With support for 
Keyword: ROCKER
Reverse Whois » KEYWORD [rocker ] { 4,382 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | rocker.info | NameKing.com Inc. | 14 May 2018 | 28 Feb 2025 | 14 May 2026 |
| 2 | rocker.us | GoDaddy.com, LLC | 16 Jun 2014 | 17 Jun 2017 | 15 Jun 2018 |
| 3 | rocker.org | - | 3 Jul 2004 | 28 Sep 2025 | 3 Jul 2026 |
| 4 | rocker.tokyo | GMO Internet Inc. | 23 Jul 2014 | 23 Jul 2014 | 23 Jul 2015 |
| 5 | rocker.rocks | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Feb 2016 | 5 Apr 2017 | 19 Feb 2018 |
| 6 | rocker.hamburg | Secura GmbH | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 7 | rocker.life | Xin Net Technology Corporation | - | 8 Mar 2025 | 10 Mar 2026 |
| 8 | rocker.city | united-domains AG | 8 Oct 2014 | 9 Oct 2014 | 8 Oct 2015 |
| 9 | rocker.website | Mesh Digital Limited | 13 Aug 2015 | 14 Aug 2015 | 13 Aug 2016 |
| 10 | rocker.rip | united-domains AG | 28 Jan 2015 | 29 Jan 2015 | 28 Jan 2016 |
| 11 | rocker.red | GMO Internet Inc. | 24 Jan 2015 | 20 Nov 2015 | 24 Jan 2016 |
| 12 | rocker.company | Name.com, Inc. | 8 Sep 2022 | 8 Sep 2022 | 8 Sep 2023 |
| 13 | rocker.community | 1&1 Internet AG | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 14 | rocker.click | Uniregistrar Corp | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 15 | rocker.band | GoDaddy.com, LLC | 9 Aug 2016 | 9 Aug 2016 | 9 Aug 2017 |
| 16 | rocker.pub | - | 7 Aug 2023 | 20 Sep 2024 | 7 Aug 2024 |
| 17 | rocker.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 7 Jul 2015 | 7 Jul 2015 | 7 Jul 2016 |
| 18 | rocker.news | Name.com, Inc. | 11 Mar 2021 | 23 Apr 2024 | 11 Mar 2024 |
| 19 | rocker.cafe | united-domains AG | 15 Jul 2015 | 16 Jul 2015 | 15 Jul 2016 |
| 20 | rocker.design | Dynadot, LLC | 26 Oct 2023 | 26 Oct 2024 | 26 Oct 2024 |
| 21 | rocker.agency | Google, Inc. | 4 Mar 2023 | 3 May 2024 | 4 Mar 2024 |
| 22 | rocker.beer | Domeneshop AS dba domainnameshop.com | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2016 |
| 23 | rocker.press | NameCheap, Inc. | 8 May 2015 | 1 May 2025 | 8 May 2026 |
| 24 | rocker.ski | Key-Systems, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 25 | rocker.pics | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 8 Sep 2015 | - | 8 Sep 2016 |
| 26 | rocker.koeln | RegistryGate GmbH | 20 Sep 2015 | 26 Nov 2025 | 20 Sep 2026 |
| 27 | rocker.mobi | GoDaddy.com, LLC | 16 Jan 2019 | 27 Apr 2020 | 16 Jan 2021 |
| 28 | rocker.top | Dynadot, LLC | 7 Aug 2025 | 7 Aug 2025 | 7 Aug 2026 |
| 29 | rocker.miami | Go China Domains, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 30 | rocker.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 16 Oct 2025 | 15 Oct 2026 |
| 31 | rocker.space | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Oct 2015 | - | 19 Oct 2016 |
| 32 | rocker.site | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Oct 2015 | - | 19 Oct 2016 |
| 33 | rocker.online | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Oct 2015 | - | 19 Oct 2016 |
| 34 | rocker.soccer | GoDaddy.com, LLC | 28 Nov 2015 | 28 Nov 2015 | 28 Nov 2016 |
| 35 | rocker.link | NameCheap, Inc. | 19 Nov 2018 | 4 Nov 2025 | 19 Nov 2026 |
| 36 | rocker.pro | - | 30 Nov 2024 | 1 Dec 2025 | - |
| 37 | rocker.com | Domaininfo AB, aka domaininfo.com | 23 Oct 1997 | 13 Nov 2025 | 22 Oct 2026 |
| 38 | rocker.tech | GoDaddy.com, LLC | 5 Apr 2016 | 4 Jul 2017 | 5 Apr 2018 |
| 39 | rocker.computer | GoDaddy.com, LLC | 5 Apr 2016 | 20 May 2017 | 5 Apr 2018 |
| 40 | rocker.cloud | Tucows Domains Inc. | 14 Nov 2019 | 18 Nov 2021 | 14 Nov 2021 |
| 41 | rocker.mom | Dynadot, LLC | 23 Oct 2025 | 29 Oct 2025 | 23 Oct 2026 |
| 42 | rocker.group | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Nov 2017 | 14 Nov 2017 | 9 Nov 2027 |
| 43 | rocker.party | CloudFlare, Inc. | 24 Jun 2025 | 14 Oct 2025 | 24 Jun 2026 |
| 44 | rocker.clothing | Cronon AG | 3 Mar 2014 | 17 Apr 2020 | 3 Mar 2021 |
| 45 | rocker.shoes | GoDaddy.com, LLC | 6 Mar 2014 | 20 Apr 2025 | 6 Mar 2026 |
| 46 | rocker.lol | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Apr 2023 | 10 Jun 2024 | 30 Apr 2024 |
| 47 | rocker.biz | Namesilo, LLC | 14 Nov 2025 | 15 Nov 2025 | 14 Nov 2026 |
| 48 | rocker.email | Uniregistrar Corp | 7 Oct 2017 | 22 Jun 2020 | 7 Oct 2020 |
| 49 | rocker.ren | - | 4 Aug 2016 | 4 Aug 2016 | 4 Aug 2017 |
| 50 | rocker.house | NameCheap, Inc. | 10 Aug 2016 | 16 Jul 2019 | 10 Aug 2020 |
| 51 | rocker.dance | NameCheap, Inc. | 10 Aug 2016 | 17 Jul 2017 | 10 Aug 2018 |
| 52 | rocker.net | Domain.com, LLC | 31 Mar 1998 | 21 Sep 2025 | 30 Mar 2035 |
| 53 | rocker.xxx | Dynadot, LLC | 7 Dec 2011 | 2 Dec 2017 | 7 Dec 2018 |
| 54 | rocker.xyz | Name.com, Inc. | 9 Jun 2014 | 1 Jul 2025 | 9 Jun 2026 |
| 55 | rocker.de | - | - | 23 Nov 2023 | - |
| 56 | rocker.tips | GoDaddy.com, LLC | 21 Nov 2016 | 22 Nov 2017 | 21 Nov 2018 |
| 57 | rocker.science | Key-Systems, LLC | 23 Feb 2017 | 14 Oct 2025 | 22 Feb 2027 |
| 58 | rocker.foundation | eNom, Inc. | 30 Mar 2017 | 29 Sep 2017 | 30 Mar 2018 |
| 59 | rocker.world | CommuniGal Communication Ltd. | 4 Jan 2025 | 9 Jan 2025 | 4 Jan 2026 |
| 60 | rocker.live | CommuniGal Communication Ltd. | 18 Oct 2024 | 30 Nov 2025 | 18 Oct 2025 |
| 61 | rocker.today | GoDaddy.com, LLC | 7 Aug 2017 | 7 Aug 2017 | 7 Aug 2018 |
| 62 | rocker.ltd | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 2 Oct 2017 | 20 Nov 2017 | 2 Oct 2020 |
| 63 | rocker.family | Tucows Domains Inc. | 24 Nov 2017 | 24 Nov 2017 | 24 Nov 2018 |
| 64 | rocker.edu.pl | - | 13 Jul 2015 | 13 Jun 2025 | 13 Jul 2026 |
| 65 | rocker.dev | Google, Inc. | 1 Mar 2019 | 6 Mar 2019 | 1 Mar 2020 |
| 66 | rocker.com.co | CommuniGal Communication Ltd. | 1 Jul 2019 | 6 Jul 2019 | 1 Jul 2020 |
| 67 | rocker.cat | Tucows Domains Inc. | 1 Oct 2020 | 11 Nov 2025 | 1 Oct 2025 |
| 68 | rocker.institute | Namesilo, LLC | 5 Nov 2020 | 5 Nov 2020 | 5 Nov 2021 |
| 69 | rocker.realty | Epik Inc. | 15 Nov 2020 | 15 Nov 2020 | 15 Nov 2021 |
| 70 | rocker.host | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Dec 2020 | - | 24 Dec 2021 |
| 71 | rocker.love | Wild West Domains, LLC | 25 Jul 2023 | 8 Sep 2025 | 25 Jul 2026 |
| 72 | rocker.style | GoDaddy.com, LLC | 6 Mar 2021 | 6 Mar 2021 | 6 Mar 2022 |
| 73 | rocker.golf | GoDaddy.com, LLC | 30 Apr 2021 | 14 Jun 2025 | 30 Apr 2026 |
| 74 | rocker.industries | Network Solutions, LLC | 2 May 2021 | 2 May 2021 | 2 May 2022 |
| 75 | rocker.network | NameCheap, Inc. | 31 Jul 2021 | 5 Aug 2021 | 31 Jul 2022 |
| 76 | rocker.me | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 1 Nov 2025 | 2 Nov 2025 | 1 Nov 2026 |
| 77 | rocker.ws | GoDaddy.com, LLC | 7 Mar 2020 | 18 Apr 2024 | 7 Mar 2024 |
| 78 | rocker.services | Vautron Rechenzentrum AG | 11 Oct 2021 | 12 Oct 2025 | 11 Oct 2026 |
| 79 | rocker.chat | Dynadot, LLC | 9 Nov 2021 | 9 Nov 2022 | 9 Nov 2023 |
| 80 | rocker.digital | GoDaddy.com, LLC | 1 Dec 2021 | 12 Jan 2025 | 1 Dec 2024 |
| 81 | rocker.holdings | Name.com, Inc. | 31 Mar 2022 | 13 Mar 2025 | 31 Mar 2026 |
| 82 | rocker.finance | Porkbun, LLC | 17 Apr 2022 | 30 Apr 2023 | 17 Apr 2024 |
| 83 | rocker.team | Name.com, Inc. | 23 Jun 2022 | 23 Jun 2025 | 23 Jun 2026 |
| 84 | rocker.media | CloudFlare, Inc. | 30 Jun 2022 | 8 Sep 2024 | 30 Jun 2024 |
| 85 | rocker.rest | - | 27 Jul 2022 | - | 27 Jul 2023 |
| 86 | rocker.com.br | - | 31 Jan 2000 | 7 Nov 2024 | 31 Jan 2026 |
| 87 | rocker.ca | - | 9 Aug 2005 | 10 Jul 2025 | 9 Aug 2026 |
| 88 | rocker.bike | NameCheap, Inc. | 31 Dec 2021 | 13 Mar 2025 | 31 Dec 2024 |
| 89 | rocker.cc | Porkbun, LLC | 12 Oct 2025 | 26 Oct 2025 | 12 Oct 2026 |
| 90 | rocker.co | GoDaddy.com, LLC | 20 Jul 2010 | 25 Jul 2025 | 19 Jul 2027 |
| 91 | rocker.by | - | 16 Jan 2018 | 29 Dec 2024 | 16 Jan 2027 |
| 92 | rocker.hair | NameCheap, Inc. | 23 Feb 2023 | 5 Apr 2024 | 23 Feb 2024 |
| 93 | rocker.ie | Protocol Internet Technology Limited T/A Hosting I… | 11 Mar 2022 | 11 Mar 2023 | 11 Mar 2024 |
| 94 | rocker.io | GoDaddy.com, LLC | 23 May 2015 | 14 Sep 2024 | 23 May 2027 |
| 95 | rocker.co.jp | - | - | 1 Apr 2025 | - |
| 96 | rocker.monster | Limited Liability Company "Registrar of domain nam… | 21 Jan 2024 | 2 Mar 2025 | 21 Jan 2025 |
| 97 | rocker.one | Cronon AG | 23 Oct 2017 | 15 Oct 2025 | 23 Oct 2026 |
| 98 | rocker.bio | NameCheap, Inc. | 6 May 2023 | 17 Jun 2024 | 6 May 2024 |
| 99 | rocker.tv | 1API GmbH | 23 Mar 2017 | 14 Apr 2024 | 23 Mar 2024 |
