 22 Sep 2024 | 11 Aug 2024 |
| 221 | seahawks.country | Minds + Machines Registrar Limited | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 222 | seahawks.photos | GoDaddy.com, LLC | 19 Jan 2015 | 5 Mar 2017 | 19 Jan 2018 |
| 223 | seahawksschedule2015.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 224 | seahawkcctv.com | Network Solutions, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2018 |
| 225 | seahawksfootball.club | GoDaddy.com, LLC | 20 Feb 2021 | 20 Feb 2021 | 20 Feb 2022 |
| 226 | seahawks.xyz | Tucows Domains Inc. | 31 Jan 2024 | 13 Mar 2025 | 31 Jan 2025 |
| 227 | seahawks.reviews | eNom, Inc. | 1 Feb 2015 | 1 Feb 2015 | 1 Feb 2016 |
| 228 | seahawks.company | GoDaddy.com, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 229 | seahawksthroat.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Mar 2015 | - | 11 Mar 2016 |
| 230 | seahawkfootball.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 231 | seahawksnfljerseys.com | eName Technology Co., Ltd. | 25 Apr 2019 | 25 Apr 2019 | 25 Apr 2020 |
| 232 | seahawkscall.com | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2017 |
| 233 | seahawkcall.com | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2017 |
| 234 | seahawksyouthsports.org | register.com, Inc. | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 235 | seahawksgameday.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 236 | seahawksbanking.com | GoDaddy.com, LLC | 7 Jan 2020 | 20 Mar 2024 | 7 Jan 2024 |
| 237 | seahawk12thmanparty.com | Gandi SAS | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 238 | seahawksurveillance.com | GoDaddy.com, LLC | 11 Jan 2015 | 11 Jan 2025 | 11 Jan 2026 |
| 239 | seahawkstuff.com | Gandi SAS | 11 Jan 2015 | 2 Feb 2019 | 11 Jan 2020 |
| 240 | seahawkshistory.com | eNom, Inc. | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 241 | seahawkfoundation.org | GoDaddy.com, LLC | 9 Jan 2015 | 14 Oct 2016 | 9 Jan 2019 |
| 242 | seahawkatlantic.com | register.com, Inc. | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 243 | seahawksofficialonlinestore.com | - | 7 May 2024 | 13 Jan 2025 | 7 May 2026 |
| 244 | seahawksauthenticofficialshop.com | Shanghai Meicheng Technology Information Co., Ltd | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 245 | seahawkssuperbowl49jersey.com | MarkMonitor Inc. | 13 Jan 2015 | 4 May 2017 | 13 Jan 2018 |
| 246 | seahawkscruise.com | Launchpad, Inc. | 13 Jan 2015 | 29 Dec 2016 | 13 Jan 2018 |
| 247 | seahawksbling.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 248 | seahawkbling.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 249 | seahawkssuperbowlxlixchamps.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 250 | seahawkssuperbowlxlixchampions.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 251 | seahawkssuperbowl49champs.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 252 | seahawks2015superbowlchamps.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 253 | seahawksvsramslive.com | BigRock Solutions Ltd. | 30 Jun 2017 | 30 Jun 2017 | 30 Jun 2018 |
| 254 | seahawksvspackerslive.com | NameCheap, Inc. | 21 Apr 2017 | 29 Aug 2017 | 21 Apr 2018 |
| 255 | seahawks.party | Dynadot, LLC | 13 Apr 2019 | 13 May 2024 | 13 Apr 2026 |
| 256 | seahawks.football | MarkMonitor Inc. | 26 May 2015 | 29 Apr 2024 | 26 May 2026 |
| 257 | seahawks12.football | united-domains AG | 3 Jun 2015 | 18 Jul 2017 | 3 Jun 2018 |
| 258 | seahawks.top | NameCheap, Inc. | 10 Jan 2017 | 16 May 2017 | 10 Jan 2018 |
| 259 | seahawks.sucks | MarkMonitor Inc. | 20 Jun 2015 | 22 Apr 2020 | 20 Jun 2021 |
| 260 | seahawks.click | Uniregistrar Corp | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 261 | seahawks12blog.com | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2023 | 17 Aug 2025 |
| 262 | seahawks.news | - | 27 Nov 2024 | 8 May 2025 | 27 Nov 2025 |
| 263 | seahawks.team | GoDaddy.com, LLC | 22 Dec 2024 | 27 Dec 2024 | 22 Dec 2025 |
| 264 | seahawksvspatriotssuperbowl2015.com | 1&1 Internet AG | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 265 | seahawksvspatriotslivestreaming.com | 1&1 Internet AG | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 266 | seahawksvspatriotslivestream.com | 1&1 Internet AG | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 267 | seahawkspatriots.com | GoDaddy.com, LLC | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 268 | seahawks2015champs.com | 1&1 Internet AG | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 269 | seahawksvspatriotslive.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 270 | seahawksvspatriotsgamelivestream.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 271 | seahawkssuperbowlxlixshop.com | GMO Internet Inc. | 31 Mar 2017 | 2 Apr 2017 | 31 Mar 2018 |
| 272 | seahawkssuperbowlxlixjerseys.com | - | 16 Apr 2016 | 16 Apr 2016 | 16 Apr 2017 |
| 273 | seahawkssuperbowlnfljersey.com | Xiamen Nawang Technology Co., Ltd | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 274 | seahawksmaniac.com | 1&1 Internet AG | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 275 | seahawksfreetaxprep.com | GoDaddy.com, LLC | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 276 | seahawksandpatriots.com | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 277 | seahawkswhynotus.com | Gandi SAS | 20 Jan 2014 | 21 Jan 2015 | 20 Jan 2016 |
| 278 | seahawksminorfootball.com | GoDaddy.com, LLC | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2018 |
| 279 | seahawkcity.com | eNom, Inc. | 28 Jan 2021 | 30 Dec 2024 | 28 Jan 2026 |
| 280 | seahawkfans.org | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 281 | seahawksvspackers2015.com | Namespro Solutions Inc. | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 282 | seahawkssuperbowlxlixonline.com | Shanghai Meicheng Technology Information Co., Ltd | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 283 | seahawksboom.com | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2017 |
| 284 | seahawks-seattle.com | GMO Internet Inc. | 22 Feb 2022 | 6 Apr 2023 | 22 Feb 2023 |
| 285 | seahawkssuperbowl49jerseys.com | Shanghai Meicheng Technology Information Co., Ltd | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 286 | seahawks-win-again.com | GoDaddy.com, LLC | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 287 | seahawkersgear.com | Tucows Domains Inc. | 24 Jan 2015 | 28 Jan 2020 | 24 Jan 2020 |
| 288 | seahawksweatshirt.com | GoDaddy.com, LLC | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 289 | seahawksfanaticsgear.com | Xiamen Nawang Technology Co., Ltd | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2016 |
| 290 | seahawksvspatriots.net | 1&1 Internet AG | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 291 | seahawkvspatriot.com | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 292 | seahawksex.com | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 293 | seahawksjerseysfantasy.com | Xin Net Technology Corporation | 28 Jan 2015 | 1 Feb 2016 | 28 Jan 2017 |
| 294 | seahawkeverest.com | register.com, Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 295 | seahawksonlineshop.us | GoDaddy.com, LLC | 19 Aug 2015 | 19 Aug 2015 | 18 Aug 2016 |
| 296 | seahawkssportsbar.com | GoDaddy.com, LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 297 | seahawkscolors.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 298 | seahawkenergy.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2015 | 28 Jan 2025 | 28 Jan 2026 |
| 299 | seahawkart.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 16 Sep 2020 | 17 Aug 2024 | 16 Sep 2025 |
| 300 | seahawksweethearts.com | Wild West Domains, LLC | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 301 | seahawksrugby.com | HiChina Zhicheng Technology Limited | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2020 |
| 302 | seahawksofficialstoreonline.com | MarkMonitor Inc. | 11 Dec 2012 | 4 May 2017 | 11 Dec 2017 |
| 303 | seahawksingles.com | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 304 | seahawksfishguides.com | GoDaddy.com, LLC | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2017 |
| 305 | seahawksthreepeat.com | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 306 | seahawksonlinestore.com | Namesilo, LLC | 14 Jul 2018 | 15 Jul 2018 | 14 Jul 2019 |
| 307 | seahawksproshop.net | MarkMonitor Inc. | 2 Aug 2014 | 4 May 2017 | 2 Aug 2017 |
| 308 | seahawksthreepeat.org | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2017 |
| 309 | seahawksthreepeat.net | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2017 |
| 310 | seahawksnw.com | Tucows Domains Inc. | 3 Feb 2015 | 7 Feb 2018 | 3 Feb 2018 |
| 311 | seahawks3pete.net | GoDaddy.com, LLC | 1 Feb 2015 | 1 Feb 2015 | 1 Feb 2016 |
| 312 | seahawksgear.info | GoDaddy.com, LLC | 2 Feb 2015 | 3 Feb 2015 | 2 Feb 2016 |
| 313 | seahawksteamproshop.com | NameCheap, Inc. | 15 Oct 2021 | - | 15 Oct 2022 |
| 314 | seahawkfanshop.com | Launchpad, Inc. | 21 Aug 2015 | 11 Aug 2016 | 21 Aug 2017 |