| 100 | rocker.ro | - | 17 Nov 2018 | - | 15 Nov 2025 |
| 101 | rocker.boo | Porkbun, LLC | 27 Jul 2023 | 26 Jul 2025 | 27 Jul 2026 |
| 102 | rocker.icu | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Aug 2023 | 28 Apr 2024 | 9 Aug 2033 |
| 103 | rocker.in.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Sep 2023 | 8 Nov 2024 | 2 Sep 2024 |
| 104 | rocker.markets | NameCheap, Inc. | 25 Nov 2023 | 6 Jan 2025 | 25 Nov 2024 |
| 105 | rocker.baby | Dynadot, LLC | 2 May 2025 | 17 Jun 2025 | 2 May 2026 |
| 106 | rocker.com.pl | - | 3 Oct 2023 | 31 Oct 2024 | - |
| 107 | rocker.co.in | - | 3 Jan 2019 | 12 Jan 2025 | 3 Jan 2026 |
| 108 | rocker.co.uk | - | 5 Dec 2025 | 12 Dec 2025 | 5 Dec 2026 |
| 109 | rocker.surf | GoDaddy.com, LLC | 24 Oct 2019 | 30 Oct 2025 | 24 Oct 2026 |
| 110 | rocker.uk | - | 7 Apr 2022 | 5 Apr 2025 | 7 Apr 2026 |
| 111 | rocker.sk | - | 22 Apr 2013 | 23 Apr 2025 | 22 Apr 2026 |
| 112 | rocker.su | - | 5 Mar 2022 | - | 5 Mar 2026 |
| 113 | rocker.se | - | 10 Dec 2008 | 3 Dec 2025 | 10 Dec 2026 |
| 114 | rocker.hu | - | 18 Jun 2004 | - | - |
| 115 | rocker.ink | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 May 2024 | 31 May 2025 | 30 May 2025 |
| 116 | rocker.tours | NameCheap, Inc. | 6 Jun 2024 | 6 Jun 2025 | 6 Jun 2026 |
| 117 | rocker.lat | - | 24 Jul 2024 | 25 Jul 2025 | 24 Jul 2026 |
| 118 | rocker.foo | Porkbun, LLC | 25 Sep 2024 | 25 Sep 2024 | 25 Sep 2025 |
| 119 | rocker.buzz | - | 15 Feb 2025 | 22 Oct 2025 | 15 Feb 2026 |
| 120 | rocker.so | NameCheap, Inc. | 4 Jul 2022 | 15 Aug 2025 | 4 Jul 2025 |
| 121 | rocker.construction | CloudFlare, Inc. | 2 May 2025 | 13 May 2025 | 2 May 2026 |
| 122 | rocker.it | - | 11 Aug 2006 | 19 Dec 2025 | 18 Dec 2025 |
| 123 | rocker.studio | - | 26 Jul 2025 | 26 Jul 2025 | - |
| 124 | rocker.jp | - | 26 Mar 2001 | 1 Apr 2025 | 31 Mar 2026 |
| 125 | rockerwap.com | One.com A/S | 8 Jan 2019 | 9 Jan 2019 | 8 Jan 2020 |
| 126 | rockeros.net | DreamHost, LLC | 10 Dec 2003 | 11 Dec 2025 | 11 Dec 2026 |
| 127 | rockersinfo.com | GoDaddy.com, LLC | 24 Jul 2008 | 25 Jul 2025 | 24 Jul 2026 |
| 128 | rockersonbraodway.com | EPAG Domainservices GmbH | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 129 | rockersneeded.com | GoDaddy.com, LLC | 22 Oct 2014 | 17 Aug 2016 | 22 Oct 2017 |
| 130 | rocker-info.net | Dynadot, LLC | 20 Aug 2024 | 9 Jul 2025 | 20 Aug 2026 |
| 131 | rockerfm.com | HiChina Zhicheng Technology Limited | 1 Jul 2014 | 10 May 2024 | 1 Jul 2026 |
| 132 | rockerheads.com.br | - | 10 Dec 2010 | 1 Sep 2015 | 10 Dec 2016 |
| 133 | rockerportal.de | - | - | 8 Dec 2025 | - |
| 134 | rockerzine.com | 1&1 Internet AG | 23 Aug 2010 | 5 Oct 2018 | 23 Aug 2026 |
| 135 | rockersneeded.info | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 136 | rockersneeded.org | GoDaddy.com, LLC | 22 Oct 2014 | 17 Aug 2016 | 22 Oct 2017 |
| 137 | rockersneeded.net | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 138 | rockerypondandwallingstone.com | 1&1 Internet AG | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 139 | rockersdeluxe.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2016 |
| 140 | rockerek.hu | - | 6 Apr 2005 | - | - |
| 141 | rockerinn.com | Key-Systems GmbH | 17 Nov 2022 | 31 Jan 2024 | 17 Nov 2023 |
| 142 | rockershop.sk | - | 24 Jul 2009 | 5 Aug 2025 | 24 Jul 2026 |
| 143 | rockerstelevision.com | GoDaddy.com, LLC | 29 May 2008 | 22 Apr 2025 | 29 May 2026 |
| 144 | rockertvmedia.com | GoDaddy.com, LLC | 29 May 2008 | 29 May 2025 | 29 May 2026 |
| 145 | rockerzin.net | Blue Razor Domains, LLC | 31 Oct 2006 | 11 Nov 2007 | 31 Oct 2016 |
| 146 | rockerstalkers.com | GoDaddy.com, LLC | 21 May 2011 | 22 May 2015 | 21 May 2016 |
| 147 | rockersind.biz | OnlineNIC, Inc. | 24 Apr 2018 | - | 24 Apr 2019 |
| 148 | rockermomrambles.com | - | 10 Aug 2016 | 10 Aug 2016 | 10 Aug 2017 |
| 149 | rockersclub.com | eNom, Inc. | 5 Jan 2010 | 10 Jan 2025 | 5 Jan 2026 |
| 150 | rockerradio.com | eNom, Inc. | 7 May 2011 | 11 Dec 2025 | 7 May 2026 |
| 151 | rockerszene.com | eNom, Inc. | 6 Jun 2011 | 15 Jun 2017 | 6 Jun 2018 |
| 152 | rockersroots.com | Xin Net Technology Corporation | 22 Feb 2021 | 11 Dec 2021 | 22 Feb 2022 |
| 153 | rockernetwork.com | eNom, Inc. | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 154 | rockersrus.com | GoDaddy.com, LLC | 24 Oct 2012 | 25 Oct 2025 | 24 Oct 2026 |
| 155 | rockerskingdom.com | GoDaddy.com, LLC | 5 Apr 2015 | 5 Apr 2015 | 5 Apr 2016 |
| 156 | rockerwear.com | GoDaddy.com, LLC | 16 Feb 2025 | 16 Feb 2025 | 16 Feb 2026 |
| 157 | rockersrevenge.biz | Cronon AG | 29 Oct 2014 | - | 28 Oct 2015 |
| 158 | rockercouture.com | Annulet LLC | 14 Mar 2019 | 27 Apr 2025 | 14 Mar 2025 |
| 159 | rockerkids.com | GoDaddy.com, LLC | 28 Oct 2021 | 1 Nov 2025 | 28 Oct 2026 |
| 160 | rockerguy.com | CloudFlare, Inc. | 25 Oct 2025 | 1 Nov 2025 | 25 Oct 2026 |
| 161 | rockermall.com | Domain Pickup LLC | 3 Aug 2022 | 17 Oct 2023 | 3 Aug 2023 |
| 162 | rockerhead.com | GoDaddy.com, LLC | 29 Dec 2007 | 30 Dec 2024 | 29 Dec 2025 |
| 163 | rockersociety.com | GoDaddy.com, LLC | 25 Dec 2007 | 30 Apr 2015 | 25 Dec 2016 |
| 164 | rocker-it.net | OVH sas | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 165 | rockersrevenge.org | Cronon AG | 29 Oct 2014 | - | 29 Oct 2015 |
| 166 | rockersrevenge.net | GoDaddy.com, LLC | 27 Jun 2016 | 8 Sep 2024 | 27 Jun 2024 |
| 167 | rockersrevenge.info | Cronon AG | 29 Oct 2014 | - | 29 Oct 2015 |
| 168 | rockers.me | West263 International Limited | 3 Sep 2025 | 16 Sep 2025 | 3 Sep 2026 |
| 169 | rockerzbattle.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 170 | rockeralone1984.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 171 | rockercard.com | Namesilo, LLC | 2 Sep 2013 | 15 Oct 2025 | 2 Sep 2026 |
| 172 | rockermail.com | GoDaddy.com, LLC | 3 May 2012 | 20 Nov 2024 | 3 May 2027 |
| 173 | rockergamingchair.com | Namesilo, LLC | 8 Nov 2019 | 9 Nov 2019 | 8 Nov 2020 |
| 174 | rockershoes.com | GoDaddy.com, LLC | 3 May 2019 | 2 May 2025 | 3 May 2026 |
| 175 | rockerflex.com | GoDaddy.com, LLC | 24 Sep 2014 | 21 Apr 2015 | 24 Sep 2015 |
| 176 | rockerwebsites.com | Wild West Domains, LLC | 8 Jun 2010 | 9 Jun 2015 | 8 Jun 2016 |
| 177 | rockergraphics.com | Wild West Domains, LLC | 8 Jun 2010 | 9 Jun 2015 | 8 Jun 2016 |
| 178 | rockero.com | Google, Inc. | 6 Nov 2002 | 22 Oct 2025 | 6 Nov 2026 |
| 179 | rockersrefuge.org | GoDaddy.com, LLC | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 180 | rockerbabyrepublic.com | GoDaddy.com, LLC | 6 Jun 2012 | 7 Jun 2015 | 6 Jun 2016 |
| 181 | rockerhorse.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 182 | rockeroysterfellers.com | Tucows Domains Inc. | 6 Dec 2006 | 21 Nov 2025 | 6 Dec 2026 |
| 183 | rockers4knockers.com | GoDaddy.com, LLC | 21 Apr 2011 | 9 Sep 2022 | 21 Apr 2031 |
| 184 | rockers.de | - | - | 16 Jun 2023 | - |
| 185 | rockerapparel.org | GoDaddy.com, LLC | 2 Nov 2014 | 2 Nov 2025 | 2 Nov 2026 |
| 186 | rockerholic.com | Domain.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 187 | rockerbags.com | GoDaddy.com, LLC | 10 Jan 2014 | 4 May 2015 | 10 Jan 2016 |
| 188 | rockertradingsystems.com | Namesilo, LLC | 18 Aug 2014 | 17 Sep 2015 | 18 Aug 2016 |
| 189 | rockertradingsystems.net | Namesilo, LLC | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 190 | rockerbotz.com | GoDaddy.com, LLC | 15 Jun 2013 | 15 Jun 2015 | 15 Jun 2016 |
| 191 | rockershoe.com | GoDaddy.com, LLC | 6 Oct 2019 | 6 Oct 2019 | 6 Oct 2020 |
| 192 | rockervintage.com | GoDaddy.com, LLC | 16 Jun 2014 | 17 Jun 2015 | 16 Jun 2016 |
| 193 | rockeresquebeautyschool.com | GoDaddy.com, LLC | 18 Jun 2012 | 18 Jun 2015 | 18 Jun 2016 |
| 194 | rockertradingsystems.org | Namesilo, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 195 | rockers-kashiwa.com | GMO Internet Inc. | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 196 | rockerstone.com | HiChina Zhicheng Technology Limited | 6 Nov 2014 | 7 Aug 2023 | 6 Nov 2026 |
| 197 | rockerzislandz.com | OVH sas | 21 Aug 2014 | 25 Jul 2024 | 21 Aug 2027 |
| 198 | rocker7wife.com | GoDaddy.com, LLC | 12 Jan 2015 | 13 Jan 2025 | 12 Jan 2027 |
| 199 | rocker2nor.info | GMO Internet Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 200 | rockerinawalker.com | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 201 | rockerkidz.com | GoDaddy.com, LLC | 22 Aug 2014 | 2 Oct 2025 | 22 Aug 2025 |