| 315 | seahawkmaintenancesupply.com | GoDaddy.com, LLC | 10 Feb 2015 | 24 Mar 2025 | 10 Feb 2025 |
| 316 | seahawksaltcompany.com | GoDaddy.com, LLC | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 317 | seahawksalt.com | GoDaddy.com, LLC | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 318 | seahawkfreightinc.com | Google, Inc. | 12 Feb 2015 | 9 Feb 2017 | 12 Feb 2019 |
| 319 | seahawkfreightinc.net | Google, Inc. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 320 | seahawkslaw.com | FastDomain Inc. | 15 Feb 2015 | 31 Jan 2025 | 15 Feb 2026 |
| 321 | seahawklaw.com | FastDomain Inc. | 15 Feb 2015 | 31 Jan 2025 | 15 Feb 2026 |
| 322 | seahawkhorizon.net | register.com, Inc. | 16 Feb 2015 | 16 Feb 2015 | 16 Feb 2016 |
| 323 | seahawkssuck.com | GoDaddy.com, LLC | 23 Dec 2019 | 23 Dec 2019 | 23 Dec 2020 |
| 324 | seahawkactive.net | register.com, Inc. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 325 | seahawkdrinkingbuddy.com | GoDaddy.com, LLC | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2020 |
| 326 | seahawksfan.net | Fabulous.com Pty Ltd. | 20 Jan 2014 | 21 Feb 2015 | 20 Jan 2016 |
| 327 | seahawks-12.com | Tucows Domains Inc. | 26 Feb 2014 | 2 Mar 2015 | 26 Feb 2016 |
| 328 | seahawksfanbox.com | GoDaddy.com, LLC | 7 Jul 2016 | 7 Jul 2016 | 7 Jul 2017 |
| 329 | seahawks-fanatics.com | GMO Internet Inc. | 4 Mar 2015 | 31 Mar 2017 | 3 Mar 2018 |
| 330 | seahawkdivecharters.com | Google, Inc. | 26 Dec 2006 | 9 Mar 2025 | 26 Dec 2024 |
| 331 | seahawkdive.com | Google, Inc. | 26 Dec 2006 | 9 Mar 2025 | 26 Dec 2024 |
| 332 | seahawkrentals.com | Launchpad, Inc. | 5 Mar 2015 | 18 Feb 2017 | 5 Mar 2018 |
| 333 | seahawkslogistics.com | Google, Inc. | 26 Jan 2024 | 12 Jan 2025 | 26 Jan 2026 |
| 334 | seahawksbride.com | DNC Holdings, Inc. | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 335 | seahawksofficialproshops.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Mar 2015 | 8 Mar 2015 | 8 Mar 2016 |
| 336 | seahawkdraftblog.com | Above.com Pty Ltd. | 28 Feb 2023 | 11 May 2024 | 28 Feb 2024 |
| 337 | seahawkyardlogo.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 338 | seahawkturflogo.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 339 | seahawktours.com | GoDaddy.com, LLC | 25 Aug 2015 | 26 Aug 2024 | 25 Aug 2025 |
| 340 | seahawklawnlogo.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 341 | seahawksrealtor.com | GoDaddy.com, LLC | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 342 | seahawksrealestate.com | Dynadot, LLC | 25 Dec 2019 | 6 Mar 2025 | 25 Dec 2024 |
| 343 | seahawksprojersey.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 344 | seahawkslocker.com | eNom, Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 345 | seahawkrealtor.com | GoDaddy.com, LLC | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 346 | seahawkfan.com | GoDaddy.com, LLC | 29 Aug 2017 | 29 Dec 2024 | 29 Aug 2025 |
| 347 | seahawkspictures.com | GoDaddy.com, LLC | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 348 | seahawksbbq.com | GoDaddy.com, LLC | 26 Aug 2015 | 7 Oct 2024 | 26 Aug 2024 |
| 349 | seahawksplayoffs.com | GoDaddy.com, LLC | 22 Mar 2015 | 22 Mar 2015 | 22 Mar 2016 |
| 350 | seahawksvsramslive-stream.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 351 | seahawksvspackers-live-stream.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 352 | seahawkgrowlers.com | GoDaddy.com, LLC | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2016 |
| 353 | seahawkgrowler.com | GoDaddy.com, LLC | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2016 |
| 354 | seahawkslogisticsltd.com | TLD Registrar Solutions Ltd. | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 355 | seahawkindustries.com | TLD Registrar Solutions Ltd. | 3 Apr 2015 | 6 Apr 2015 | 3 Apr 2016 |
| 356 | seahawksvramslivestream.com | 1&1 Internet AG | 1 Sep 2015 | 13 Oct 2016 | 1 Sep 2017 |
| 357 | seahawksofficialproshop.com | Bizcn.com, Inc. | 31 Aug 2013 | 1 Sep 2015 | 31 Aug 2016 |
| 358 | seahawksfans4.life | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 359 | seahawkstrufan.com | GoDaddy.com, LLC | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 360 | seahawkwoman.com | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 361 | seahawks.tickets | MarkMonitor Inc. | 3 Sep 2015 | 31 Jul 2017 | 3 Sep 2018 |
| 362 | seahawkman.com | GoDaddy.com, LLC | 16 Oct 2015 | 16 Oct 2015 | 16 Oct 2016 |
| 363 | seahawkkids.com | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 364 | seahawkbaby.com | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 365 | seahawkentertainment.com | TLD Registrar Solutions Ltd. | 8 Apr 2015 | 13 Apr 2015 | 8 Apr 2016 |
| 366 | seahawkautotransport.com | GoDaddy.com, LLC | 12 Apr 2015 | 12 Apr 2015 | 12 Apr 2016 |
| 367 | seahawksteamfanshop.com | Bizcn.com, Inc. | 4 Sep 2015 | 6 Sep 2016 | 4 Sep 2017 |
| 368 | seahawkservice.com | Google, Inc. | 15 Apr 2015 | 21 Apr 2024 | 15 Apr 2032 |
| 369 | seahawkapparel.com | Webfusion Ltd. | 11 Aug 2020 | 12 Aug 2024 | 11 Aug 2025 |
| 370 | seahawkstix4facevalue.com | GoDaddy.com, LLC | 22 Apr 2015 | 22 Apr 2015 | 22 Apr 2016 |
| 371 | seahawkslivestream.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 372 | seahawkpedicab.com | NameCheap, Inc. | 26 Apr 2015 | 27 Mar 2025 | 26 Apr 2026 |
| 373 | seahawksworld.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Sep 2016 | 24 Oct 2017 | 12 Sep 2018 |
| 374 | seahawkmarket.net | register.com, Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 375 | seahawkstickets.center | GoDaddy.com, LLC | 8 Sep 2015 | 6 Jan 2017 | 8 Sep 2017 |
| 376 | seahawksforlife.com | GoDaddy.com, LLC | 1 May 2015 | 1 May 2015 | 1 May 2016 |
| 377 | seahawkswim.com | NameCheap, Inc. | 13 Sep 2024 | 13 Sep 2024 | 13 Sep 2025 |
| 378 | seahawksgoods.com | HiChina Zhicheng Technology Limited | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2016 |
| 379 | seahawkscornhole.com | GoDaddy.com, LLC | 9 Sep 2015 | 10 Sep 2024 | 9 Sep 2025 |
| 380 | seahawkbroadband.com | GoDaddy.com, LLC | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2017 |
| 381 | seahawkshirefaisal.com | Google, Inc. | 7 May 2015 | 30 Apr 2017 | 7 May 2018 |
| 382 | seahawksvsramslivestream.com | 1&1 Internet AG | 9 May 2015 | 9 May 2015 | 9 May 2016 |
| 383 | seahawksgossip.com | Wild West Domains, LLC | 11 May 2015 | 10 Apr 2025 | 11 May 2026 |
| 384 | seahawkcomputing.com | eNom, Inc. | 12 May 2015 | 12 May 2015 | 12 May 2016 |
| 385 | seahawksteamshop.com | Bizcn.com, Inc. | 11 Sep 2015 | 12 Sep 2015 | 11 Sep 2016 |
| 386 | seahawksfandomshop.com | MarkMonitor Inc. | 12 Sep 2015 | 26 Jul 2017 | 12 Sep 2017 |
| 387 | seahawksvsramslivestreaming.com | 1&1 Internet AG | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 388 | seahawksvspackerslivestreaming.com | 1&1 Internet AG | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 389 | seahawksvspackerslive-stream.com | 1&1 Internet AG | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 390 | seahawkscrm.com | Network Solutions, LLC | 20 May 2015 | 21 Mar 2025 | 20 May 2030 |
| 391 | seahawksvsramslivestream.net | 1&1 Internet AG | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 392 | seahawks.love | Porkbun, LLC | 12 Sep 2015 | 12 Sep 2015 | 12 Sep 2016 |
| 393 | seahawkcove.com | GoDaddy.com, LLC | 26 May 2015 | 27 May 2025 | 26 May 2026 |
| 394 | seahawkcentral.com | Porkbun, LLC | 8 Jul 2021 | 8 Jul 2021 | 8 Jul 2022 |
| 395 | seahawksteamjerseys.com | Xin Net Technology Corporation | 25 May 2014 | 29 May 2015 | 25 May 2016 |
| 396 | seahawkers.net | eNom, Inc. | 29 May 2015 | 15 Jun 2017 | 29 May 2019 |
| 397 | seahawksfitness.com | GoDaddy.com, LLC | 2 Jun 2015 | 7 Jun 2025 | 2 Jun 2026 |
| 398 | seahawksfit.com | GoDaddy.com, LLC | 2 Jun 2015 | 7 Jun 2025 | 2 Jun 2026 |
| 399 | seahawkfinancing.com | TLD Registrar Solutions Ltd. | 27 May 2015 | 2 Jun 2015 | 27 May 2016 |
| 400 | seahawkaholic.com | FastDomain Inc. | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 401 | seahawkaviation.com | - | 23 Aug 2023 | 21 Mar 2025 | 23 Aug 2025 |
| 402 | seahawksortho.com | eNom, Inc. | 17 Sep 2015 | 2 Sep 2016 | 17 Sep 2017 |
| 403 | seahawksemail.com | Network Solutions, LLC | 16 Sep 2015 | 18 Jul 2020 | 16 Sep 2025 |
| 404 | seahawksimage.com | - | - | - | - |
| 405 | seahawksfandom.com | GMO Internet Inc. | 14 Nov 2017 | 14 Nov 2017 | 14 Nov 2018 |
| 406 | seahawks-store.com | GoDaddy.com, LLC | 30 Nov 2018 | 30 Nov 2018 | 30 Nov 2019 |
| 407 | seahawks-proshop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 408 | seahawksfootballgear.com | Dynadot, LLC | 10 Jun 2025 | 10 Jun 2025 | 10 Jun 2026 |
| 409 | seahawksonline.com | GoDaddy.com, LLC | 12 Jun 2015 | 13 Jun 2024 | 12 Jun 2025 |
| 410 | seahawkspot.net | Domain.com, LLC | 14 Jun 2015 | 14 Jun 2015 | 14 Jun 2016 |
| 411 | seahawkbrewing.com | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 412 | seahawkexpress.com | NameCheap, Inc. | 24 Dec 2020 | 7 Mar 2025 | 24 Dec 2024 |
| 413 | seahawkshomerentals.com | GoDaddy.com, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 414 | seahawkjerseysale.com | GMO Internet Inc. | 5 Dec 2016 | 5 Dec 2017 | 5 Dec 2018 |
| 415 | seahawkssuperbowlteamshopjerseys.com | Shanghai Meicheng Technology Information Co., Ltd | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2016 |
| 416 | seahawksorthodontics.com | eNom, Inc. | 22 Sep 2015 | 21 Aug 2016 | 22 Sep 2017 |
| 417 | seahawksbraces.com | eNom, Inc. | 22 Sep 2015 | 21 Aug 2016 | 22 Sep 2017 |
| 418 | seahawksgamelive.com | Innovadeus Pvt. Ltd. | 21 Jul 2019 | 21 Jul 2019 | 21 Jul 2020 |
| 419 | seahawkproductions.com | GoDaddy.com, LLC | 10 May 2024 | 10 May 2024 | 10 May 2026 |
| 420 | seahawkconsultinggroup.com | GoDaddy.com, LLC | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
| 421 | seahawksgamelivestream.com | Eranet International Limited | 8 Oct 2020 | 9 Oct 2020 | 8 Oct 2021 |
| 422 | seahawksimin.com | GoDaddy.com, LLC | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 423 | seahawksshop.top | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Sep 2015 | - | 25 Sep 2016 |
| 424 | seahawkstimes.com | GoDaddy.com, LLC | 5 Jul 2015 | 5 Jul 2015 | 5 Jul 2016 |
| 425 | seahawks-schedule.com | GMO Internet Inc. | 6 Oct 2021 | 9 Oct 2021 | 6 Oct 2022 |
| 426 | seahawks-clash.com | NameJolt.com LLC | 25 Sep 2019 | 25 Sep 2019 | 25 Sep 2020 |
| 427 | seahawkhotels.com | GoDaddy.com, LLC | 25 Sep 2015 | 23 Aug 2024 | 25 Sep 2026 |
| 428 | seahawkaviationinc.com | GoDaddy.com, LLC | 12 Jul 2015 | 12 Jul 2015 | 12 Jul 2016 |
| 429 | seahawkspony.com | GoDaddy.com, LLC | 16 Jul 2015 | 17 Jul 2024 | 16 Jul 2025 |
| 430 | seahawksgearstore.com | Bizcn.com, Inc. | 17 Jul 2015 | 18 Jul 2020 | 17 Jul 2020 |
| 431 | seahawkwedding.com | - | 21 Jul 2015 | 21 Jul 2015 | 21 Jul 2017 |
| 432 | seahawkswedding.com | - | 21 Jul 2015 | 21 Jul 2015 | 21 Jul 2017 |
| 433 | seahawksdeals.com | eNom, Inc. | 22 Jul 2015 | 23 Jun 2017 | 22 Jul 2018 |
| 434 | seahawksmusic.com | Google, Inc. | 28 Sep 2015 | 1 Jun 2024 | 28 Sep 2025 |
| 435 | seahawksgifts.com | GoDaddy.com, LLC | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 436 | seahawkcommander.com | GoDaddy.com, LLC | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 437 | seahawkscountry.com | GoDaddy.com, LLC | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2016 |
| 438 | seahawksteamonlinestore.com | Xiamen Nawang Technology Co., Ltd | 27 Jul 2015 | 28 Jun 2024 | 27 Jul 2025 |
| 439 | seahawksonlineshop.com | Eranet International Limited | 26 Jul 2024 | 28 Jul 2024 | 26 Jul 2025 |
| 440 | seahawksguru.com | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2017 |
| 441 | seahawktrust.com | TLD Registrar Solutions Ltd. | 17 Jun 2015 | 29 Jul 2015 | 17 Jun 2016 |
| 442 | seahawkdesignsinc.com | GoDaddy.com, LLC | 1 Oct 2015 | 2 Oct 2023 | 1 Oct 2025 |
| 443 | seahawkcap.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jun 2023 | 4 Sep 2024 | 23 Jun 2024 |
| 444 | seahawksmall.com | GoDaddy.com, LLC | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 445 | seahawksjerseygear.com | GoDaddy.com, LLC | 1 Aug 2015 | 1 Aug 2015 | 1 Aug 2016 |
| 446 | seahawkjobs.com | GoDaddy.com, LLC | 2 Aug 2015 | 22 Jan 2024 | 2 Aug 2025 |
| 447 | seahawk-custom-pc.com | eNom, Inc. | 3 Aug 2015 | 4 Aug 2015 | 3 Aug 2016 |
| 448 | seahawktrackandxc.com | Key-Systems GmbH | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2016 |
| 449 | seahawks2016.com | GoDaddy.com, LLC | 5 Aug 2015 | 6 Aug 2015 | 5 Aug 2016 |
| 450 | seahawkbt.com | GoDaddy.com, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2017 |
| 451 | seahawksteamgearshop.com | Hongkong Domain Name Information Management Co., L… | 11 Jun 2022 | 18 Jul 2023 | 11 Jun 2023 |
| 452 | seahawksfanshop.com | GoDaddy.com, LLC | 7 Dec 2020 | 7 Dec 2020 | 7 Dec 2021 |
| 453 | seahawkevents.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2016 |
| 454 | seahawkssuperbowlteamshopjersey.com | eNom, Inc. | 4 Oct 2015 | 4 Oct 2015 | 4 Oct 2016 |
| 455 | seahawksjerseysshopofficial.com | Shanghai Meicheng Technology Information Co., Ltd | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 456 | seahawksfootballgears.com | MarkMonitor Inc. | 7 Oct 2015 | 26 Jul 2017 | 7 Oct 2017 |
| 457 | seahawksandhuskies.com | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 458 | seahawksabsweeps.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 459 | seahawkinsider.com | GoDaddy.com, LLC | 17 Jun 2020 | 17 Jun 2020 | 17 Jun 2021 |
| 460 | seahawksbookmark.com | DNSPod, Inc. | 21 Mar 2022 | 21 Apr 2023 | 21 Mar 2023 |
| 461 | seahawksnow.com | NameCheap, Inc. | 12 Oct 2015 | 12 Oct 2024 | 12 Oct 2025 |
| 462 | seahawks12s.com | GoDaddy.com, LLC | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2017 |
| 463 | seahawkswire.com | Brandsight, Inc. | 14 Oct 2015 | 31 Jul 2024 | 14 Oct 2025 |
| 464 | seahawkman.net | GoDaddy.com, LLC | 16 Oct 2015 | 16 Oct 2015 | 16 Oct 2016 |
| 465 | seahawkman.info | GoDaddy.com, LLC | 16 Oct 2015 | 17 Oct 2016 | 16 Oct 2017 |
| 466 | seahawkman.org | GoDaddy.com, LLC | 16 Oct 2015 | 17 Oct 2016 | 16 Oct 2017 |
| 467 | seahawksgame.net | Namesilo, LLC | 18 Oct 2015 | 19 Oct 2024 | 18 Oct 2025 |
| 468 | seahawksacceptsbitcoin.info | GoDaddy.com, LLC | 19 Oct 2015 | 31 Aug 2016 | 19 Oct 2017 |
| 469 | seahawksjerseys.us | Dynadot, LLC | 1 Nov 2024 | 22 Jan 2025 | 1 Nov 2025 |
| 470 | seahawkcapitalmgmt.com | GoDaddy.com, LLC | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 471 | seahawk-rubber-molding.com | GoDaddy.com, LLC | 21 Oct 2015 | 22 Oct 2024 | 21 Oct 2027 |
| 472 | seahawkers.info | Network Solutions, LLC | 22 Oct 2015 | 22 Oct 2015 | 22 Oct 2016 |
| 473 | seahawksfootballjerseysshop.com | Shanghai Meicheng Technology Information Co., Ltd | 24 Oct 2015 | 24 Oct 2015 | 24 Oct 2016 |
| 474 | seahawksshop.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Oct 2015 | 26 Oct 2016 | 26 Oct 2017 |
| 475 | seahawkgroup.info | Network Solutions, LLC | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 476 | seahawks.live | GoDaddy.com, LLC | 12 Jun 2017 | 9 Oct 2017 | 12 Jun 2018 |
| 477 | seahawkcovestudentliving.info | GoDaddy.com, LLC | 28 Oct 2015 | 12 Dec 2024 | 28 Oct 2025 |
| 478 | seahawkcovestudentliving.com | GoDaddy.com, LLC | 28 Oct 2015 | 15 Oct 2024 | 28 Oct 2025 |
| 479 | seahawkcovestudenthousing.com | GoDaddy.com, LLC | 28 Oct 2015 | 29 Oct 2024 | 28 Oct 2025 |
| 480 | seahawklegion12.com | Wild West Domains, LLC | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 481 | seahawkventures.com | GoDaddy.com, LLC | 30 Oct 2015 | 31 Oct 2024 | 30 Oct 2025 |
| 482 | seahawkstrategies.com | GoDaddy.com, LLC | 29 Apr 2017 | 29 Apr 2017 | 29 Apr 2022 |
| 483 | seahawksofficialprostores.com | Shanghai Meicheng Technology Information Co., Ltd | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 484 | seahawksaccessories.com | eNom, Inc. | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 485 | seahawkgoods.com | eNom, Inc. | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 486 | seahawkbling.tech | NameCheap, Inc. | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 487 | seahawksvolume12.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 488 | seahawksnfl.com | GoDaddy.com, LLC | 22 Dec 2023 | 4 Mar 2025 | 22 Dec 2024 |
| 489 | seahawkspercyharvinjerseys.com | eName Technology Co., Ltd. | 26 Apr 2019 | 26 Apr 2019 | 26 Apr 2020 |
| 490 | seahawksfansstoreonline.com | Bizcn.com, Inc. | 8 Nov 2015 | 4 Nov 2016 | 8 Nov 2017 |
| 491 | seahawksonline.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2015 | 1 Nov 2016 | 7 Nov 2017 |
| 492 | seahawksonlineofficialstore.com | Bizcn.com, Inc. | 7 Nov 2013 | 8 Nov 2015 | 7 Nov 2016 |
| 493 | seahawksfootballprostores.com | NameCheap, Inc. | 16 Apr 2025 | 16 Apr 2025 | 16 Apr 2026 |
| 494 | seahawkswap.com | Domaincatcher LLC | 29 Jan 2019 | 30 Jan 2019 | 29 Jan 2020 |
| 495 | seahawkmediagroup.com | GoDaddy.com, LLC | 11 Nov 2015 | 12 Nov 2024 | 11 Nov 2025 |
| 496 | seahawkswindmill.com | 1&1 Internet AG | 15 Nov 2015 | 16 Nov 2016 | 15 Nov 2017 |
| 497 | seahawksjerseysonlineshop.com | Shanghai Meicheng Technology Information Co., Ltd | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 498 | seahawkair.info | Network Solutions, LLC | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2016 |
| 499 | seahawklacrossecamps.com | Amazon Registrar, Inc. | 18 Nov 2015 | 16 Oct 2016 | 18 Nov 2017 |
| 500 | seahawks.gift | Name.com, Inc. | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2016 |
| 501 | seahawks.christmas | Name.com, Inc. | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2016 |
| 502 | seahawksseattle.com | GoDaddy.com, LLC | 24 Jul 2019 | 24 Jul 2019 | 24 Jul 2020 |
| 503 | seahawksofficialshop.com | Bizcn.com, Inc. | 21 Nov 2015 | 18 Nov 2016 | 21 Nov 2017 |
| 504 | seahawksgnome.com | eNom, Inc. | 22 Nov 2015 | 23 Nov 2016 | 22 Nov 2017 |
| 505 | seahawkshopper.com | NameKing.com Inc. | 24 Nov 2015 | 26 Oct 2016 | 24 Nov 2017 |