| 202 | rockerkidz.net | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 203 | rockermemorialskatepark.org | FastDomain Inc. | 21 Aug 2014 | 11 Aug 2025 | 21 Aug 2026 |
| 204 | rockerreclinernursery.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 205 | rockerscamp.com | TurnCommerce, Inc. DBA NameBright.com | 11 Oct 2021 | 20 Nov 2024 | 11 Oct 2024 |
| 206 | rockermans.com | TurnCommerce, Inc. DBA NameBright.com | 17 Nov 2011 | 27 Dec 2024 | 17 Nov 2024 |
| 207 | rockersupply.com | Internet Domain Services BS Corp | 6 May 2021 | 6 May 2021 | 6 May 2022 |
| 208 | rockeribs.com | GoDaddy.com, LLC | 18 Apr 2017 | 18 Apr 2017 | 18 Apr 2018 |
| 209 | rockersindia.com | Namesilo, LLC | 10 Sep 2022 | 10 Nov 2023 | 10 Sep 2023 |
| 210 | rockerwigs.com | NameCheap, Inc. | 15 Aug 2014 | 11 Jan 2018 | 15 Aug 2018 |
| 211 | rocker17.com | HiChina Zhicheng Technology Limited | 29 Aug 2014 | 28 Aug 2024 | 29 Aug 2026 |
| 212 | rockercock.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 213 | rockersmagazine.org | GoDaddy.com, LLC | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 214 | rockersmagazine.info | GoDaddy.com, LLC | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 215 | rockeremail.info | Wild West Domains, LLC | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 216 | rockerhair.com | GMO Internet Inc. | 22 Dec 2025 | 22 Dec 2025 | 22 Dec 2026 |
| 217 | rockerrinfra.com | register.com, Inc. | 1 Feb 2022 | 1 Feb 2022 | 1 Feb 2023 |
| 218 | rockeralone3cr.com | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 219 | rockerfellerwreckers.com | Tucows Domains Inc. | 14 Sep 2014 | 18 Sep 2015 | 14 Sep 2016 |
| 220 | rockerfellerwreckers.net | Tucows Domains Inc. | 14 Sep 2014 | 18 Sep 2015 | 14 Sep 2016 |
| 221 | rockerchickspicks.com | GoDaddy.com, LLC | 1 Sep 2014 | 7 Sep 2016 | 1 Sep 2017 |
| 222 | rockerchickspics.com | GoDaddy.com, LLC | 1 Sep 2014 | 7 Sep 2016 | 1 Sep 2017 |
| 223 | rockerchickspix.com | GoDaddy.com, LLC | 1 Sep 2014 | 7 Sep 2016 | 1 Sep 2017 |
| 224 | rockerchickspix.net | GoDaddy.com, LLC | 1 Sep 2014 | 7 Sep 2016 | 1 Sep 2017 |
| 225 | rockerchickspix.org | GoDaddy.com, LLC | 1 Sep 2014 | 2 Sep 2017 | 1 Sep 2018 |
| 226 | rockermagazine.com | Interplanet, S.A. De C.V. | 16 Sep 2014 | 27 Oct 2025 | 16 Sep 2025 |
| 227 | rockeregio.com | GoDaddy.com, LLC | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2016 |
| 228 | rockeremblems.com | 1&1 Internet AG | 3 Sep 2014 | 4 Sep 2016 | 3 Sep 2017 |
| 229 | rockerpatches.com | 1&1 Internet AG | 3 Sep 2014 | 4 Sep 2016 | 3 Sep 2018 |
| 230 | rockers175records.com | Tucows Domains Inc. | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2016 |
| 231 | rockerwraps.com | GoDaddy.com, LLC | 4 Nov 2021 | 4 Nov 2025 | 4 Nov 2027 |
| 232 | rockerwraps.net | GoDaddy.com, LLC | 5 Sep 2014 | 6 Sep 2016 | 5 Sep 2017 |
| 233 | rockersbar.com | Hosting Concepts B.V. dba Openprovider | 13 Nov 2021 | 15 Nov 2021 | 13 Nov 2022 |
| 234 | rockerkult.com | One.com A/S | 10 Mar 2019 | 23 Feb 2025 | 10 Mar 2026 |
| 235 | rocker001.com | - | 26 Apr 2022 | 27 Apr 2023 | 26 Apr 2024 |
| 236 | rockerbeds.com | GoDaddy.com, LLC | 21 Sep 2014 | 21 Sep 2016 | 21 Sep 2017 |
| 237 | rockerbed.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Dec 2020 | 9 Dec 2025 | 8 Dec 2026 |
| 238 | rockerfeler.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 239 | rockerclutch.com | Tucows Domains Inc. | 8 Sep 2014 | 12 Sep 2015 | 8 Sep 2016 |
| 240 | rockercoaster.info | Crazy Domains FZ-LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2016 |
| 241 | rockershocker.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Sep 2014 | 9 Sep 2025 | 8 Sep 2026 |
| 242 | rockeryaya.com | Launchpad, Inc. | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 243 | rockerdave.com | GoDaddy.com, LLC | 10 Sep 2014 | 11 Sep 2025 | 10 Sep 2026 |
| 244 | rockerkees.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Nov 2023 | 31 Dec 2024 | 29 Nov 2024 |
| 245 | rockerboyphotography.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 246 | rockerboyfoto.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 247 | rockerstea.com | Namesilo, LLC | 10 Sep 2014 | 9 Feb 2018 | 10 Sep 2018 |
| 248 | rockerdo.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2016 | 2 Oct 2018 |
| 249 | rockerfunder.com | Network Solutions, LLC | 1 Oct 2014 | 1 Oct 2023 | 1 Oct 2026 |
| 250 | rockersaranch.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2025 | 22 Sep 2030 |
| 251 | rockerpower.name | - | - | - | - |
| 252 | rockerreclinerchair.com | Domainshype.com, Inc. | 22 Dec 2016 | 22 Dec 2017 | 22 Dec 2017 |
| 253 | rockerzing.com | eNom, Inc. | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 254 | rockerscornertv.com | LCN.COM Ltd. | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2016 |
| 255 | rockerchickchic.com | NameCheap, Inc. | 10 Jun 2023 | 16 May 2025 | 10 Jun 2026 |
| 256 | rockergaming.com | NameCheap, Inc. | 26 Feb 2020 | 21 Aug 2023 | 26 Feb 2029 |
| 257 | rockergaming.net | 1&1 Internet AG | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 258 | rockerswebsolution.com | GoDaddy.com, LLC | 7 Apr 2017 | 7 Apr 2017 | 7 Apr 2018 |
| 259 | rockerswear.com | Key-Systems GmbH | 22 Sep 2021 | 23 Sep 2021 | 22 Sep 2022 |
| 260 | rockereando.com | GoDaddy.com, LLC | 23 Jun 2017 | 23 Jun 2017 | 23 Jun 2018 |
| 261 | rockerrneier.net | Tucows Domains Inc. | 24 Sep 2014 | 28 Sep 2015 | 24 Sep 2016 |
| 262 | rockerdesigns.com | DreamHost, LLC | 5 Oct 2005 | 4 Sep 2025 | 5 Oct 2026 |
| 263 | rockermc.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2016 |
| 264 | rockerowalter.com | register.com, Inc. | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 265 | rockerwhiskey.com | MidWestDomains, LLC | 28 Dec 2019 | 29 Dec 2019 | 28 Dec 2020 |
| 266 | rockerseats.com | GoDaddy.com, LLC | 26 Sep 2014 | 27 Sep 2025 | 26 Sep 2026 |
| 267 | rockermusthave.com | GoDaddy.com, LLC | 13 Oct 2014 | 17 Oct 2017 | 13 Oct 2018 |
| 268 | rockerjewlz.net | GoDaddy.com, LLC | 13 Oct 2014 | 14 Sep 2016 | 13 Oct 2017 |
| 269 | rockerswitchpro.com | GoDaddy.com, LLC | 13 Oct 2014 | 30 Jan 2025 | 29 Jan 2026 |
| 270 | rockergear.com | GoDaddy.com, LLC | 17 Oct 2014 | 18 Oct 2024 | 17 Oct 2026 |
| 271 | rockeramurodeescalada.com | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2016 |
| 272 | rockermerchandise.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 273 | rockerpet.com | 1&1 Internet AG | 23 Jan 2023 | 23 Jan 2023 | 23 Jan 2026 |
| 274 | rockertacofoodtruck.com | GoDaddy.com, LLC | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 275 | rockerr.net | GoDaddy.com, LLC | 16 Sep 2017 | 17 Sep 2025 | 16 Sep 2027 |
| 276 | rockermybaby.org | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2016 |
| 277 | rockerszone.com | DNC Holdings, Inc. | 6 Apr 2022 | 18 May 2023 | 6 Apr 2023 |
| 278 | rockerloans.com | Internet Domain Services BS Corp | 28 May 2021 | 10 May 2025 | 28 May 2026 |
| 279 | rockers-direct.com | Network Solutions, LLC | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 280 | rockerpark.com | Beijing Lanhai Jiye Technology Co., Ltd | 23 Apr 2019 | 29 Oct 2025 | 23 Apr 2026 |
| 281 | rockeroom.com | GoDaddy.com, LLC | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2019 |
| 282 | rockerrmedia.com | DreamHost, LLC | 3 Dec 2014 | 5 Dec 2017 | 3 Dec 2018 |
| 283 | rockeretteness.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 284 | rockerbindings.com | Domain.com, LLC | 5 Dec 2014 | 20 Nov 2017 | 5 Dec 2018 |
| 285 | rockervillefire.org | DomainPeople, Inc. | 21 Oct 2011 | 1 Jan 2025 | 21 Oct 2024 |
| 286 | rockersunited.org | GoDaddy.com, LLC | 3 Dec 2014 | 4 Dec 2025 | 3 Dec 2026 |
| 287 | rockerrtv.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 288 | rockerrstudios.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 289 | rockerrstudio.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 290 | rockerrsports.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 291 | rockerrproductions.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 292 | rockerrpictures.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 293 | rockerrmusic.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 294 | rockerrgirls.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 295 | rockerrfilms.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 296 | rockerrentertainment.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 297 | rockerrdigital.com | DreamHost, LLC | 9 Dec 2014 | 11 Dec 2016 | 9 Dec 2017 |