| 506 | seahawksproshoponline.com | Bizcn.com, Inc. | 26 Nov 2015 | 26 Nov 2015 | 26 Nov 2016 |
| 507 | seahawks4life.com | - | 24 Jul 2016 | 24 Jul 2016 | 24 Jul 2017 |
| 508 | seahawkgames.com | GoDaddy.com, LLC | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2017 |
| 509 | seahawksnation.xyz | NameCheap, Inc. | 30 Nov 2015 | 14 Dec 2015 | 30 Nov 2017 |
| 510 | seahawksportsradio.com | GoDaddy.com, LLC | 28 Nov 2015 | 28 Nov 2015 | 28 Nov 2017 |
| 511 | seahawksfanzz.com | Shanghai Meicheng Technology Information Co., Ltd | 28 Nov 2015 | 28 Nov 2015 | 28 Nov 2016 |
| 512 | seahawks.link | NameCheap, Inc. | 16 Dec 2018 | - | 16 Dec 2019 |
| 513 | seahawksvr.com | GoDaddy.com, LLC | 25 May 2017 | 25 May 2017 | 25 May 2018 |
| 514 | seahawkblog.com | - | 27 Feb 2023 | 29 Mar 2024 | 27 Feb 2024 |
| 515 | seahawks01.com | Web Commerce Communications Limited dba WebNic.cc | 23 Aug 2019 | 23 Aug 2019 | 23 Aug 2020 |
| 516 | seahawkdiving.com | 1&1 Internet AG | 6 Dec 2015 | 6 Dec 2015 | 6 Dec 2016 |
| 517 | seahawksjerseyshome.us | GoDaddy.com, LLC | 9 Dec 2015 | 9 Dec 2015 | 8 Dec 2016 |
| 518 | seahawkstailgate.com | GoDaddy.com, LLC | 11 Dec 2015 | 11 Dec 2015 | 11 Dec 2016 |
| 519 | seahawkarmbands.com | TLD Registrar Solutions Ltd. | 10 Dec 2014 | 11 Dec 2015 | 10 Dec 2016 |
| 520 | seahawksproud.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 521 | seahawksjerseyproshop.com | DropCatch.com 1350 LLC | 27 Feb 2017 | 27 Feb 2017 | 27 Feb 2018 |
| 522 | seahawkssuckdick.com | GoDaddy.com, LLC | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2017 |
| 523 | seahawkexport.com | GoDaddy.com, LLC | 15 Dec 2015 | 16 Dec 2024 | 15 Dec 2025 |
| 524 | seahawkbase.com | GoDaddy.com, LLC | 17 Dec 2015 | 17 Dec 2015 | 17 Dec 2016 |
| 525 | seahawkgrocer.com | GoDaddy.com, LLC | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2016 |
| 526 | seahawkinthebakken.com | eNom, Inc. | 20 Dec 2015 | 20 Dec 2015 | 20 Dec 2016 |
| 527 | seahawktrucking.com | GoDaddy.com, LLC | 28 Dec 2015 | 28 Dec 2015 | 28 Dec 2016 |
| 528 | seahawkaus.com | NetRegistry Pty Ltd. | 1 Jan 2016 | 1 Jan 2016 | 1 Jan 2017 |
| 529 | seahawkcbd.com | GoDaddy.com, LLC | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 530 | seahawkdynasty.com | GoDaddy.com, LLC | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2018 |
| 531 | seahawksvsvikings.com | Namesilo, LLC | 27 Jun 2019 | 30 Jul 2020 | 27 Jun 2020 |
| 532 | seahawkhoops.com | - | 20 Feb 2021 | 20 Feb 2021 | 20 Feb 2022 |
| 533 | seahawksvsvikingslivestream.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 534 | seahawkwindows.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 535 | seahawktubs.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 536 | seahawktub.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 537 | seahawksiding.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 538 | seahawkroofing.com | GoDaddy.com, LLC | 12 Nov 2018 | 13 Nov 2024 | 12 Nov 2026 |
| 539 | seahawkdecks.com | Wix.com Ltd. | 1 Jul 2019 | 1 Jun 2024 | 1 Jul 2025 |
| 540 | seahawkssuperbowlshop.com | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2017 |
| 541 | seahawking.com | TurnCommerce, Inc. DBA NameBright.com | 20 Jun 2018 | 14 Jun 2020 | 20 Jun 2025 |
| 542 | seahawks.land | GoDaddy.com, LLC | 11 Jan 2016 | 25 Feb 2017 | 11 Jan 2018 |
| 543 | seahawksmortgage.com | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2018 |
| 544 | seahawksart.com | GoDaddy.com, LLC | 6 Aug 2018 | 7 Aug 2024 | 6 Aug 2026 |
| 545 | seahawksyndicate.com | GoDaddy.com, LLC | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 546 | seahawksvspantherslivestream.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 547 | seahawksmortgage.org | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 548 | seahawksvspanthersliveonline.info | GoDaddy.com, LLC | 11 Jan 2016 | 12 Jan 2016 | 11 Jan 2017 |
| 549 | seahawksmortgage.net | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 550 | seahawksmortgage.info | GoDaddy.com, LLC | 12 Jan 2016 | - | 12 Jan 2017 |
| 551 | seahawkslimo.net | Tucows Domains Inc. | 12 Jan 2016 | 14 Dec 2016 | 12 Jan 2018 |
| 552 | seahawktees.com | GoDaddy.com, LLC | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 553 | seahawkplumbing.com | GoDaddy.com, LLC | 16 Jan 2016 | 15 Jan 2024 | 16 Jan 2027 |
| 554 | seahawksfantravel.com | GoDaddy.com, LLC | 16 Jan 2016 | 17 Jan 2025 | 16 Jan 2026 |
| 555 | seahawk-apparel.com | Webfusion Ltd. | 21 Jan 2016 | 22 Jan 2025 | 21 Jan 2026 |
| 556 | seahawkvolleyballcamps.com | Network Solutions, LLC | 20 Jan 2016 | 21 Dec 2024 | 20 Jan 2026 |
| 557 | seahawksandkittens.com | Name.com, Inc. | 29 Jan 2016 | 29 Jan 2016 | 29 Jan 2017 |
| 558 | seahawkconsulting.net | 1&1 Internet AG | 28 Jan 2016 | 18 Mar 2017 | 28 Jan 2018 |
| 559 | seahawksnflstore.com | GoDaddy.com, LLC | 2 Nov 2021 | 2 Nov 2021 | 2 Nov 2022 |
| 560 | seahawkconsultancy.com | Tucows Domains Inc. | 2 Feb 2016 | 2 Jan 2024 | 2 Feb 2026 |
| 561 | seahawkssportsradio.com | GoDaddy.com, LLC | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2018 |
| 562 | seahawkcay.com | GoDaddy.com, LLC | 5 Feb 2016 | 5 Feb 2016 | 5 Feb 2017 |
| 563 | seahawkanglers.com | Tucows Domains Inc. | 6 Feb 2010 | 10 Feb 2016 | 6 Feb 2017 |
| 564 | seahawks-mexico.com | Neubox Internet S.A. de C.V. | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 565 | seahawks.cloud | GoDaddy.com, LLC | 17 Feb 2016 | 28 Feb 2017 | 17 Feb 2018 |
| 566 | seahawksafl.com | Crazy Domains FZ-LLC | 27 Feb 2016 | 10 Mar 2018 | 27 Feb 2018 |
| 567 | seahawks.space | NameCheap, Inc. | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 568 | seahawkjp.com | GMO Internet Inc. | 29 Feb 2016 | 21 May 2017 | 28 Feb 2019 |
| 569 | seahawksmancave.com | GoDaddy.com, LLC | 29 Sep 2018 | 29 Sep 2018 | 29 Sep 2019 |
| 570 | seahawksfancave.com | 1&1 Internet AG | 4 Mar 2016 | 4 Mar 2016 | 4 Mar 2017 |
| 571 | seahawkmancave.com | 1&1 Internet AG | 4 Mar 2016 | 4 Mar 2016 | 4 Mar 2017 |
| 572 | seahawkfancave.com | 1&1 Internet AG | 5 Mar 2016 | 5 Mar 2016 | 5 Mar 2017 |
| 573 | seahawksschedule2016.com | GoDaddy.com, LLC | 6 Mar 2016 | 6 Mar 2016 | 6 Mar 2017 |
| 574 | seahawkszone.com | GoDaddy.com, LLC | 9 Mar 2016 | 9 Mar 2016 | 9 Mar 2017 |
| 575 | seahawktennisacademy.com | Network Solutions, LLC | 10 Mar 2016 | 28 Mar 2017 | 10 Mar 2018 |
| 576 | seahawkdesignerhub.com | Network Solutions, LLC | 13 Mar 2016 | 13 Mar 2016 | 13 Mar 2017 |
| 577 | seahawksolutions.com | GMO Internet Inc. | 3 Jun 2024 | 4 Jun 2025 | 3 Jun 2025 |
| 578 | seahawksalmoncharters.com | Key-Systems GmbH | 15 Mar 2016 | 20 Apr 2025 | 15 Mar 2026 |
| 579 | seahawkschat.com | GoDaddy.com, LLC | 16 Mar 2016 | 28 May 2024 | 16 Mar 2024 |
| 580 | seahawkevent.com | GoDaddy.com, LLC | 17 Mar 2016 | 25 Mar 2025 | 17 Mar 2027 |
| 581 | seahawksteamofficialshop.com | Namesilo, LLC | 12 Nov 2019 | 13 Nov 2019 | 12 Nov 2020 |
| 582 | seahawkssouvenirs.com | GoDaddy.com, LLC | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 583 | seahawksteamstoreapparel.com | Domains Express LLC | 9 Jun 2017 | 13 Jun 2017 | 9 Jun 2018 |
| 584 | seahawksfanproshop.com | Tucows Domains Inc. | 6 Jul 2024 | 23 Sep 2024 | 6 Jul 2025 |
| 585 | seahawklanding.com | GoDaddy.com, LLC | 31 Mar 2016 | 21 Sep 2022 | 31 Mar 2026 |
| 586 | seahawksswag.com | Tucows Domains Inc. | 2 Apr 2014 | 6 Apr 2017 | 2 Apr 2017 |
| 587 | seahawksshopnflofficial.com | GMO Internet Inc. | 23 Jun 2018 | 23 Jun 2018 | 23 Jun 2019 |
| 588 | seahawksfangirl.com | GoDaddy.com, LLC | 6 Apr 2016 | 7 Apr 2024 | 6 Apr 2026 |
| 589 | seahawks.co.uk | - | 23 Jan 2013 | 26 Jul 2024 | 23 Jan 2026 |
| 590 | seahawkmyrtlebeach.info | Network Solutions, LLC | 11 Apr 2016 | 15 Feb 2025 | 11 Apr 2026 |
| 591 | seahawkvibecard.com | Network Solutions, LLC | 13 Apr 2016 | 6 Mar 2017 | 13 Apr 2018 |
| 592 | seahawksofficialnflprostore.com | Bizcn.com, Inc. | 14 Apr 2014 | 14 Apr 2014 | 14 Apr 2017 |
| 593 | seahawksbourbonstreetparty.com | eNom, Inc. | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 594 | seahawksatsaints.com | eNom, Inc. | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 595 | seahawkestates.com | - | 15 Apr 2016 | 15 Apr 2016 | 15 Apr 2017 |
| 596 | seahawkbooks.com | Wild West Domains, LLC | 18 May 2016 | 18 May 2016 | 18 May 2018 |
| 597 | seahawksquiz.com | GoDaddy.com, LLC | 19 Apr 2016 | 20 Apr 2025 | 19 Apr 2026 |
| 598 | seahawkscigarthoughts.com | eNom, Inc. | 20 Apr 2016 | 22 Mar 2017 | 20 Apr 2018 |
| 599 | seahawkcoveuncw.com | GoDaddy.com, LLC | 21 Apr 2016 | 7 Nov 2022 | 21 Apr 2026 |
| 600 | seahawkzcorner.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Apr 2016 | 23 Apr 2017 | 23 Apr 2018 |
| 601 | seahawk-boats.com | Gandi SAS | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 602 | seahawkscricketclub.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Apr 2016 | 27 Apr 2016 | 27 Apr 2017 |
| 603 | seahawkerreport.com | Wild West Domains, LLC | 28 Apr 2016 | 28 Apr 2016 | 28 Apr 2017 |