| 298 | rockeribsbc.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 299 | rockerbooth.com | Network Solutions, LLC | 9 Dec 2014 | 5 Mar 2017 | 9 Dec 2017 |
| 300 | rockersproducciones.com | Dattatec.com SRL | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 301 | rockers-and-rebels.com | 1&1 Internet AG | 12 Dec 2014 | 13 Dec 2016 | 12 Dec 2017 |
| 302 | rockers-and-rebels.net | 1&1 Internet AG | 12 Dec 2014 | 13 Dec 2016 | 12 Dec 2017 |
| 303 | rockerclothing.com | Dot Holding Inc. | 29 Nov 2005 | 28 Aug 2024 | 29 Nov 2026 |
| 304 | rockersthemovie.com | GoDaddy.com, LLC | 25 May 2017 | 25 May 2017 | 25 May 2018 |
| 305 | rockersoaps.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2025 | 18 Dec 2026 |
| 306 | rockersleathers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Dec 2014 | 3 Dec 2025 | 17 Dec 2026 |
| 307 | rockersph.com | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2016 |
| 308 | rockerprotein.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2016 |
| 309 | rockeromundial.com | Domain-It!, Inc. | 23 Dec 2014 | 1 Apr 2017 | 23 Dec 2017 |
| 310 | rockersign.com | Tucows Domains Inc. | 21 Dec 2013 | 25 Dec 2014 | 21 Dec 2015 |
| 311 | rockerfellerhealth.com | GoDaddy.com, LLC | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2016 |
| 312 | rockerportal.info | united-domains AG | 25 Dec 2014 | 26 Dec 2014 | 25 Dec 2015 |
| 313 | rockersite.com | - | 1 Jun 2024 | 31 Jul 2025 | 1 Jun 2026 |
| 314 | rockermart.com | Xin Net Technology Corporation | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 315 | rockersranch.com | Hostinger, UAB | 22 Jun 2020 | 3 Nov 2024 | 22 Jun 2026 |
| 316 | rockerranch.com | Realtime Register B.V. | 31 Jul 2022 | 29 May 2023 | 31 Jul 2026 |
| 317 | rockerscomic.com | - | 8 Jan 2023 | 9 Feb 2024 | 8 Jan 2024 |
| 318 | rockerjewlz.com | Go Montenegro Domains, LLC | 30 Dec 2014 | 31 Dec 2024 | 30 Dec 2026 |
| 319 | rockerizer.com | eNom, Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 320 | rockersoft.com | Eranet International Limited | 25 Nov 2025 | 25 Nov 2025 | 25 Nov 2026 |
| 321 | rockerdrewlifts.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2017 |
| 322 | rockersunderground.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 323 | rockerbuybaby.com | GoDaddy.com, LLC | 4 Jan 2015 | 5 Jan 2025 | 4 Jan 2026 |
| 324 | rockerbrew.coffee | - | 5 Jul 2014 | 5 Jul 2014 | 5 Jul 2015 |
| 325 | rockerizm.webcam | 1API GmbH | 1 Jul 2014 | - | 30 Jun 2015 |
| 326 | rockers.tokyo | GMO Internet Inc. | 23 Jul 2014 | 23 Jul 2014 | 23 Jul 2015 |
| 327 | rockerarms.xyz | Network Solutions, LLC | 22 Jul 2014 | 23 Jul 2014 | 22 Jul 2015 |
| 328 | rockersound.xyz | Network Solutions, LLC | 1 Aug 2014 | 1 Aug 2014 | 1 Aug 2015 |
| 329 | rockersuperheroes.toys | GoDaddy.com, LLC | 30 Jul 2014 | 30 Jul 2014 | 30 Jul 2015 |
| 330 | rockers.rocks | Name.com, Inc. | 6 Mar 2020 | 11 Sep 2025 | 6 Mar 2026 |
| 331 | rockers.xyz | Dynadot, LLC | 11 Apr 2019 | 12 Sep 2025 | 11 Apr 2027 |
| 332 | rocker-over-pygmy.blue | GMO Internet Inc. | 29 Dec 2014 | - | 29 Dec 2015 |
| 333 | rockerzeeguitars.com | eNom, Inc. | 12 Aug 2015 | 17 Jul 2017 | 12 Aug 2017 |
| 334 | rockersuperheroes.band | GoDaddy.com, LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 335 | rockerklamotten.club | 1&1 Internet AG | 24 Mar 2015 | 24 Mar 2015 | 23 Mar 2016 |
| 336 | rockerbraut.club | 1&1 Internet AG | 24 Mar 2015 | 24 Mar 2015 | 23 Mar 2016 |
| 337 | rockerson.com | Webfusion Ltd. | 24 Dec 2022 | 6 Feb 2025 | 24 Dec 2033 |
| 338 | rockers.bike | Crazy Domains FZ-LLC | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 339 | rockers.college | eNom, Inc. | 28 Apr 2015 | 29 Apr 2015 | 28 Apr 2016 |
| 340 | rockersdoc.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 341 | rocker-filter.com | GoDaddy.com, LLC | 5 Jan 2015 | 6 Jan 2015 | 5 Jan 2016 |
| 342 | rockersinpogress.com | eNom, Inc. | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 343 | rockermiles.com | Hangzhou AiMing Network Co., LTD | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 344 | rockermag.com | NameCheap, Inc. | 20 May 2025 | 20 May 2025 | 20 May 2026 |
| 345 | rockeries.info | GMO Internet Inc. | 9 Jan 2015 | - | 9 Jan 2016 |
| 346 | rockerzz.net | - | - | - | - |
| 347 | rockerside.com | Network Solutions, LLC | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 348 | rockersmusic.net | DreamHost, LLC | 10 Jan 2014 | 14 Jan 2015 | 10 Jan 2016 |
| 349 | rockerollers.com | Mesh Digital Limited | 15 Aug 2015 | 7 Dec 2016 | 15 Aug 2017 |
| 350 | rockerverb.website | Global Domains International, Inc. DBA DomainCostC… | 22 Apr 2015 | 17 Jun 2015 | 22 Apr 2016 |
| 351 | rockers.fashion | Minds + Machines Registrar Limited | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 352 | rockerscornerradio.com | eNom, Inc. | 15 Aug 2015 | 20 Jul 2017 | 15 Aug 2017 |
| 353 | rockermart.net | - | 16 Aug 2015 | 16 Aug 2015 | 16 Aug 2017 |
| 354 | rockerbox.technology | GoDaddy.com, LLC | 10 Jul 2015 | 21 Aug 2023 | 10 Jul 2023 |
| 355 | rockerbox.solutions | GoDaddy.com, LLC | 10 Jul 2015 | 21 Aug 2023 | 10 Jul 2023 |
| 356 | rockerbox.menu | GoDaddy.com, LLC | 10 Jul 2015 | 21 Aug 2023 | 10 Jul 2023 |
| 357 | rockerbox.guru | GoDaddy.com, LLC | 10 Jul 2015 | 21 Aug 2023 | 10 Jul 2023 |
| 358 | rockerbox.email | GoDaddy.com, LLC | 10 Jul 2015 | 21 Aug 2023 | 10 Jul 2023 |
| 359 | rockerbox.company | GoDaddy.com, LLC | 10 Jul 2015 | 21 Aug 2023 | 10 Jul 2023 |
| 360 | rockers.video | PSI-USA, Inc. dba Domain Robot | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 361 | rockers.news | PSI-USA, Inc. dba Domain Robot | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 362 | rockers.agency | eNom, Inc. | 28 Jul 2015 | 30 Jun 2017 | 28 Jul 2017 |
| 363 | rockertools.equipment | Wild West Domains, LLC | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 364 | rockertools.construction | Wild West Domains, LLC | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 365 | rockerenterpriseandconsulting.com | GoDaddy.com, LLC | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 366 | rockeryao.com | GoDaddy.com, LLC | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2017 |
| 367 | rockerteergames.com | GoDaddy.com, LLC | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 368 | rockerystudioseastvan.com | GoDaddy.com, LLC | 19 Jan 2015 | 2 Mar 2025 | 19 Jan 2025 |
| 369 | rockerill.net | OVH sas | 18 Jan 2015 | 29 Dec 2016 | 18 Jan 2018 |
| 370 | rockerlars.com | CloudFlare, Inc. | 13 Oct 2022 | 19 Oct 2022 | 13 Oct 2027 |
| 371 | rockerzinfaccia.com | Tucows Domains Inc. | 23 Jan 2015 | 27 Jan 2016 | 23 Jan 2017 |
| 372 | rockersoap.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 373 | rockerstage.com | Automattic Inc. | 28 Apr 2025 | 28 Apr 2025 | 28 Apr 2026 |
| 374 | rockersstage.com | FBS Inc. | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2017 |
| 375 | rockerspoint.com | FBS Inc. | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2017 |
| 376 | rockerpoint.com | FBS Inc. | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2017 |
| 377 | rockersla.com | Google, Inc. | 24 Jul 2020 | 25 Jul 2023 | 24 Jul 2024 |
| 378 | rockerchildtrust.com | Launchpad, Inc. | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 379 | rockerrefined.com | GoDaddy.com, LLC | 23 Apr 2021 | 23 Apr 2021 | 23 Apr 2022 |
| 380 | rockerprincess.com | NameCheap, Inc. | 3 Mar 2011 | 8 Oct 2025 | 3 Mar 2028 |
| 381 | rockerclassicmotorcycles.com | GoDaddy.com, LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2017 |
| 382 | rockermods.com | GoDaddy.com, LLC | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 383 | rockerswitchpros.com | GoDaddy.com, LLC | 29 Jan 2015 | 25 Nov 2025 | 24 Nov 2026 |
| 384 | rockerspecs.com | GoDaddy.com, LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 385 | rockershell.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 9 Oct 2021 | 10 Oct 2022 | 9 Oct 2023 |
| 386 | rockersoleshoes.com | Tucows Domains Inc. | 9 Jul 2024 | 13 Jul 2025 | 9 Jul 2026 |
| 387 | rockers.party | NameCheap, Inc. | 16 Jul 2017 | 31 Jul 2023 | 16 Jul 2023 |
| 388 | rockerfizz.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 389 | rockerboxframes.com | GoDaddy.com, LLC | 1 Feb 2015 | 1 Feb 2015 | 1 Feb 2016 |