| 604 | seahawksandcoffee.com | GoDaddy.com, LLC | 1 May 2016 | 1 May 2016 | 1 May 2017 |
| 605 | seahawkins.com | GoDaddy.com, LLC | 2 May 2016 | 3 May 2025 | 2 May 2026 |
| 606 | seahawkinspections.com | GoDaddy.com, LLC | 6 May 2016 | 6 May 2016 | 6 May 2017 |
| 607 | seahawksgame.com | Hostinger, UAB | 10 Nov 2024 | 10 Jan 2025 | 10 Nov 2025 |
| 608 | seahawks3.com | - | 18 May 2024 | 19 May 2025 | 18 May 2026 |
| 609 | seahawks-game.com | eNom, Inc. | 13 May 2016 | 14 Apr 2017 | 13 May 2018 |
| 610 | seahawksworld.com | GoDaddy.com, LLC | 21 Jan 2020 | 22 Jan 2025 | 21 Jan 2026 |
| 611 | seahawksauthenticofficialonline.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Jan 2023 | 30 Jan 2025 | 29 Jan 2026 |
| 612 | seahawkwireless.com | DropCatch.com 1105 LLC | 6 Aug 2017 | 6 Aug 2017 | 6 Aug 2018 |
| 613 | seahawkswireless.com | GoDaddy.com, LLC | 19 May 2016 | 19 May 2016 | 19 May 2017 |
| 614 | seahawkwireless.net | GoDaddy.com, LLC | 19 May 2016 | 19 May 2016 | 19 May 2017 |
| 615 | seahawkswireless.net | GoDaddy.com, LLC | 19 May 2016 | 19 May 2016 | 19 May 2017 |
| 616 | seahawksportscamps.com | GoDaddy.com, LLC | 31 May 2016 | 31 May 2016 | 31 May 2017 |
| 617 | seahawksgame.org | Dynadot, LLC | 1 Sep 2017 | 1 Sep 2017 | 1 Sep 2018 |
| 618 | seahawkboats.com | Network Solutions, LLC | 9 Apr 1998 | 19 Feb 2025 | 8 Apr 2026 |
| 619 | seahawkskush.com | Network Solutions, LLC | 3 May 2018 | 3 May 2018 | 3 May 2019 |
| 620 | seahawks.store | MarkMonitor Inc. | 6 Jun 2016 | 17 Jun 2024 | 6 Jun 2026 |
| 621 | seahawks.pics | Uniregistrar Corp | 6 Jun 2016 | 17 Jul 2017 | 6 Jun 2017 |
| 622 | seahawksbox.com | eNom, Inc. | 14 Jun 2016 | 14 Jun 2016 | 14 Jun 2017 |
| 623 | seahawksgame.us | NameKing.com Inc. | 12 Aug 2021 | 31 Aug 2021 | 12 Aug 2022 |
| 624 | seahawks.city | Epik Inc. | 18 Jun 2016 | 2 Aug 2017 | 18 Jun 2018 |
| 625 | seahawkstrackandfieldacademy.com | register.com, Inc. | 21 Jun 2016 | 22 Jun 2024 | 21 Jun 2025 |
| 626 | seahawks2.com | 1&1 Internet AG | 21 Jun 2016 | 21 Jun 2016 | 21 Jun 2018 |
| 627 | seahawkgroups.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Nov 2020 | 20 Nov 2020 | 20 Nov 2021 |
| 628 | seahawksgear.net | GoDaddy.com, LLC | 24 Jun 2016 | 24 Jun 2016 | 24 Jun 2017 |
| 629 | seahawksvsdolphinslivestream.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2016 | 24 Jun 2016 | 24 Jun 2017 |
| 630 | seahawksfanshop.net | GoDaddy.com, LLC | 26 Jun 2016 | 26 Jun 2016 | 26 Jun 2017 |
| 631 | seahawks-vs-rams-live-stream.xyz | NameCheap, Inc. | 28 Jun 2016 | 29 Jul 2016 | 28 Jun 2017 |
| 632 | seahawks-vs-jets-live-stream.xyz | NameCheap, Inc. | 28 Jun 2016 | 29 Jul 2016 | 28 Jun 2017 |
| 633 | seahawkks.com | - | 28 Jun 2016 | 28 Jun 2016 | 28 Jun 2017 |
| 634 | seahawksvssaintslive.xyz | NameCheap, Inc. | 28 Jun 2016 | 29 Jul 2016 | 28 Jun 2017 |
| 635 | seahawksvspatriotslive.xyz | NameCheap, Inc. | 28 Jun 2016 | 29 Jul 2016 | 28 Jun 2017 |
| 636 | seahawksvspantherslive.xyz | NameCheap, Inc. | 28 Jun 2016 | 29 Jul 2016 | 28 Jun 2017 |
| 637 | seahawksvsdolphinslive.xyz | NameCheap, Inc. | 28 Jun 2016 | 29 Jul 2016 | 28 Jun 2017 |
| 638 | seahawksvscardinalslive.xyz | NameCheap, Inc. | 28 Jun 2016 | 29 Jul 2016 | 28 Jun 2017 |
| 639 | seahawksvsbuccaneerslive.xyz | NameCheap, Inc. | 28 Jun 2016 | 29 Jul 2016 | 28 Jun 2017 |
| 640 | seahawksvs49ers.xyz | NameCheap, Inc. | 30 Jun 2016 | 29 Jul 2016 | 30 Jun 2017 |
| 641 | seahawksexpress.com | Google, Inc. | 26 Jan 2024 | 9 Mar 2025 | 26 Jan 2025 |
| 642 | seahawkstouchdown.com | GoDaddy.com, LLC | 3 Jul 2016 | 3 Jul 2016 | 3 Jul 2017 |
| 643 | seahawktheatre.com | GoDaddy.com, LLC | 6 Jul 2016 | 6 Jul 2016 | 6 Jul 2017 |
| 644 | seahawkbikes.com | Beijing Lanhai Jiye Technology Co., Ltd | 30 Sep 2023 | 19 Oct 2024 | 30 Sep 2025 |
| 645 | seahawksteamsshop.us | NameCheap, Inc. | 7 Jul 2016 | 7 Jul 2016 | 6 Jul 2017 |
| 646 | seahawksvspatriotslivestream.xyz | Gandi SAS | 6 Jun 2016 | 11 Jun 2016 | 6 Jun 2017 |
| 647 | seahawksvspackersgamelive.xyz | URL Solutions, Inc. | 7 Jun 2016 | 29 Jul 2016 | 7 Jun 2017 |
| 648 | seahawksvsbuccaneerslivestream.xyz | Gandi SAS | 6 Jun 2016 | 11 Jun 2016 | 6 Jun 2017 |
| 649 | seahawksvssaintsgamelive.xyz | URL Solutions, Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 650 | seahawksvsjetsgamelive.xyz | URL Solutions, Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 651 | seahawksvsramsgamelive.xyz | URL Solutions, Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 652 | seahawksvs49ersgamelive.xyz | URL Solutions, Inc. | 7 Jun 2016 | 29 Jul 2016 | 7 Jun 2017 |
| 653 | seahawkfanbox.com | GoDaddy.com, LLC | 7 Jul 2016 | 7 Jul 2016 | 7 Jul 2017 |
| 654 | seahawksvsjetslive.xyz | Gandi SAS | 7 Jun 2016 | 12 Jun 2016 | 7 Jun 2017 |
| 655 | seahawksvscardinalsgamelive.xyz | URL Solutions, Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 656 | seahawksvsbuccaneersgamelive.xyz | URL Solutions, Inc. | 7 Jun 2016 | 29 Jul 2016 | 7 Jun 2017 |
| 657 | seahawksvspatriotsgamelive.xyz | URL Solutions, Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 658 | seahawktransaction.com | GoDaddy.com, LLC | 8 Jul 2016 | 8 Jul 2016 | 8 Jul 2017 |
| 659 | seahawkmania.com | Key-Systems GmbH | 14 Jul 2021 | 14 Jul 2021 | 14 Jul 2022 |
| 660 | seahawksgear.store | MarkMonitor Inc. | 14 Jun 2016 | 17 Jun 2024 | 14 Jun 2026 |
| 661 | seahawk12.com | 1&1 Internet AG | 12 Jul 2016 | 13 Jul 2024 | 12 Jul 2025 |
| 662 | seahawksjersey.top | Jiangsu Bangning Science and technology Co. Ltd. | 18 Sep 2015 | 18 Sep 2015 | 18 Sep 2016 |
| 663 | seahawks.one | - | 24 Feb 2024 | 3 Mar 2025 | 24 Feb 2025 |
| 664 | seahawksbook.com | GoDaddy.com, LLC | 11 May 2025 | 11 May 2025 | 11 May 2026 |
| 665 | seahawks.ninja | eNom, Inc. | 28 May 2014 | 10 May 2016 | 28 May 2017 |
| 666 | seahawktravels.in | - | 20 Oct 2012 | 29 Nov 2022 | 20 Oct 2027 |
| 667 | seahawksplayer.top | Jiangsu Bangning Science and technology Co. Ltd. | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 668 | seahawks.email | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Mar 2014 | 26 Mar 2023 | 26 Mar 2024 |
| 669 | seahawks.ch | - | - | - | - |
| 670 | seahawk-clothing.biz | Tucows Domains Inc. | 10 Nov 2008 | 13 Nov 2018 | 9 Nov 2018 |
| 671 | seahawks.biz | MarkMonitor Inc. | 27 Mar 2002 | 27 Feb 2025 | 26 Mar 2027 |
| 672 | seahawkclothingltd.biz | Tucows Domains Inc. | 8 Oct 2008 | 11 Oct 2018 | 7 Oct 2018 |
| 673 | seahawkconsulting.biz | eNom, Inc. | 14 Mar 2012 | 12 Mar 2017 | 13 Mar 2017 |
| 674 | seahawkgroup.biz | GoDaddy.com, LLC | 13 Mar 2013 | 14 Aug 2016 | 12 Mar 2018 |
| 675 | seahawkdrilling.biz | Network Solutions, LLC | 20 Feb 2009 | 25 Feb 2019 | 19 Feb 2029 |
| 676 | seahawkclothing.biz | Tucows Domains Inc. | 10 Nov 2008 | 13 Nov 2018 | 9 Nov 2018 |
| 677 | seahawks.website | NameCheap, Inc. | 7 Dec 2020 | 7 Dec 2021 | 7 Dec 2022 |
| 678 | seahawksvsrams-live-stream.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 679 | seahawksvsdolphinslive-stream.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 680 | seahawkexports.com | Domainsofcourse.com LLC | 29 Jul 2017 | 2 Jul 2020 | 29 Jul 2021 |
| 681 | seahawkdude.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2018 |
| 682 | seahawksfansonline.com | Namesilo, LLC | 24 Jul 2016 | 26 Jul 2018 | 24 Jul 2019 |
| 683 | seahawksedgeshop.com | Gandi SAS | 27 Jul 2016 | 28 Jul 2020 | 27 Jul 2020 |
| 684 | seahawkspaintings.com | - | 29 Jul 2016 | 29 Jul 2016 | 29 Jul 2018 |
| 685 | seahawkpaintings.com | - | 29 Jul 2016 | 29 Jul 2016 | 29 Jul 2018 |
| 686 | seahawkers360.com | GoDaddy.com, LLC | 28 Jul 2016 | 28 Jul 2016 | 28 Jul 2019 |
| 687 | seahawksjerseysale.com | GoDaddy.com, LLC | 30 Jul 2016 | 7 Jun 2017 | 30 Jul 2017 |
| 688 | seahawksfansapparel.com | HiChina Zhicheng Technology Limited | 16 Oct 2019 | 17 Oct 2019 | 16 Oct 2020 |
| 689 | seahawkskeychain.com | GoDaddy.com, LLC | 29 Jul 2016 | 29 Jul 2016 | 29 Jul 2017 |
| 690 | seahawksapparelproshop.com | Google, Inc. | 24 Oct 2019 | 24 Oct 2019 | 24 Oct 2020 |
| 691 | seahawkchartersmv.com | GoDaddy.com, LLC | 3 Apr 2013 | 15 May 2024 | 3 Apr 2024 |
| 692 | seahawkskeychains.com | GoDaddy.com, LLC | 3 Aug 2016 | 3 Aug 2016 | 3 Aug 2017 |
| 693 | seahawksteamstoreonline.com | Realtime Register B.V. | 5 Jan 2021 | - | 5 Jan 2022 |
| 694 | seahawksresources.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Aug 2016 | 3 Aug 2016 | 3 Aug 2017 |
| 695 | seahawkimpex.com | GoDaddy.com, LLC | 3 Aug 2016 | 3 Aug 2016 | 3 Aug 2017 |
| 696 | seahawksdrone.com | - | 4 Aug 2016 | 4 Aug 2016 | 4 Aug 2017 |
| 697 | seahawksjerseyshop.us | - | 4 Aug 2016 | 4 Aug 2016 | 3 Aug 2017 |
| 698 | seahawksoutlet.top | 1API GmbH | 4 Aug 2016 | 17 Sep 2017 | 17 Sep 2017 |
| 699 | seahawksstore.top | 1API GmbH | 4 Aug 2016 | 17 Sep 2017 | 17 Sep 2017 |
| 700 | seahawksfactoryonline.top | 1API GmbH | 4 Aug 2016 | 17 Sep 2017 | 17 Sep 2017 |
| 701 | seahawksjerseysforcheap.top | Jiangsu Bangning Science and technology Co. Ltd. | 4 Aug 2016 | 7 Sep 2017 | 7 Sep 2017 |