| 390 | rockerpanelsusa.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 391 | rocker-panels.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 392 | rockerwebsitedesign.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 393 | rockermybabystore.com | Launchpad, Inc. | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 394 | rockerger.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 395 | rockermocker.com | GoDaddy.com, LLC | 20 Aug 2015 | 21 Aug 2025 | 20 Aug 2026 |
| 396 | rockerfinder.com | Launchpad, Inc. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 397 | rockersparadise.com | GoDaddy.com, LLC | 30 Mar 2021 | 11 May 2024 | 30 Mar 2024 |
| 398 | rockermum.com | 1&1 Internet AG | 14 Feb 2015 | 15 Feb 2017 | 14 Feb 2018 |
| 399 | rockerbye.com | DropCatch.com 864 LLC | 24 Apr 2018 | 24 Apr 2018 | 24 Apr 2019 |
| 400 | rocker-girls.com | DreamHost, LLC | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2016 |
| 401 | rockersislanddtla.com | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 402 | rockersevent.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 403 | rockersdtla.com | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 404 | rockersandrollers.com | West263 International Limited | 14 Apr 2021 | 14 Apr 2021 | 14 Apr 2022 |
| 405 | rockertommyb.com | CloudFlare, Inc. | 25 Feb 2025 | 4 Mar 2025 | 25 Feb 2026 |
| 406 | rockersapparel.com | GoDaddy.com, LLC | 18 Feb 2015 | 19 Feb 2015 | 18 Feb 2020 |
| 407 | rockersweb.com | OnlineNIC, Inc. | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2016 |
| 408 | rockerchickevents.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 17 Nov 2021 | 18 Nov 2021 | 17 Nov 2022 |
| 409 | rockerbiker.com | GoDaddy.com, LLC | 16 May 2021 | 17 May 2025 | 16 May 2026 |
| 410 | rockerzzz.com | BigRock Solutions Ltd. | 25 Feb 2015 | 18 Mar 2025 | 25 Feb 2026 |
| 411 | rockersinternational.com | GoDaddy.com, LLC | 24 Feb 2015 | 27 Feb 2025 | 24 Feb 2028 |
| 412 | rockerbc.com | Domain.com, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 413 | rockerlicious.com | Network Solutions, LLC | 26 Feb 2015 | 16 Jun 2024 | 26 Feb 2026 |
| 414 | rockerdom.com | eNom, Inc. | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 415 | rockerpc.com | DreamHost, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 416 | rockerfuel.com | CloudFlare, Inc. | 11 Dec 2023 | 19 Feb 2025 | 11 Dec 2024 |
| 417 | rockerfeed.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 418 | rockerbucket.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 419 | rockersinrecoveryunpluggedaddictionnetwork.com | GoDaddy.com, LLC | 3 Mar 2015 | 4 Mar 2025 | 3 Mar 2026 |
| 420 | rockersinrecoveryaddictionnetwork.com | GoDaddy.com, LLC | 3 Mar 2015 | 4 Mar 2025 | 3 Mar 2026 |
| 421 | rockershaft.com | DropCatch.com 652 LLC | 3 Mar 2015 | 4 Mar 2017 | 3 Mar 2018 |
| 422 | rockerguys.com | GoDaddy.com, LLC | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 423 | rockersinrecovery.net | GoDaddy.com, LLC | 3 Mar 2015 | 3 Mar 2025 | 3 Mar 2026 |
| 424 | rockeradio.net | CV. Jogjacamp | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 425 | rockersdiveradio.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 426 | rockerpointestates.com | GoDaddy.com, LLC | 31 Jan 2019 | 31 Jan 2019 | 31 Jan 2020 |
| 427 | rockerchixxchoir.com | - | 20 May 2025 | 23 May 2025 | 20 May 2026 |
| 428 | rockersvsmodsaustin.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 429 | rockermarket.com | - | 20 May 2016 | 20 May 2016 | 20 May 2017 |
| 430 | rockerhobbies.com | GoDaddy.com, LLC | 16 Mar 2021 | 28 Mar 2025 | 16 Mar 2026 |
| 431 | rockervendor.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 432 | rocker-news.com | InterNetworX Ltd. & Co. KG | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 433 | rockershipx-m.com | Network Solutions, LLC | 12 Mar 2015 | 5 Mar 2017 | 12 Mar 2020 |
| 434 | rockership-x-m.com | Network Solutions, LLC | 12 Mar 2015 | 20 Feb 2020 | 12 Mar 2021 |
| 435 | rockersintown.com | GoDaddy.com, LLC | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 436 | rockerfood.com | Web Commerce Communications Limited dba WebNic.cc | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2017 |
| 437 | rockeroranchllc.com | GoDaddy.com, LLC | 25 Aug 2015 | 26 Aug 2025 | 25 Aug 2035 |
| 438 | rockersnetwork.com | Tucows Domains Inc. | 12 Mar 2014 | 16 Mar 2015 | 12 Mar 2016 |
| 439 | rockercruise.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2025 | 16 Mar 2027 |
| 440 | rocker-machs-dir-selbst.com | 1&1 Internet AG | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 441 | rockerbus.com | DropCatch.com 441 LLC | 22 Aug 2025 | 22 Aug 2025 | 22 Aug 2026 |
| 442 | rockersentertainment.com | Internet Domain Services BS Corp | 26 Dec 2020 | 26 Dec 2020 | 26 Dec 2021 |
| 443 | rockercloud.com | GoDaddy.com, LLC | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 444 | rockerbie.com | Webfusion Ltd. | 19 Mar 2015 | 12 Mar 2017 | 19 Mar 2018 |
| 445 | rockerfellerfoundation.org | Domainamania.com LLC | 14 Dec 2021 | 20 Oct 2025 | 14 Dec 2026 |
| 446 | rockerundrebellen.com | Cronon AG | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 447 | rockerplace.com | TurnCommerce, Inc. DBA NameBright.com | 11 Oct 2017 | 20 Nov 2024 | 11 Oct 2024 |
| 448 | rockerklamotten.com | 1&1 Internet AG | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 449 | rockerbraut.com | Register.it SPA | 12 Jun 2016 | 12 Jun 2016 | 12 Jun 2017 |
| 450 | rockersandrecoveryunplugged.com | GoDaddy.com, LLC | 25 Mar 2015 | 26 Mar 2025 | 25 Mar 2026 |
| 451 | rockersandrecovery.com | GoDaddy.com, LLC | 25 Mar 2015 | 26 Mar 2025 | 25 Mar 2026 |
| 452 | rockercode.com | GoDaddy.com, LLC | 5 Feb 2024 | 5 Feb 2025 | 5 Feb 2026 |
| 453 | rockerbottomsshoes.com | - | 28 Jul 2016 | 28 Jul 2016 | 28 Jul 2017 |
| 454 | rockercyb.org | Gransy s.r.o. d/b/a subreg.cz | 25 Mar 2015 | - | 25 Mar 2016 |
| 455 | rockersdomain.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 456 | rockerlockers.com | Tucows Domains Inc. | 27 Aug 2015 | 15 Jul 2025 | 27 Aug 2027 |
| 457 | rockerluxuryhomes.com | GoDaddy.com, LLC | 28 Mar 2015 | 8 Jun 2025 | 28 Mar 2025 |
| 458 | rockerestates.com | GoDaddy.com, LLC | 28 Mar 2015 | 1 Apr 2025 | 28 Mar 2026 |
| 459 | rockerhieu.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 9 May 2023 | 9 May 2023 | 9 May 2024 |
| 460 | rockerfellerusa.com | GMO Internet Inc. | 21 Dec 2024 | 22 Dec 2025 | 21 Dec 2025 |
| 461 | rockergypsydesigns.com | DreamHost, LLC | 17 Mar 2014 | 31 Mar 2015 | 17 Mar 2016 |
| 462 | rockerfootwear.com | Tucows Domains Inc. | 8 Mar 2024 | 21 Feb 2025 | 8 Mar 2026 |
| 463 | rockerfellerhall.com | Fabulous.com Pty Ltd. | 1 Mar 2005 | 28 Jan 2018 | 1 Mar 2018 |
| 464 | rockermarketing.com | GoDaddy.com, LLC | 23 Jun 2023 | 4 Aug 2025 | 23 Jun 2025 |
| 465 | rockerguards.com | GoDaddy.com, LLC | 1 Apr 2009 | 12 Mar 2025 | 1 Apr 2026 |
| 466 | rockersoundstation.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 467 | rockergirlz.com | GoDaddy.com, LLC | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 468 | rockersmints.net | GoDaddy.com, LLC | 1 Sep 2015 | 2 Sep 2025 | 1 Sep 2026 |
| 469 | rockersmints.com | GoDaddy.com, LLC | 1 Sep 2015 | 2 Sep 2025 | 1 Sep 2026 |
| 470 | rockersmint.com | GoDaddy.com, LLC | 1 Sep 2015 | 2 Sep 2025 | 1 Sep 2026 |
| 471 | rocker-custom.com | Vautron Rechenzentrum AG | 30 Aug 2015 | 1 Sep 2025 | 30 Aug 2026 |
| 472 | rockersz.com | GoDaddy.com, LLC | 24 May 2021 | 5 Jul 2024 | 24 May 2024 |
| 473 | rockerimage.com | GoDaddy.com, LLC | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 474 | rocker-pub.com | Interweb Advertising D.B.A. Profile Builder | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 475 | rockersbandpa.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 476 | rockerspolishbytrinity.com | GoDaddy.com, LLC | 11 Apr 2015 | 11 Apr 2015 | 11 Apr 2016 |
| 477 | rockersmoto.com | One.com A/S | 27 Nov 2024 | 28 Nov 2025 | 27 Nov 2026 |
| 478 | rockers-moto.com | Crazy Domains FZ-LLC | 13 Apr 2015 | 14 Apr 2017 | 13 Apr 2019 |
| 479 | rockers-galore.com | GMO Internet Inc. | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2017 |
| 480 | rockerfellas.net | Cronon AG | 5 Sep 2015 | 5 Sep 2015 | 5 Sep 2016 |
| 481 | rockerlady.com | DropCatch.com 1205 LLC | 21 Sep 2018 | 21 Sep 2018 | 21 Sep 2019 |
| 482 | rockerfeel.com | GoDaddy.com, LLC | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 483 | rockersroll.com | DropCatch.com 1154 LLC | 8 Jul 2018 | 8 Jul 2018 | 8 Jul 2019 |
| 484 | rockerampstand.com | NameKing.com Inc. | 24 Apr 2015 | 16 Mar 2017 | 24 Apr 2018 |
| 485 | rockerzdate.com | TierraNet Inc. d/b/a DomainDiscover | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2017 |
| 486 | rockersdate.com | TierraNet Inc. d/b/a DomainDiscover | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2017 |
| 487 | rockermingle.com | TierraNet Inc. d/b/a DomainDiscover | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2017 |
| 488 | rocker-mingle.com | TierraNet Inc. d/b/a DomainDiscover | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2017 |
| 489 | rocker-date.com | TierraNet Inc. d/b/a DomainDiscover | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2017 |
| 490 | rockerbio.com | Wild West Domains, LLC | 26 Apr 2015 | 26 Apr 2015 | 26 Apr 2017 |
| 491 | rockerdress.com | - | - | - | - |
| 492 | rockerservrz.com | eNom, Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 493 | rockerka.com | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 494 | rockersdogs.com | GoDaddy.com, LLC | 8 Sep 2015 | 9 Sep 2025 | 8 Sep 2026 |
| 495 | rockersculture.com | GoDaddy.com, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 496 | rockersbrand.com | NameCheap, Inc. | 30 Jan 2023 | 13 Mar 2025 | 30 Jan 2025 |
| 497 | rockers.ski | Key-Systems, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 498 | rockerfellers.org | NameCheap, Inc. | 31 Dec 2022 | 25 Dec 2024 | 31 Dec 2025 |
| 499 | rockermade.us | GoDaddy.com, LLC | 30 Apr 2015 | 30 Apr 2017 | 29 Apr 2018 |
| 500 | rockerslovereggae.com | Domain.com, LLC | 2 May 2015 | 2 May 2015 | 2 May 2017 |
| 501 | rockerabyannettemoreno.com | Tucows Domains Inc. | 30 Apr 2013 | 4 May 2015 | 30 Apr 2016 |
| 502 | rockernator.com | GoDaddy.com, LLC | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 503 | rockerto.info | PlanetDomain Pty Ltd | 12 Apr 2005 | 6 May 2015 | 12 Apr 2016 |
| 504 | rockerrehab.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 505 | rockerinc.com | GoDaddy.com, LLC | 7 May 2015 | 18 Sep 2022 | 7 May 2027 |
| 506 | rockermomrealty.net | GoDaddy.com, LLC | 8 May 2015 | 8 May 2015 | 8 May 2016 |
| 507 | rockerscustoms.com | Crazy Domains FZ-LLC | 10 May 2015 | 21 May 2019 | 10 May 2019 |
| 508 | rockergirlchic.com | GoDaddy.com, LLC | 10 May 2015 | 10 May 2015 | 10 May 2016 |
| 509 | rockerpov.com | GoDaddy.com, LLC | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 510 | rockerpay.com | Domaininfo AB, aka domaininfo.com | 10 Aug 2021 | 3 Aug 2025 | 10 Aug 2026 |
| 511 | rockerpartners.com | GoDaddy.com, LLC | 23 Dec 2022 | 23 Dec 2022 | 23 Dec 2023 |
| 512 | rockermob.com | eNom, Inc. | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 513 | rockersvintagegentlemen.com | OVH sas | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 514 | rockerplanet.com | GoDaddy.com, LLC | 24 Nov 2018 | 25 Nov 2025 | 24 Nov 2026 |
| 515 | rockeramsterdam.com | Realtime Register B.V. | 16 May 2015 | 27 Jul 2024 | 16 May 2024 |
| 516 | rockercam.com | GoDaddy.com, LLC | 18 May 2015 | 19 May 2025 | 18 May 2026 |
| 517 | rockerlocks.com | Domain.com, LLC | 21 May 2015 | 24 Jun 2025 | 21 May 2027 |
| 518 | rockergirlmanagement.com | Tucows Domains Inc. | 18 May 2014 | 22 May 2023 | 18 May 2024 |
| 519 | rockerwolf.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Sep 2015 | 13 Sep 2015 | 13 Sep 2016 |
| 520 | rockercase.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 22 Aug 2022 | 29 Sep 2023 | 22 Aug 2023 |
| 521 | rockerfeller-research.com | PSI-USA, Inc. dba Domain Robot | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 522 | rockerchickgetsfit.net | GoDaddy.com, LLC | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 523 | rockerfella-media.com | TLD Registrar Solutions Ltd. | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 524 | rockercoverage.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 525 | rockerpaya.net | Melbourne IT, Ltd | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 526 | rockermemorial.org | FastDomain Inc. | 29 May 2015 | 19 May 2025 | 29 May 2026 |
| 527 | rockertamil.com | GoDaddy.com, LLC | 31 May 2015 | 31 May 2015 | 31 May 2016 |
| 528 | rockerbracket.com | Fabulous.com Pty Ltd. | 3 May 2011 | 3 Jun 2017 | 3 May 2018 |
| 529 | rockersanime.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 530 | rockerbomber.com | Wild West Domains, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 531 | rocker-cn.com | HiChina Zhicheng Technology Limited | 3 Jun 2015 | 20 May 2017 | 3 Jun 2018 |
| 532 | rockersforsoccer.com | GoDaddy.com, LLC | 24 Dec 2018 | 25 Dec 2024 | 24 Dec 2025 |
| 533 | rockersforsoccer.biz | GoDaddy.com, LLC | 5 Jun 2015 | 5 Jun 2015 | 4 Jun 2016 |
| 534 | rockersandrebels.com | Google, Inc. | 27 Jan 2020 | 13 Jan 2025 | 27 Jan 2026 |
| 535 | rockersnanet.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 536 | rockeraj.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 537 | rockersforsoccer.org | GoDaddy.com, LLC | 5 Jun 2015 | 6 Jun 2017 | 5 Jun 2018 |
| 538 | rockersforsoccer.net | GoDaddy.com, LLC | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 539 | rockersforsoccer.mobi | GoDaddy.com, LLC | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 540 | rockersforsoccer.info | GoDaddy.com, LLC | 5 Jun 2015 | - | 5 Jun 2016 |
| 541 | rockerovip.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 542 | rockers-revenge.com | Cronon AG | 9 Jun 2015 | 29 Jul 2025 | 9 Jun 2026 |
| 543 | rockerfrilly.com | eNom, Inc. | 16 Sep 2012 | 17 Sep 2015 | 16 Sep 2016 |
| 544 | rockerfellaindustries.com | GoDaddy.com, LLC | 17 Sep 2015 | 19 Sep 2025 | 17 Sep 2027 |
| 545 | rockerlife.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 546 | rockerinsurance.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 547 | rocker1963.com | Wild West Domains, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 548 | rockerschool.com | Shanghai Meicheng Technology Information Co., Ltd | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2018 |
| 549 | rockeroshits.com | GoDaddy.com, LLC | 18 Sep 2015 | 18 Sep 2015 | 18 Sep 2016 |
| 550 | rockerstar.com | GoDaddy.com, LLC | 12 Nov 2021 | 3 Nov 2025 | 12 Nov 2026 |
| 551 | rockerbyte.com | GoDaddy.com, LLC | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2020 |
| 552 | rockerfx.net | GoDaddy.com, LLC | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2016 |
| 553 | rockerfx.info | GoDaddy.com, LLC | 21 Sep 2015 | 22 Sep 2016 | 21 Sep 2017 |
| 554 | rockerfx.com | TurnCommerce, Inc. DBA NameBright.com | 9 Dec 2017 | 11 Nov 2025 | 9 Dec 2025 |
| 555 | rockersgin.com | Arsys Internet, S.L. dba NICLINE.COM | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 556 | rockero.net | GoDaddy.com, LLC | 23 Jun 2015 | 17 Oct 2025 | 23 Jun 2026 |
| 557 | rockersmaniac.com | Tucows Domains Inc. | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2017 |
| 558 | rockerdealsmania.com | - | 7 Oct 2016 | 7 Oct 2016 | 7 Oct 2017 |
| 559 | rockermomrambles.net | GoDaddy.com, LLC | 27 Jun 2015 | 27 Jun 2015 | 27 Jun 2016 |
| 560 | rockerstim.com | Gandi SAS | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 561 | rockerrod.com | Gandi SAS | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 562 | rockergirlreviews.com | - | - | - | - |
| 563 | rockerfellerfdn.com | - | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2017 |
| 564 | rockerebelshop.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 565 | rockerisimo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jul 2015 | 1 Jul 2015 | 1 Jul 2016 |
| 566 | rockertesting.org | Domain.com, LLC | 9 Oct 2013 | 30 Jun 2015 | 9 Oct 2015 |
| 567 | rocker-c.com | Xin Net Technology Corporation | 19 Sep 2018 | 19 Sep 2018 | 19 Sep 2019 |
| 568 | rockerstamil.com | GoDaddy.com, LLC | 26 Sep 2017 | 7 Aug 2025 | 26 Sep 2025 |
| 569 | rockerswedding.com | GoDaddy.com, LLC | 5 Jul 2015 | 5 Jul 2015 | 5 Jul 2016 |
| 570 | rockerbottomfootwear.com | - | - | - | - |
| 571 | rockerboyandvendingmachines.com | Tucows Domains Inc. | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2017 |
| 572 | rockershoesstore.com | Tucows Domains Inc. | 30 Apr 2017 | 30 Apr 2017 | 30 Apr 2018 |
| 573 | rockerlockr.com | eNom, Inc. | 25 Sep 2015 | 11 Sep 2016 | 25 Sep 2017 |
| 574 | rockerfit.com | Porkbun, LLC | 10 Dec 2020 | 26 Oct 2025 | 10 Dec 2026 |
| 575 | rockerbox.biz | GoDaddy.com, LLC | 10 Jul 2015 | 20 Aug 2023 | 9 Jul 2023 |