| 702 | seahawksjerseyssale.top | Jiangsu Bangning Science and technology Co. Ltd. | 4 Aug 2016 | 7 Sep 2017 | 7 Sep 2017 |
| 703 | seahawkd.com | GoDaddy.com, LLC | 27 Nov 2019 | 27 Nov 2019 | 27 Nov 2020 |
| 704 | seahawka.com | GoDaddy.com, LLC | 5 Nov 2020 | 5 Nov 2020 | 5 Nov 2021 |
| 705 | seahawke.com | Namesilo, LLC | 2 Nov 2020 | 3 Nov 2020 | 2 Nov 2021 |
| 706 | seahawkw.com | - | 6 Aug 2016 | 6 Aug 2016 | 6 Aug 2017 |
| 707 | seahawksvipshop.com | Shanghai Meicheng Technology Information Co., Ltd | 2 Apr 2021 | 2 Apr 2021 | 2 Apr 2022 |
| 708 | seahawksmemes.com | - | 9 Aug 2016 | 9 Aug 2016 | 9 Aug 2017 |
| 709 | seahawksfan.tel | eNom, Inc. | 3 May 2009 | 2 Jun 2025 | 2 May 2026 |
| 710 | seahawksvipstore.com | - | 11 Aug 2016 | 11 Aug 2016 | 11 Aug 2017 |
| 711 | seahawksapparelshop.com | - | 11 Aug 2016 | 11 Aug 2016 | 11 Aug 2017 |
| 712 | seahawksprojerseyshop.com | - | 11 Aug 2016 | 11 Aug 2016 | 11 Aug 2017 |
| 713 | seahawkstix1.com | - | 11 Aug 2016 | 11 Aug 2016 | 11 Aug 2017 |
| 714 | seahawkstix2.com | - | 11 Aug 2016 | 11 Aug 2016 | 11 Aug 2017 |
| 715 | seahawksproshop.us | NameCheap, Inc. | 30 Mar 2023 | 30 Mar 2024 | 30 Mar 2024 |
| 716 | seahawkn.com | - | 18 Aug 2016 | 18 Aug 2016 | 18 Aug 2017 |
| 717 | seahawksplayersgear.com | GoDaddy.com, LLC | 18 Aug 2016 | 9 Aug 2024 | 18 Aug 2025 |
| 718 | seahawkswork.com | - | 20 Aug 2016 | 20 Aug 2016 | 20 Aug 2018 |
| 719 | seahawksvsrams.com | Dynadot, LLC | 30 Jul 2019 | 30 Jul 2019 | 30 Jul 2020 |
| 720 | seahawkgang.com | - | 23 Aug 2016 | 23 Aug 2016 | 23 Aug 2017 |
| 721 | seahawkstundra.com | - | 23 Aug 2016 | 23 Aug 2016 | 23 Aug 2017 |
| 722 | seahawksofficialshop.us | NameCheap, Inc. | 30 Jun 2022 | 30 Jun 2023 | 30 Jun 2023 |
| 723 | seahawks.center | Omnis Network, LLC | 25 Aug 2016 | 29 Sep 2017 | 25 Aug 2018 |
| 724 | seahawksgearproshop.com | 1API GmbH | 25 Aug 2016 | 30 Sep 2017 | 25 Aug 2017 |
| 725 | seahawksteamjerseyshop.com | 1API GmbH | 25 Aug 2016 | 30 Sep 2017 | 25 Aug 2017 |
| 726 | seahawktheatre.org | GoDaddy.com, LLC | 29 Aug 2016 | 4 Aug 2017 | 29 Aug 2018 |
| 727 | seahawksteamsale.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Aug 2016 | 11 Oct 2017 | 30 Aug 2017 |
| 728 | seahawksjerseyvip.com | Namesilo, LLC | 18 Nov 2018 | 19 Nov 2024 | 18 Nov 2025 |
| 729 | seahawkmiami.com | - | 21 Nov 2024 | 31 Mar 2025 | 21 Nov 2025 |
| 730 | seahawkshqs.com | - | 2 Sep 2016 | 2 Sep 2016 | 2 Sep 2017 |
| 731 | seahawksvsramslive.us | - | 31 Aug 2016 | 31 Aug 2016 | 30 Aug 2017 |
| 732 | seahawksvsdolphins.com | eNom, Inc. | 4 Sep 2016 | 17 Oct 2017 | 4 Sep 2017 |
| 733 | seahawksuzuki.com | - | 5 Sep 2016 | 5 Sep 2016 | 5 Sep 2017 |
| 734 | seahawksfansshop.com | GoDaddy.com, LLC | 7 Sep 2021 | 18 Nov 2023 | 7 Sep 2023 |
| 735 | seahawkstailgating.com | Wild West Domains, LLC | 5 Sep 2016 | 6 Aug 2024 | 5 Sep 2025 |
| 736 | seahawksoffcialstore.com | GMO Internet Inc. | 21 Jul 2019 | 22 Jul 2019 | 21 Jul 2020 |
| 737 | seahawksenews.com | Network Solutions, LLC | 20 Sep 2006 | 2 Nov 2024 | 20 Sep 2024 |
| 738 | seahawkgroup.net | GMO Internet Inc. | 10 Dec 2024 | 11 Dec 2024 | 10 Dec 2025 |
| 739 | seahawksgo.com | Dynadot, LLC | 17 Feb 2021 | 18 Feb 2021 | 17 Feb 2022 |
| 740 | seahawksmobile.xyz | GoDaddy.com, LLC | 7 Sep 2016 | 24 Sep 2016 | 7 Sep 2017 |
| 741 | seahawks206.com | GoDaddy.com, LLC | 7 Sep 2016 | 8 Sep 2024 | 7 Sep 2026 |
| 742 | seahawkswireless.xyz | GoDaddy.com, LLC | 7 Sep 2016 | 24 Sep 2016 | 7 Sep 2017 |
| 743 | seahawkswa.com | GoDaddy.com, LLC | 6 Dec 2022 | 7 Dec 2024 | 6 Dec 2025 |
| 744 | seahawksairportparking.com | - | 9 Sep 2016 | 9 Sep 2016 | 9 Sep 2018 |
| 745 | seahawksvsjetslive.us | - | 7 Sep 2016 | 7 Sep 2016 | 6 Sep 2017 |
| 746 | seahawksvsrams-live.us | - | 7 Sep 2016 | 7 Sep 2016 | 6 Sep 2017 |
| 747 | seahawkscanwetalk.com | GoDaddy.com, LLC | 10 Sep 2016 | 4 Jan 2025 | 10 Sep 2025 |
| 748 | seahawksuck.com | GoDaddy.com, LLC | 1 May 2018 | 13 Jul 2024 | 1 May 2024 |
| 749 | seahawkrepair.com | eNom, Inc. | 13 Sep 2016 | 14 Sep 2017 | 13 Sep 2018 |
| 750 | seahawksfansprostore.com | Dynadot, LLC | 22 Jul 2021 | 2 Oct 2023 | 22 Jul 2023 |
| 751 | seahawkscommunity.com | eNom, Inc. | 17 Sep 2016 | 7 Sep 2017 | 17 Sep 2018 |
| 752 | seahawksvs49erslive.us | - | 16 Sep 2016 | 16 Sep 2016 | 15 Sep 2017 |
| 753 | seahawksonlinepro.com | NameCheap, Inc. | 20 Dec 2017 | 21 Dec 2017 | 20 Dec 2018 |
| 754 | seahawkjerseys.us | - | 21 Sep 2016 | 21 Sep 2016 | 20 Sep 2017 |
| 755 | seahawksjersey.us | - | 21 Sep 2016 | 21 Sep 2016 | 20 Sep 2017 |
| 756 | seahawksvs49ers.us | - | 20 Sep 2016 | 20 Sep 2016 | 19 Sep 2017 |
| 757 | seahawkweblog.info | GoDaddy.com, LLC | 21 Sep 2016 | 2 Nov 2017 | 21 Sep 2018 |
| 758 | seahawksoftballcamps.com | GoDaddy.com, LLC | 19 Mar 2009 | 20 Mar 2016 | 19 Mar 2017 |
| 759 | seahawktactical.com | eNom, Inc. | 17 Jul 2013 | 10 Aug 2016 | 17 Jul 2017 |
| 760 | seahawkeltd.com | GoDaddy.com, LLC | 12 Mar 2013 | 13 Mar 2016 | 12 Mar 2017 |
| 761 | seahawksfagship.com | GMO Internet Inc. | 15 Feb 2014 | 9 Feb 2017 | 14 Feb 2018 |
| 762 | seahawk-splash.com | GoDaddy.com, LLC | 11 Oct 2013 | 11 Sep 2015 | 11 Oct 2017 |
| 763 | seahawkssports.com | Omnis Network, LLC | 17 Nov 2005 | 24 Sep 2024 | 17 Nov 2025 |
| 764 | seahawk-anchor.com | Hetzner Online AG | 8 Mar 2012 | 7 Mar 2025 | 8 Mar 2026 |
| 765 | seahawksofficialauthentic.com | Bizcn.com, Inc. | 14 Apr 2014 | 17 Mar 2016 | 14 Apr 2017 |
| 766 | seahawksalumni.com | Network Solutions, LLC | 20 Jul 2004 | 21 May 2025 | 20 Jul 2030 |
| 767 | seahawkponies.com | GoDaddy.com, LLC | 26 Jun 2014 | 27 Jun 2024 | 26 Jun 2025 |
| 768 | seahawkcm.com | GoDaddy.com, LLC | 5 Aug 2010 | 25 May 2015 | 5 Aug 2017 |
| 769 | seahawkworkboats.com | GMO Internet Inc. | 24 Mar 2025 | 24 Mar 2025 | 24 Mar 2026 |
| 770 | seahawkfiji.com | - | 14 Dec 2024 | 14 Dec 2024 | 14 Dec 2025 |
| 771 | seahawkmarijuana.com | GoDaddy.com, LLC | 20 Jan 2014 | 26 Dec 2014 | 20 Jan 2017 |
| 772 | seahawksat.com | HiChina Zhicheng Technology Limited | 22 Mar 2018 | 22 Mar 2018 | 22 Mar 2019 |
| 773 | seahawkmotel.com | Network Solutions, LLC | 8 Jul 1998 | 25 Jun 2024 | 7 Jul 2025 |
| 774 | seahawksnewsdaily.com | GoDaddy.com, LLC | 26 Sep 2012 | 6 Oct 2015 | 26 Sep 2016 |
| 775 | seahawkstemptdestiny.com | 1&1 Internet AG | 2 Jan 2004 | 30 Dec 2022 | 2 Jan 2026 |
| 776 | seahawkstoday.com | GoDaddy.com, LLC | 27 Jul 2007 | 22 Jul 2024 | 27 Jul 2025 |
| 777 | seahawkteamshoponline.com | MarkMonitor Inc. | 19 Nov 2012 | 21 Jun 2017 | 19 Nov 2017 |
| 778 | seahawksnflofficialonline.com | - | 12 Jan 2023 | 15 Mar 2024 | 12 Jan 2024 |
| 779 | seahawkdesigns.com | GoDaddy.com, LLC | 9 Aug 2001 | 28 Mar 2025 | 9 Aug 2027 |
| 780 | seahawktrading.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Sep 2023 | 6 Sep 2024 | 5 Sep 2025 |
| 781 | seahawksplus.com | Google, Inc. | 13 Aug 2019 | 29 Aug 2024 | 13 Aug 2025 |
| 782 | seahawkshater.com | GoDaddy.com, LLC | 11 Dec 2007 | 12 Dec 2014 | 11 Dec 2016 |
| 783 | seahawkpriceguide.com | Namesilo, LLC | 28 Sep 2001 | 6 Nov 2017 | 28 Sep 2018 |
| 784 | seahawksripit.com | GoDaddy.com, LLC | 8 Jan 2010 | 9 Jan 2025 | 8 Jan 2026 |
| 785 | seahawksailing.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Oct 2022 | 18 Oct 2024 | 17 Oct 2025 |
| 786 | seahawknoise.com | GoDaddy.com, LLC | 16 Sep 2013 | 16 Sep 2016 | 16 Sep 2017 |
| 787 | seahawk1.com | GoDaddy.com, LLC | 26 Feb 2018 | 27 Feb 2025 | 26 Feb 2026 |
| 788 | seahawkboyssoccercamps.com | Gandi SAS | 27 Jan 2006 | 24 Dec 2024 | 27 Jan 2026 |
| 789 | seahawkswolfpack.com | GoDaddy.com, LLC | 14 Dec 2012 | 14 Dec 2014 | 14 Dec 2016 |
| 790 | seahawksteamstore.com | GoDaddy.com, LLC | 16 Dec 2013 | 28 Dec 2015 | 16 Dec 2016 |
| 791 | seahawksfan.com | register.com, Inc. | 21 Jun 1997 | 29 Sep 2024 | 20 Jun 2026 |
| 792 | seahawksfootballnetwork.com | register.com, Inc. | 15 Dec 2009 | 15 Dec 2009 | 15 Dec 2016 |
| 793 | seahawkslasvegas.com | 1&1 Internet AG | 3 Aug 2014 | 3 Aug 2016 | 3 Aug 2018 |
| 794 | seahawkcannabis.com | GoDaddy.com, LLC | 20 Jan 2014 | 26 Dec 2014 | 20 Jan 2017 |
| 795 | seahawkerssouth.com | 1&1 Internet AG | 22 Sep 2006 | 5 Dec 2024 | 22 Sep 2024 |
| 796 | seahawkspot.com | GoDaddy.com, LLC | 20 Jan 2014 | 26 Dec 2014 | 20 Jan 2017 |
| 797 | seahawkpaddleboats.com | GoDaddy.com, LLC | 17 Mar 2005 | 3 Feb 2015 | 17 Mar 2017 |
| 798 | seahawksgears.com | GMO Internet Inc. | 31 Dec 2013 | 25 Dec 2015 | 31 Dec 2016 |
| 799 | seahawkobx.com | GoDaddy.com, LLC | 16 Mar 2011 | 22 Mar 2016 | 16 Mar 2018 |
| 800 | seahawksplash.com | GoDaddy.com, LLC | 11 Oct 2013 | 11 Sep 2015 | 11 Oct 2017 |
| 801 | seahawksparade.com | GoDaddy.com, LLC | 4 Feb 2014 | 5 Feb 2016 | 4 Feb 2017 |
| 802 | seahawknest.com | Automattic Inc. | 22 Feb 2022 | 2 Feb 2025 | 22 Feb 2026 |
| 803 | seahawks12man.com | GoDaddy.com, LLC | 4 Dec 2013 | 5 Dec 2015 | 4 Dec 2016 |
| 804 | seahawksfgi.com | Network Solutions, LLC | 21 Mar 2014 | 19 Jan 2025 | 21 Mar 2026 |