| 576 | rockerberry.com | GoDaddy.com, LLC | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 577 | rockerfellerfoundn.com | Tucows Domains Inc. | 27 Sep 2015 | 2 Jun 2017 | 27 Sep 2017 |
| 578 | rockerskating.com | Tucows Domains Inc. | 16 Jul 2015 | 1 Jul 2025 | 16 Jul 2026 |
| 579 | rockernbabytravel.com | Wild West Domains, LLC | 15 Jul 2015 | 15 Jul 2015 | 15 Jul 2016 |
| 580 | rockerjacket.com | EndeavourDomains, LLC | 10 Dec 2019 | 11 Dec 2019 | 10 Dec 2020 |
| 581 | rocker-jacket.com | GoDaddy.com, LLC | 15 Jul 2015 | 15 Jul 2015 | 15 Jul 2016 |
| 582 | rockergirl.org | GoDaddy.com, LLC | 14 Jul 2015 | 14 Jul 2015 | 14 Jul 2016 |
| 583 | rockerboy.org | GoDaddy.com, LLC | 14 Jul 2015 | 14 Jul 2015 | 14 Jul 2016 |
| 584 | rockerboy.net | Amazon Registrar, Inc. | 16 Jul 2020 | 11 Jun 2025 | 16 Jul 2026 |
| 585 | rockerfellerfoundation.com | 1&1 Internet AG | 3 Aug 2023 | 15 Sep 2024 | 3 Aug 2024 |
| 586 | rockerfellerfdtn.com | Tucows Domains Inc. | 27 Sep 2015 | 1 Oct 2019 | 27 Sep 2019 |
| 587 | rockerbeaver.com | united-domains AG | 17 Jul 2015 | 18 Jul 2015 | 17 Jul 2016 |
| 588 | rockerrisk.com | GoDaddy.com, LLC | 20 Jul 2015 | 21 Jul 2025 | 20 Jul 2027 |
| 589 | rockertshirts.com | NameCheap, Inc. | 5 Aug 2021 | 17 Oct 2023 | 5 Aug 2023 |
| 590 | rockerfield.com | Tucows Domains Inc. | 21 Jul 2015 | 25 Jul 2022 | 21 Jul 2023 |
| 591 | rockersquoing.com | Namesilo, LLC | 28 Sep 2015 | 28 Sep 2015 | 28 Sep 2016 |
| 592 | rockergy.info | Namesilo, LLC | 24 Jul 2015 | 13 Aug 2017 | 24 Jul 2018 |
| 593 | rockervideo.com | Google, Inc. | 26 May 2022 | 11 May 2025 | 26 May 2026 |
| 594 | rockertec.com | Name.com, Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 595 | rockersrally.com | Name.com, Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 596 | rockerhockey.com | eNom, Inc. | 29 Sep 2015 | 14 Mar 2017 | 29 Sep 2017 |
| 597 | rockerd.com | TurnCommerce, Inc. DBA NameBright.com | 4 Oct 2022 | 14 Dec 2024 | 4 Oct 2024 |
| 598 | rockercenstationery.com | eNom, Inc. | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2016 |
| 599 | rockergy.org | Namesilo, LLC | 24 Jul 2015 | 13 Aug 2017 | 24 Jul 2018 |
| 600 | rockerieau.com | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2017 |
| 601 | rockers.ws | - | - | - | - |
| 602 | rockersgotorestaurant.com | Tucows Domains Inc. | 18 Oct 2007 | 20 Jan 2025 | 18 Oct 2026 |
| 603 | rockersmusicalgroup.com | BigRock Solutions Ltd. | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2016 |
| 604 | rockerhx.com | NameCheap, Inc. | 1 Aug 2025 | 1 Aug 2025 | 1 Aug 2026 |
| 605 | rockertools.biz | Wild West Domains, LLC | 31 Jul 2015 | 31 Jul 2015 | 30 Jul 2016 |
| 606 | rockerforms.com | eNom, Inc. | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 607 | rocker-fun.com | Tucows Domains Inc. | 29 Jul 2009 | 2 Aug 2015 | 29 Jul 2016 |
| 608 | rockertools.us | Wild West Domains, LLC | 31 Jul 2015 | 31 Jul 2015 | 30 Jul 2016 |
| 609 | rockertools.net | Wild West Domains, LLC | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 610 | rockertools.info | Wild West Domains, LLC | 31 Jul 2015 | - | 31 Jul 2016 |
| 611 | rockerpanelweldingandmechanicservices.com | Tucows Domains Inc. | 30 Jul 2014 | 3 Aug 2015 | 30 Jul 2016 |
| 612 | rockersden.com | FastDomain Inc. | 24 Sep 2019 | 7 Oct 2025 | 24 Sep 2026 |
| 613 | rockersagency.com | GoDaddy.com, LLC | 23 Mar 2022 | 24 Mar 2024 | 23 Mar 2026 |
| 614 | rockerlabs.miami | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 615 | rockersdenstore.com | Name.com, Inc. | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2016 |
| 616 | rockersagency.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 Aug 2015 | - | 3 Aug 2016 |
| 617 | rockersagency.net | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2016 |
| 618 | rockersagency.info | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 Aug 2015 | - | 3 Aug 2016 |
| 619 | rockerwoodpro.com | Wild West Domains, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2016 |
| 620 | rockerwoodpro.biz | Wild West Domains, LLC | 5 Aug 2015 | 5 Aug 2015 | 4 Aug 2016 |
| 621 | rockersteelpro.com | Wild West Domains, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2016 |
| 622 | rockersteelpro.biz | Wild West Domains, LLC | 5 Aug 2015 | 5 Aug 2015 | 4 Aug 2016 |
| 623 | rockerwoodpro.net | Wild West Domains, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2016 |
| 624 | rockerwoodpro.info | Wild West Domains, LLC | 5 Aug 2015 | - | 5 Aug 2016 |
| 625 | rockersteelpro.net | Wild West Domains, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2016 |
| 626 | rockersteelpro.info | Wild West Domains, LLC | 5 Aug 2015 | - | 5 Aug 2016 |
| 627 | rockerine.com | - | - | - | - |
| 628 | rockersforrecovery.com | GoDaddy.com, LLC | 9 Aug 2015 | 9 Aug 2025 | 9 Aug 2026 |
| 629 | rockers4recovery.com | GoDaddy.com, LLC | 9 Aug 2015 | 9 Aug 2025 | 9 Aug 2026 |
| 630 | rockersforrecovery.net | GoDaddy.com, LLC | 9 Aug 2015 | 9 Aug 2025 | 9 Aug 2026 |
| 631 | rockers4recovery.net | GoDaddy.com, LLC | 9 Aug 2015 | 9 Aug 2025 | 9 Aug 2026 |
| 632 | rockersforrecovery.org | GoDaddy.com, LLC | 9 Aug 2015 | 23 Sep 2025 | 9 Aug 2026 |
| 633 | rockers4recovery.org | GoDaddy.com, LLC | 9 Aug 2015 | 23 Sep 2025 | 9 Aug 2026 |
| 634 | rockerpureipiashirahama.xyz | GMO Internet Inc. | 5 Oct 2015 | - | 5 Oct 2016 |
| 635 | rockersdieyounger.com | OVH sas | 7 Oct 2015 | 8 Oct 2024 | 7 Oct 2026 |
| 636 | rockerreads.com | NameCheap, Inc. | 7 May 2024 | 18 Jun 2025 | 7 May 2025 |
| 637 | rockersbr.com | Domains of Origin, LLC | 30 Jan 2018 | 30 Jan 2018 | 30 Jan 2019 |
| 638 | rockersinrecoverycafes.com | GoDaddy.com, LLC | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2017 |
| 639 | rockersinrecoverycafe.com | GoDaddy.com, LLC | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2017 |
| 640 | rockercases.net | GoDaddy.com, LLC | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 641 | rockercases.com | GoDaddy.com, LLC | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 642 | rockersinrecoverycafes.org | GoDaddy.com, LLC | 10 Oct 2015 | 21 Sep 2016 | 10 Oct 2018 |
| 643 | rockersinrecoverycafe.org | GoDaddy.com, LLC | 10 Oct 2015 | 21 Sep 2016 | 10 Oct 2018 |
| 644 | rockersinrecovery.cafe | GoDaddy.com, LLC | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2016 |
| 645 | rockerlifecoachblab.com | GoDaddy.com, LLC | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2016 |
| 646 | rockerplumbing.com | 1&1 Internet AG | 11 Oct 2015 | 19 Mar 2018 | 11 Oct 2026 |
| 647 | rockersretreat.com | GoDaddy.com, LLC | 14 Jul 2022 | 14 Jul 2025 | 14 Jul 2026 |
| 648 | rockerswelding.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 649 | rockersfxstudio.xyz | Hostinger, UAB | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 650 | rockerzfootwear.com | GoDaddy.com, LLC | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 651 | rockerstrip.work | GoDaddy.com, LLC | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 652 | rockerzent.com | GoDaddy.com, LLC | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 653 | rockersontheroad.com | GoDaddy.com, LLC | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2017 |
| 654 | rockerskiracks.com | 1API GmbH | 2 Dec 2020 | 2 Dec 2020 | 2 Dec 2021 |
| 655 | rockerns.com | GoDaddy.com, LLC | 16 Oct 2015 | 16 Oct 2015 | 16 Oct 2016 |
| 656 | rockeryacehardware.com | Key-Systems GmbH | 4 Oct 2016 | 4 Oct 2016 | 4 Oct 2017 |
| 657 | rockerefelleracademy.com | Crazy Domains FZ-LLC | 16 Oct 2013 | 27 Oct 2017 | 16 Oct 2017 |
| 658 | rockersislandshop.com | Japan Registry Services Co., Ltd. | 20 Oct 2015 | 18 Oct 2025 | 20 Oct 2026 |
| 659 | rockerz.xyz | GMO Internet Inc. | 1 Sep 2025 | 13 Sep 2025 | 1 Sep 2026 |
| 660 | rockerclassicmotorcycle.com | GoDaddy.com, LLC | 24 Oct 2015 | 24 Oct 2015 | 24 Oct 2016 |
| 661 | rockertaco.com | TurnCommerce, Inc. DBA NameBright.com | 25 Oct 2015 | 19 Oct 2020 | 25 Oct 2026 |
| 662 | rockersauto.com | eNom, Inc. | 25 Oct 2015 | 14 Mar 2017 | 25 Oct 2017 |
| 663 | rockermranch.com | GoDaddy.com, LLC | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 664 | rockerm.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 21 Nov 2024 | 28 Nov 2024 | 21 Nov 2026 |
| 665 | rockersup.com | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Aug 2022 | 12 Oct 2025 | 29 Aug 2025 |
| 666 | rockeroils.info | GoDaddy.com, LLC | 30 Oct 2015 | 31 Oct 2016 | 30 Oct 2017 |
| 667 | rockertoe.com | DreamHost, LLC | 27 Oct 2011 | 31 Oct 2015 | 27 Oct 2017 |
| 668 | rockerest.xyz | NameCheap, Inc. | 1 Nov 2015 | 1 Nov 2025 | 1 Nov 2026 |
| 669 | rockerpowersports.com | eNom, Inc. | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 670 | rockersnshockersball.com | GoDaddy.com, LLC | 5 Nov 2015 | 5 Nov 2015 | 5 Nov 2017 |
| 671 | rockersnshockers.com | GoDaddy.com, LLC | 5 Nov 2015 | 5 Nov 2015 | 5 Nov 2017 |
| 672 | rockerspt.com | GoDaddy.com, LLC | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 673 | rockerfeller-foundation.com | eNom, Inc. | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 674 | rockerballs.com | Cronon AG | 10 Nov 2015 | 30 Dec 2024 | 10 Nov 2026 |
| 675 | rockersrecords.com | 1API GmbH | 10 Apr 2021 | 17 Oct 2025 | 10 Apr 2027 |
| 676 | rockerrente.com | DropCatch.com 1459 LLC | 27 Jul 2017 | 27 Jul 2017 | 27 Jul 2018 |
| 677 | rockerbiefilm.com | DreamHost, LLC | 12 Nov 2015 | 11 Oct 2016 | 12 Nov 2017 |
| 678 | rockerthon.com | GoDaddy.com, LLC | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 679 | rockersink.com | 1&1 Internet AG | 17 Nov 2015 | 18 Nov 2016 | 17 Nov 2017 |
| 680 | rockershoppe.com | 1&1 Internet AG | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 681 | rockers-ink.com | 1&1 Internet AG | 17 Nov 2015 | 18 Nov 2016 | 17 Nov 2017 |
| 682 | rockerarmmanufacturers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Nov 2015 | 18 Nov 2025 | 17 Nov 2026 |
| 683 | rockervault.com | GoDaddy.com, LLC | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2016 |
| 684 | rockersgliders.xyz | NameCheap, Inc. | 18 Nov 2015 | 4 Dec 2016 | 18 Nov 2017 |
| 685 | rockersdiscos.com | Arsys Internet, S.L. dba NICLINE.COM | 20 Nov 2015 | 20 Nov 2015 | 20 Nov 2016 |
| 686 | rockeroapp.com | GoDaddy.com, LLC | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2016 |
| 687 | rockeroadchallenge.com | GoDaddy.com, LLC | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2017 |
| 688 | rockersoccer.com | GoDaddy.com, LLC | 28 Nov 2015 | 28 Nov 2015 | 28 Nov 2016 |
| 689 | rockeros.info | NameCheap, Inc. | 9 Aug 2018 | 9 Aug 2018 | 9 Aug 2019 |
| 690 | rockersonmymind.org | GoDaddy.com, LLC | 3 Dec 2015 | 4 Dec 2016 | 3 Dec 2017 |
| 691 | rockersonmymind.net | GoDaddy.com, LLC | 3 Dec 2015 | 3 Dec 2015 | 3 Dec 2016 |
| 692 | rockersonmymind.com | GoDaddy.com, LLC | 3 Dec 2015 | 4 Dec 2025 | 3 Dec 2026 |
| 693 | rockers.space | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 2 Dec 2015 | - | 2 Dec 2016 |
| 694 | rockerpower.com | Hostinger, UAB | 5 Jul 2025 | 5 Jul 2025 | 5 Jul 2026 |
| 695 | rockerickson.net | GoDaddy.com, LLC | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 696 | rockerickson.info | GoDaddy.com, LLC | 13 Dec 2015 | - | 13 Dec 2016 |
| 697 | rockerickson.com | Name.com, Inc. | 29 Jul 2019 | 9 Aug 2025 | 29 Jul 2026 |
| 698 | rockersclub.net | BigRock Solutions Ltd. | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 699 | rockersandwarriors.org | GoDaddy.com, LLC | 13 Dec 2015 | 17 Oct 2016 | 13 Dec 2018 |
| 700 | rockersandwarriors.net | GoDaddy.com, LLC | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 701 | rockersandwarriors.info | GoDaddy.com, LLC | 13 Dec 2015 | 17 Oct 2016 | 13 Dec 2018 |
| 702 | rockersandwarriors.com | GoDaddy.com, LLC | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 703 | rockerickson.org | GoDaddy.com, LLC | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 704 | rockervera.com | Namesilo, LLC | 12 Apr 2019 | 13 Apr 2019 | 12 Apr 2020 |
| 705 | rockerchurch.com | Cronon AG | 16 Dec 2015 | 4 Feb 2025 | 16 Dec 2026 |
| 706 | rockerbottom.org | Reg2C.com Inc. | 18 Dec 2015 | 25 May 2025 | 18 Dec 2030 |
| 707 | rockerbottom.info | Reg2C.com Inc. | 18 Dec 2015 | 25 May 2025 | 18 Dec 2030 |
| 708 | rockerkayak.com | GoDaddy.com, LLC | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2016 |
| 709 | rockerbottom.net | Reg2C.com Inc. | 18 Dec 2015 | 20 May 2025 | 18 Dec 2030 |
| 710 | rockersasia.com | GoDaddy.com, LLC | 20 Dec 2015 | 20 Dec 2015 | 20 Dec 2017 |
| 711 | rockeroutlet.com | Tucows Domains Inc. | 23 Dec 2015 | 24 Nov 2024 | 23 Dec 2025 |
| 712 | rockerama.com | GoDaddy.com, LLC | 10 Sep 2022 | 22 Nov 2023 | 10 Sep 2023 |
| 713 | rockerzemo.com | GoDaddy.com, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 714 | rockerpals.com | GoDaddy.com, LLC | 14 Nov 2022 | 14 Nov 2024 | 14 Nov 2026 |
| 715 | rockerdown.info | Network Solutions, LLC | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 716 | rockervideos.com | GoDaddy.com, LLC | 28 Dec 2015 | 28 Dec 2015 | 28 Dec 2016 |
| 717 | rockerthosting.com | 1&1 Internet AG | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2016 |
| 718 | rockersagainstguns.com | 1&1 Internet AG | 29 Dec 2015 | 30 Dec 2016 | 29 Dec 2017 |
| 719 | rockerw.com | CloudFlare, Inc. | 30 Dec 2015 | 30 Nov 2025 | 30 Dec 2026 |
| 720 | rockerme.com | GoDaddy.com, LLC | 18 Jan 2020 | 18 Jan 2020 | 18 Jan 2021 |
| 721 | rockerman.com | GoDaddy.com, LLC | 30 Dec 2015 | 31 Dec 2024 | 30 Dec 2025 |
| 722 | rockerbuben.com | PSI-USA, Inc. dba Domain Robot | 30 Dec 2015 | 18 Feb 2017 | 30 Dec 2017 |
| 723 | rockerzroom.com | CV. Jogjacamp | 21 Jul 2021 | 27 Sep 2023 | 21 Jul 2023 |
| 724 | rockers4peace.com | GoDaddy.com, LLC | 1 Jan 2016 | 1 Jan 2016 | 1 Jan 2018 |
| 725 | rockerpillow.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 726 | rockermomma.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2025 | 3 Jan 2026 |
| 727 | rockermama.com | GoDaddy.com, LLC | 3 Jan 2016 | 18 Aug 2023 | 4 Jul 2030 |
| 728 | rockerdaddy.com | GoDaddy.com, LLC | 2 Jan 2016 | 5 Jul 2025 | 4 Jul 2026 |
| 729 | rockerella.com | Eranet International Limited | 6 Oct 2021 | 15 Nov 2024 | 6 Oct 2024 |
| 730 | rockerosdecorazon.com | GoDaddy.com, LLC | 19 Aug 2019 | 19 Aug 2019 | 19 Aug 2020 |
| 731 | rockermotorbike.com | Network Solutions, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2018 |
| 732 | rockermomrestyle.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 733 | rockerjuice.com | GoDaddy.com, LLC | 2 Jul 2019 | 2 Jul 2019 | 2 Jul 2020 |
| 734 | rocker7.com | GoDaddy.com, LLC | 12 Feb 2008 | 13 Feb 2025 | 12 Feb 2026 |
| 735 | rockersrefine.com | eNom, Inc. | 6 Jan 2016 | 23 Dec 2016 | 6 Jan 2018 |
| 736 | rockergroup.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2016 | 3 Jan 2017 | 8 Jan 2018 |
| 737 | rockerteens.com | Annulet LLC | 2 Mar 2018 | 19 Apr 2025 | 2 Mar 2026 |
| 738 | rockerslair.com | Hosting Concepts B.V. dba Openprovider | 25 Oct 2021 | 26 Oct 2021 | 25 Oct 2022 |
| 739 | rockerresearch.com | Namesilo, LLC | 11 Jan 2016 | 12 Jan 2025 | 11 Jan 2026 |
| 740 | rockerprog.com | GoDaddy.com, LLC | 1 Jun 2022 | 1 Jun 2022 | 1 Jun 2023 |
| 741 | rockerbox-motorcycles.com | Cosmotown, Inc. | 13 Aug 2025 | 13 Aug 2025 | 13 Aug 2026 |
| 742 | rockerarmshaft.com | Hongkong Domain Name Information Management Co., L… | 12 Jun 2022 | 18 Aug 2023 | 12 Jun 2023 |
| 743 | rocker1.biz | register.com, Inc. | 14 Jan 2016 | - | 13 Jan 2017 |
| 744 | rockersuit.com | Name.com, Inc. | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 745 | rockersforchrist.org | Google, Inc. | 31 Jan 2021 | 17 Jul 2025 | 31 Jan 2026 |
| 746 | rockerhub.net | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2018 |
| 747 | rockerhub.com | DropCatch.com 1519 LLC | 18 Jun 2023 | 19 Jun 2023 | 18 Jun 2026 |
| 748 | rockerharleywedding.com | GoDaddy.com, LLC | 27 Jan 2020 | 27 Jan 2020 | 27 Jan 2021 |
| 749 | rockerzindia.com | GoDaddy.com, LLC | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 750 | rockers.online | NameCheap, Inc. | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2017 |
| 751 | rockerskiy.com | register.com, Inc. | 19 Jan 2016 | 23 Jan 2017 | 19 Jan 2018 |
| 752 | rockermini.com | GoDaddy.com, LLC | 7 Apr 2017 | 7 Apr 2017 | 7 Apr 2018 |
| 753 | rockerfellers.net | Network Solutions, LLC | 23 Jan 2016 | 23 Jan 2016 | 23 Jan 2017 |
| 754 | rockerscreative.com | Tucows Domains Inc. | 20 Jan 2014 | 24 Jan 2016 | 20 Jan 2017 |
| 755 | rockerkegi.com | 1&1 Internet AG | 24 Jan 2016 | 24 Jan 2016 | 24 Jan 2017 |
| 756 | rockerbet.com | NameCheap, Inc. | 14 Nov 2023 | 17 Nov 2025 | 14 Nov 2026 |
| 757 | rockerosviral.info | GoDaddy.com, LLC | 28 Jan 2016 | - | 28 Jan 2017 |
| 758 | rocker-parties.com | NameCheap, Inc. | 5 Oct 2020 | 5 Sep 2025 | 5 Oct 2026 |
| 759 | rockerplacellc.com | Tucows Domains Inc. | 29