| 805 | seahawksschedule.com | GoDaddy.com, LLC | 17 Mar 2021 | 18 Mar 2025 | 17 Mar 2026 |
| 806 | seahawks24-7.com | GoDaddy.com, LLC | 1 Feb 2014 | 2 Feb 2016 | 1 Feb 2017 |
| 807 | seahawksfangear.com | - | 21 Apr 2022 | 22 Apr 2024 | 21 Apr 2025 |
| 808 | seahawksgiveaway.com | GoDaddy.com, LLC | 3 Feb 2014 | 3 Feb 2016 | 3 Feb 2018 |
| 809 | seahawkstiffany.com | Cloud Boom, LLC | 17 Jun 2019 | 17 Jun 2019 | 17 Jun 2020 |
| 810 | seahawksseatingchart.com | GoDaddy.com, LLC | 14 Sep 2009 | 15 Sep 2023 | 14 Sep 2025 |
| 811 | seahawkgouge.com | GoDaddy.com, LLC | 5 Oct 2005 | 15 Sep 2024 | 5 Oct 2025 |
| 812 | seahawksexchange.com | Tucows Domains Inc. | 18 Mar 2013 | 22 Mar 2018 | 18 Mar 2018 |
| 813 | seahawkerope.com | GoDaddy.com, LLC | 18 Jul 2011 | 23 Feb 2012 | 18 Jul 2017 |
| 814 | seahawksnflfan.com | GoDaddy.com, LLC | 9 Jan 2014 | 4 May 2015 | 9 Jan 2017 |
| 815 | seahawkcharter.com | DreamHost, LLC | 7 May 2002 | 5 Apr 2025 | 7 May 2026 |
| 816 | seahawksmagazine.com | GoDaddy.com, LLC | 20 Dec 2012 | 25 Dec 2015 | 20 Dec 2016 |
| 817 | seahawkindia.com | Network Solutions, LLC | 17 Nov 2005 | 19 Nov 2024 | 17 Nov 2026 |
| 818 | seahawkscannabis.com | GoDaddy.com, LLC | 20 Jan 2014 | 26 Dec 2014 | 20 Jan 2017 |
| 819 | seahawktravel.com | GoDaddy.com, LLC | 5 Feb 2014 | 14 Feb 2017 | 5 Feb 2018 |
| 820 | seahawkmedical.com | GoDaddy.com, LLC | 8 Feb 2013 | 8 Feb 2016 | 8 Feb 2017 |
| 821 | seahawktowing.com | Wild West Domains, LLC | 22 May 2012 | 23 May 2025 | 22 May 2026 |
| 822 | seahawkislamujeres.com | eNom, Inc. | 24 May 2012 | 21 May 2025 | 24 May 2026 |
| 823 | seahawksmarijuana.com | GoDaddy.com, LLC | 20 Jan 2014 | 26 Dec 2014 | 20 Jan 2017 |
| 824 | seahawksdesksite.com | GoDaddy.com, LLC | 28 Jul 2010 | 5 Oct 2015 | 1 Jan 2017 |
| 825 | seahawks-jersey-fan-look.com | Bizcn.com, Inc. | 7 Dec 2012 | 9 Jan 2025 | 8 Dec 2025 |
| 826 | seahawkfootball.com | DropCatch.com 1307 LLC | 29 Oct 2021 | 30 Oct 2021 | 29 Oct 2025 |
| 827 | seahawkyachts.com | GoDaddy.com, LLC | 8 Apr 2014 | 9 Apr 2025 | 8 Apr 2026 |
| 828 | seahawks5k.com | GoDaddy.com, LLC | 3 Apr 2014 | 15 Mar 2016 | 3 Apr 2018 |
| 829 | seahawksbus.com | GoDaddy.com, LLC | 22 Sep 2009 | 18 Feb 2025 | 7 Dec 2024 |
| 830 | seahawksfantees.com | Domain.com, LLC | 20 Nov 2013 | 5 Nov 2015 | 20 Nov 2016 |
| 831 | seahawkmuffler.com | TurnCommerce, Inc. DBA NameBright.com | 15 Nov 2012 | 25 Jan 2025 | 15 Nov 2024 |
| 832 | seahawksapparel.com | NameCheap, Inc. | 27 Apr 2010 | 28 Mar 2025 | 27 Apr 2026 |
| 833 | seahawkelvis.com | eNom, Inc. | 16 Dec 2013 | 28 Jan 2025 | 16 Dec 2024 |
| 834 | seahawksjewelry.com | GoDaddy.com, LLC | 9 Jul 2013 | 10 Jul 2016 | 9 Jul 2017 |
| 835 | seahawkadvisory.com | GoDaddy.com, LLC | 29 Jan 2010 | 5 Feb 2024 | 29 Jan 2026 |
| 836 | seahawksub.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jul 2014 | 9 Jun 2024 | 6 Jul 2025 |
| 837 | seahawksweather.com | GoDaddy.com, LLC | 1 Oct 2010 | 9 Oct 2024 | 1 Oct 2025 |
| 838 | seahawkologist.com | GoDaddy.com, LLC | 20 Feb 2014 | 17 Feb 2025 | 20 Feb 2026 |
| 839 | seahawkfans.com | FastDomain Inc. | 17 Aug 2023 | 30 Oct 2024 | 17 Aug 2024 |
| 840 | seahawkiberica.com | Realtime Register B.V. | 27 Jul 2010 | 13 Jul 2017 | 27 Jul 2018 |
| 841 | seahawkradio.com | 1&1 Internet AG | 16 Nov 2006 | 20 Mar 2018 | 16 Nov 2025 |
| 842 | seahawks12thmanarmy.com | GoDaddy.com, LLC | 24 Jan 2014 | 25 Jan 2016 | 24 Jan 2017 |
| 843 | seahawksplayercups.com | GoDaddy.com, LLC | 29 Jul 2014 | 30 Jul 2016 | 29 Jul 2017 |
| 844 | seahawkshouse.com | GoDaddy.com, LLC | 17 Oct 2015 | 17 Oct 2015 | 17 Oct 2016 |
| 845 | seahawkindonesia.com | PT Ardh Global Indonesia | 22 Aug 2013 | 29 Jul 2017 | 22 Aug 2018 |
| 846 | seahawksceo.com | Network Solutions, LLC | 28 Dec 2006 | 29 Oct 2024 | 28 Dec 2027 |
| 847 | seahawkcapitalmanagement.com | GoDaddy.com, LLC | 23 Apr 2014 | 5 May 2016 | 23 Apr 2017 |
| 848 | seahawks-online.com | MarkMonitor Inc. | 18 Oct 2012 | 5 Mar 2016 | 18 Oct 2017 |
| 849 | seahawkarms.com | GoDaddy.com, LLC | 8 Oct 2011 | 10 Sep 2022 | 8 Oct 2031 |
| 850 | seahawkaluminumboattrailers.com | eNom, Inc. | 20 Feb 2009 | 30 Mar 2017 | 20 Feb 2018 |
| 851 | seahawkauthor.com | GoDaddy.com, LLC | 3 Mar 2011 | 4 Mar 2016 | 3 Mar 2017 |
| 852 | seahawkdiver.com | Network Solutions, LLC | 11 Jun 2012 | 24 Aug 2024 | 11 Jun 2024 |
| 853 | seahawksftw.com | Google, Inc. | 12 Jan 2011 | 21 Apr 2024 | 12 Jan 2027 |
| 854 | seahawkgroup.com | Network Solutions, LLC | 10 Feb 2002 | 12 Dec 2021 | 10 Feb 2027 |
| 855 | seahawksdynasty.com | Domain.com, LLC | 19 Jan 2014 | 19 Jan 2017 | 19 Jan 2018 |
| 856 | seahawksmovie.com | GoDaddy.com, LLC | 29 Aug 2007 | 30 Aug 2024 | 29 Aug 2025 |
| 857 | seahawk-systems.com | Network Solutions, LLC | 8 Feb 2012 | 10 Dec 2024 | 8 Feb 2026 |
| 858 | seahawksblog.com | GoDaddy.com, LLC | 1 Apr 2004 | 2 Apr 2025 | 1 Apr 2026 |
| 859 | seahawkmex.com | Gabia, Inc. | 8 Nov 2006 | 11 Nov 2019 | 8 Nov 2022 |
| 860 | seahawkclothing.com | TurnCommerce, Inc. DBA NameBright.com | 14 Jan 2012 | 8 Jan 2021 | 14 Jan 2026 |
| 861 | seahawkssearch.com | Moniker Online Services LLC | 1 Nov 2009 | 22 Jan 2025 | 1 Nov 2025 |
| 862 | seahawkstemp.com | GoDaddy.com, LLC | 20 Aug 2010 | 29 Aug 2016 | 20 Aug 2017 |
| 863 | seahawksportsmedicine.com | GMO Internet Inc. | 29 Jan 2014 | 15 Jul 2016 | 29 Jan 2017 |
| 864 | seahawksjerseyshop.com | MarkMonitor Inc. | 27 Jul 2011 | 13 Feb 2016 | 27 Jul 2017 |
| 865 | seahawkboosterclub.com | Wild West Domains, LLC | 19 Mar 2009 | 20 Mar 2025 | 19 Mar 2026 |
| 866 | seahawksshirt.com | GoDaddy.com, LLC | 10 Apr 2013 | 22 May 2025 | 10 Apr 2025 |
| 867 | seahawkstrainingcamp.com | MarkMonitor Inc. | 4 Jun 2005 | 3 May 2024 | 4 Jun 2026 |
| 868 | seahawktrailers.com | GoDaddy.com, LLC | 27 Jun 2014 | 28 Jun 2023 | 27 Jun 2025 |
| 869 | seahawkwrestling.com | register.com, Inc. | 12 Dec 2012 | 12 May 2017 | 12 Dec 2017 |
| 870 | seahawkstribalsweeps.com | GoDaddy.com, LLC | 4 Sep 2013 | 5 Sep 2015 | 4 Sep 2016 |
| 871 | seahawkupdate.com | GoDaddy.com, LLC | 5 Oct 2007 | 6 Oct 2015 | 5 Oct 2017 |
| 872 | seahawks-shop.com | GoDaddy.com, LLC | 4 Mar 2020 | 4 Mar 2020 | 4 Mar 2021 |
| 873 | seahawksystems.com | 1&1 Internet AG | 26 Jul 2004 | 20 Mar 2018 | 26 Jul 2025 |
| 874 | seahawks-extrapoints.com | MarkMonitor Inc. | 2 Jun 2004 | 2 Aug 2024 | 2 Jun 2026 |
| 875 | seahawkcharters.com | TurnCommerce, Inc. DBA NameBright.com | 21 Dec 2019 | 15 Dec 2020 | 21 Dec 2025 |
| 876 | seahawksf.com | GMO Internet Inc. | 1 Dec 2022 | 12 Jan 2024 | 1 Dec 2023 |
| 877 | seahawk-connect.com | DropCatch.com 615 LLC | 10 Nov 2019 | 10 Nov 2019 | 10 Nov 2020 |
| 878 | seahawk33.com | Japan Registry Services Co., Ltd. | 11 Nov 2013 | 25 Sep 2024 | 11 Nov 2025 |
| 879 | seahawkyouthrugby.com | Dynadot, LLC | 29 Jan 2025 | 30 Jan 2025 | 29 Jan 2026 |
| 880 | seahawksfanatics.com | MarkMonitor Inc. | 13 Sep 2011 | 12 Aug 2024 | 13 Sep 2025 |
| 881 | seahawksteeshirts.com | MarkMonitor Inc. | 6 Aug 2009 | 2 Aug 2024 | 6 Aug 2025 |
| 882 | seahawknation.com | GoDaddy.com, LLC | 25 May 2004 | 25 May 2025 | 25 May 2026 |
| 883 | seahawkbio.com | GoDaddy.com, LLC | 11 Dec 2003 | 1 Dec 2024 | 1 Dec 2026 |
| 884 | seahawks12fan.com | GoDaddy.com, LLC | 14 Jan 2014 | 18 Jan 2016 | 14 Jan 2017 |
| 885 | seahawkbasketball.com | GoDaddy.com, LLC | 12 Apr 2011 | 22 Apr 2016 | 1 Jul 2017 |
| 886 | seahawkboatcompany.com | GoDaddy.com, LLC | 8 Jan 2014 | 8 Jan 2014 | 8 Jan 2017 |
| 887 | seahawksjerseyforsale.com | MarkMonitor Inc. | 29 Nov 2013 | 24 Apr 2016 | 29 Nov 2016 |
| 888 | seahawkeye.com | GoDaddy.com, LLC | 31 May 2012 | 31 May 2016 | 31 May 2017 |
| 889 | seahawkstalkradio.com | GoDaddy.com, LLC | 1 May 2008 | 1 May 2025 | 1 May 2026 |
| 890 | seahawkair.com | Network Solutions, LLC | 12 Nov 1999 | 12 May 2024 | 12 Nov 2029 |
| 891 | seahawkvacations.com | FastDomain Inc. | 9 Nov 2004 | 12 Nov 2023 | 9 Nov 2026 |
| 892 | seahawksfanatic.com | GoDaddy.com, LLC | 31 May 2021 | 31 May 2021 | 31 May 2022 |
| 893 | seahawkint.com | Inames Co. Ltd. | 3 Nov 2011 | 10 Nov 2017 | 3 Nov 2017 |
| 894 | seahawksshoponline.com | MarkMonitor Inc. | 24 Oct 2012 | 15 Mar 2016 | 24 Oct 2017 |
| 895 | seahawkherb.com | GoDaddy.com, LLC | 20 Jan 2014 | 26 Dec 2014 | 20 Jan 2017 |
| 896 | seahawksticketexchange.com | GoDaddy.com, LLC | 2 Mar 2017 | 13 Apr 2024 | 2 Mar 2024 |
| 897 | seahawksparking.com | Network Solutions, LLC | 16 Aug 2005 | 17 Jun 2020 | 16 Aug 2025 |
| 898 | seahawkspolevault.com | West263 International Limited | 6 Oct 2020 | 6 Oct 2020 | 6 Oct 2021 |
| 899 | seahawkuk.com | NameCamp Limited | 4 Apr 2013 | 13 Mar 2025 | 4 Apr 2026 |
| 900 | seahawkjewelleryandwhatnot.com | Tucows Domains Inc. | 19 Feb 2014 | 6 Jan 2025 | 19 Feb 2026 |
| 901 | seahawkfreight.com | TurnCommerce, Inc. DBA NameBright.com | 19 Jan 2019 | 19 Jan 2019 | 19 Jan 2020 |
| 902 | seahawksextrapoints.com | MarkMonitor Inc. | 2 Jun 2004 | 2 Aug 2024 | 2 Jun 2026 |
| 903 | seahawkscore.com | GoDaddy.com, LLC | 14 Feb 2014 | 14 Feb 2016 | 14 Feb 2018 |
| 904 | seahawkstickets.com | eNom, Inc. | 11 Oct 1997 | 11 Sep 2024 | 10 Oct 2025 |
| 905 | seahawkconsulting.com | TurnCommerce, Inc. DBA NameBright.com | 10 Mar 2020 | 27 Aug 2021 | 10 Mar 2026 |
| 906 | seahawksbar.com | DomainPeople, Inc. | 9 Dec 2004 | 10 Nov 2017 | 9 Dec 2017 |
| 907 | seahawkstv.com | Wild West Domains, LLC | 23 Jan 2012 | 24 Jan 2016 | 23 Jan 2017 |
| 908 | seahawker.com | Webfusion Ltd. | 30 Dec 2008 | 10 Apr 2025 | 30 Dec 2025 |
| 909 | seahawksswimming.com | - | 24 Oct 2024 | 26 May 2025 | 18 Nov 2025 |
| 910 | seahawkfishingcharters.com | Google, Inc. | 15 Nov 2023 | 27 Jan 2025 | 15 Nov 2024 |
| 911 | seahawkdrilling.com | Network Solutions, LLC | 28 Jan 2009 | 29 Jan 2025 | 28 Jan 2035 |
| 912 | seahawk-clothing.com | Tucows Domains Inc. | 10 Nov 2008 | 14 Nov 2018 | 10 Nov 2018 |
| 913 | seahawkspodcast.com | Wild West Domains, LLC | 6 Mar 2010 | 7 Mar 2025 | 6 Mar 2026 |
| 914 | seahawksrants.com | - | 1 Nov 2008 | 1 Nov 2008 | 1 Nov 2017 |
| 915 | seahawkspotter.com | - | 2 May 2021 | 4 May 2021 | 2 May 2022 |
| 916 | seahawksnoise.com | GoDaddy.com, LLC | 16 Sep 2013 | 16 Sep 2016 | 16 Sep 2017 |
| 917 | seahawkmaritime.com | Papaki Ltd. | 17 Mar 2013 | 29 May 2023 | 17 Mar 2028 |
| 918 | seahawkstageproductions.com | GoDaddy.com, LLC | 17 Oct 2006 | 18 Oct 2015 | 17 Oct 2016 |
| 919 | seahawkrealty.com | NameKing.com Inc. | 9 Jan 2021 | 24 Mar 2024 | 9 Jan 2024 |
| 920 | seahawkslovers.com | MarkMonitor Inc. | 11 Oct 2012 | 20 Mar 2016 | 11 Oct 2017 |
| 921 | seahawkinshorefishingcharters.com | register.com, Inc. | 7 Feb 2007 | 17 Jan 2023 | 7 Feb 2026 |
| 922 | seahawks101.com | GoDaddy.com, LLC | 21 Apr 2011 | 21 Apr 2016 | 21 Apr 2017 |
| 923 | seahawkpublishing.com | register.com, Inc. | 17 Nov 2003 | 17 Nov 2003 | 17 Nov 2019 |
| 924 | seahawkslockerroom.com | NameCheap, Inc. | 25 Apr 2019 | 25 Apr 2019 | 25 Apr 2020 |
| 925 | seahawkjerseycheap.com | MarkMonitor Inc. | 8 Oct 2013 | 24 Apr 2016 | 8 Oct 2016 |
| 926 | seahawkpot.com | GoDaddy.com, LLC | 20 Jan 2014 | 30 Dec 2017 | 20 Jan 2019 |
| 927 | seahawksrewardscard.com | GoDaddy.com, LLC | 5 Feb 2014 | 13 Nov 2015 | 5 Feb 2017 |
| 928 | seahawktravels.com | GoDaddy.com, LLC | 19 Jun 2024 | 19 Jun 2024 | 19 Jun 2025 |
| 929 | seahawks12thmoms.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 22 Jul 2014 | 22 Jul 2024 | 22 Jul 2025 |
| 930 | seahawksunday.com | GoDaddy.com, LLC | 30 Jan 2006 | 28 Jan 2025 | 30 Jan 2026 |
| 931 | seahawks-connect.com | RegistryGate GmbH | 26 Sep 2011 | 31 Oct 2017 | 26 Sep 2018 |
| 932 | seahawkstowingseattlewa.com | GoDaddy.com, LLC | 7 Oct 2009 | 25 Sep 2011 | 7 Oct 2020 |
| 933 | seahawkequity.com | NameCheap, Inc. | 20 Apr 2013 | 21 Mar 2025 | 20 Apr 2026 |
| 934 | seahawkswingman.com | GoDaddy.com, LLC | 21 Nov 2013 | 26 Nov 2015 | 21 Nov 2016 |
| 935 | seahawkfanatics.com | MarkMonitor Inc. | 15 Apr 2011 | 14 Mar 2025 | 15 Apr 2026 |
| 936 | seahawkschedule.com | Internet Domain Services BS Corp | 26 Aug 2013 | 15 Dec 2015 | 26 Aug 2017 |
| 937 | seahawkscsl.com | GoDaddy.com, LLC | 25 Jan 2006 | 24 Jan 2015 | 25 Jan 2017 |
| 938 | seahawksweed.com | GoDaddy.com, LLC | 20 Jan 2014 | 26 Dec 2014 | 20 Jan 2017 |
| 939 | seahawkstix.com | Wild West Domains, LLC | 16 Jul 2003 | 17 Jul 2016 | 16 Jul 2017 |
| 940 | seahawkexim.com | - | 26 Sep 2016 | 26 Sep 2016 | 26 Sep 2017 |
| 941 | seahawkteddybears.com | register.com, Inc. | 26 Jan 2015 | 26 Jan 2015 | 26 Jan 2018 |
| 942 | seahawksteam.com | MarkMonitor Inc. | 1 May 2005 | 30 Mar 2025 | 1 May 2027 |
| 943 | seahawkartmuseum.com | GMO Internet Inc. | 1 Apr 2019 | 1 Apr 2019 | 1 Apr 2020 |
| 944 | seahawksmix.com | Wild West Domains, LLC | 11 Apr 2008 | 12 Apr 2016 | 11 Apr 2017 |
| 945 | seahawksal.com | Google, Inc. | 16 Apr 2001 | 25 Mar 2025 | 16 Apr 2027 |
| 946 | seahawks-jerseys-store.com | MarkMonitor Inc. | 25 Sep 2012 | 5 Mar 2016 | 25 Sep 2017 |
| 947 | seahawkmarine.com | GoDaddy.com, LLC | 27 Jun 2013 | 11 Feb 2025 | 27 Jun 2027 |
| 948 | seahawkbaseballcamps.com | GoDaddy.com, LLC | 16 Sep 2008 | 17 Sep 2024 | 16 Sep 2026 |
| 949 | seahawklogistic.com | Tucows Domains Inc. | 28 Feb 2012 | 27 Feb 2025 | 28 Feb 2026 |
| 950 | seahawksuniforms.com | HiChina Zhicheng Technology Limited | 31 Mar 2018 | 31 Mar 2018 | 31 Mar 2019 |
| 951 | seahawks-jersey2012.com | MarkMonitor Inc. | 20 Sep 2012 | 21 Sep 2016 | 20 Sep 2017 |
| 952 | seahawkmedia.com | GoDaddy.com, LLC | 4 Jul 2012 | 5 Jul 2024 | 4 Jul 2025 |
| 953 | seahawksct.com | GoDaddy.com, LLC | 8 Sep 2009 | 9 Sep 2024 | 8 Sep 2026 |
| 954 | seahawksfever.com | GoDaddy.com, LLC | 11 Jan 2014 | 23 Jan 2016 | 11 Jan 2017 |
| 955 | seahawkav8.com | GoDaddy.com, LLC | 9 Feb 2012 | 29 Aug 2012 | 29 Aug 2017 |
| 956 | seahawksfootballprostore.com | Bizcn.com, Inc. | 7 Nov 2013 | 26 Oct 2015 | 7 Nov 2016 |
| 957 | seahawktuff.com | Gandi SAS | 28 Nov 2013 | 11 Nov 2017 | 28 Nov 2017 |
| 958 | seahawksquarterbacks.com | GoDaddy.com, LLC | 2 Jan 2011 | 13 Jan 2025 | 2 Jan 2026 |
| 959 | seahawktalk.com | GoDaddy.com, LLC | 27 Jul 2007 | 22 Jul 2024 | 27 Jul 2025 |
| 960 | seahawkinvite.com | Launchpad, Inc. | 2 Jun 2014 | 22 May 2016 | 2 Jun 2017 |
| 961 | seahawksmemberrewardstv.com | GoDaddy.com, LLC | 25 Feb 2014 | 8 Jan 2016 | 25 Feb 2018 |
| 962 | seahawk1coa.com | Wild West Domains, LLC | 8 Apr 2014 | 9 Apr 2016 | 8 Apr 2017 |
| 963 | seahawksfansshop2u.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Aug 2013 | 27 Sep 2016 | 22 Aug 2016 |
| 964 | seahawkers.com | eNom, Inc. | 14 Jul 2003 | 23 Jan 2025 | 14 Jul 2026 |
| 965 | seahawkranch.com | Network Solutions, LLC | 9 Mar 1999 | 5 Mar 2017 | 9 Mar 2019 |
| 966 | seahawkcocktaillounge.com | Dynadot, LLC | 31 Aug 2021 | 31 Aug 2021 | 31 Aug 2022 |
| 967 | seahawkprint.com | GoDaddy.com, LLC | 22 Jan 2014 | 4 May 2015 | 22 Jan 2017 |
| 968 | seahawks-lights.com | Network Solutions, LLC | 7 Sep 2013 | 9 Sep 2016 | 7 Sep 2017 |
| 969 | seahawksofficialnflonline.com | Dynadot, LLC | 8 Apr 2022 | 24 Mar 2025 | 8 Apr 2026 |
| 970 | seahawkshub.com | - | 27 Sep 2022 | 28 Sep 2023 | 27 Sep 2024 |
| 971 | seahawkshop.com | GoDaddy.com, LLC | 17 Dec 2008 | 26 Nov 2024 | 17 Dec 2025 |
| 972 | seahawksnews.com | Network Solutions, LLC | 16 Aug 2001 | 1 Aug 2024 | 16 Aug 2025 |
| 973 | seahawkscentral.com | GoDaddy.com, LLC | 5 Dec 2018 | 5 Dec 2024 | 5 Dec 2025 |
| 974 | seahawkrock.com | Network Solutions, LLC | 16 Dec 2010 | 16 Oct 2020 | 16 Dec 2025 |
| 975 | seahawksflag.com | GoDaddy.com, LLC | 11 Apr 2024 | 5 Apr 2025 | 11 Apr 2026 |
| 976 | seahawksclub.com | GoDaddy.com, LLC | 19 Jun 2008 | 31 Aug 2024 | 19 Jun 2024 |
| 977 | seahawkrugby.com | 1&1 Internet AG | 9 May 2013 | 22 May 2023 | 9 May 2026 |
| 978 | seahawkshop2012.com | MarkMonitor Inc. | 15 Oct 2012 | 20 Mar 2016 | 15 Oct 2017 |
| 979 | seahawksoccercamps.com | Gandi SAS | 27 Jan 2006 | 24 Dec 2024 | 27 Jan 2026 |
| 980 | seahawkswin.com | NameCheap, Inc. | 14 Sep 2019 | - | 14 Sep 2020 |
| 981 | seahawklogitech.com | Network Solutions, LLC | 9 Apr 2001 | 28 Jun 2017 | 9 Apr 2027 |
| 982 | seahawkct.com | GoDaddy.com, LLC | 8 Sep 2009 | 9 Sep 2024 | 8 Sep 2026 |
| 983 | seahawkshats.com | MarkMonitor Inc. | 6 Aug 2009 | 5 Jul 2024 | 6 Aug 2025 |
| 984 | seahawkscience.com | register.com, Inc. | 5 Sep 2013 | 7 Sep 2016 | 5 Sep 2017 |
| 985 | seahawksfootballestore.com | MarkMonitor Inc. | 12 Oct 2013 | 24 Apr 2016 | 12 Oct 2016 |
| 986 | seahawkprojects.com | GoDaddy.com, LLC | 9 Mar 2006 | 11 Apr 2008 | 9 Mar 2018 |
| 987 | seahawktrailer.com | FastDomain Inc. | 22 Sep 2019 | 22 Sep 2019 | 22 Sep 2020 |
| 988 | seahawksofficialjerseysshop.com | MarkMonitor Inc. | 27 Nov 2012 | 21 Jun 2017 | 27 Nov 2017 |
| 989 | seahawkssuperbowlpackages.com | GoDaddy.com, LLC | 14 Jan 2011 | 15 Jan 2016 | 14 Jan 2017 |
| 990 | seahawksofficialnflproshop.com | Tucows Domains Inc. | 31 May 2019 | 31 May 2019 | 31 May 2020 |
| 991 | seahawksstadium.com | Network Solutions, LLC | 23 May 2002 | 24 Mar 2025 | 23 May 2026 |
| 992 | seahawksoccercamp.com | Gandi SAS | 5 Mar 2012 | 30 Jan 2025 | 5 Mar 2026 |
| 993 | seahawkbud.com | GoDaddy.com, LLC | 20 Jan 2014 | 30 Dec 2017 | 20 Jan 2019 |
| 994 | seahawkenterprises.com | GMO Internet Inc. | 11 Dec 2008 | 17 Nov 2024 | 11 Dec 2025 |
| 995 | seahawksphoto.com | GoDaddy.com, LLC | 1 Mar 2014 | 2 Mar 2016 | 1 Mar 2017 |
| 996 | seahawksupplycorp.com | Tucows Domains Inc. | 29 Jun 2005 | 31 May 2024 | 29 Jun 2025 |
| 997 | seahawkthailand.com | GMO Internet Inc. | 7 Mar 2024 | 27 Feb 2025 | 7 Mar 2026 |
| 998 | seahawkorchard.com | GoDaddy.com, LLC | 5 May 2014 | 6 May 2025 | 5 May 2027 |
| 999 | seahawkscamp.com | Moniker Online Services LLC | 1 Aug 2001 | 6 Sep 2017 | 1 Aug 2018 |
| 1000 | seahawkplates.com | GoDaddy.com, LLC | 13 Dec 2013 | 13 Dec 2015 | 13 Dec 2016 |
Displaying 1,000 out of 2,286 domains starting with the keyword "SEAHAWK". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=seahawk
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |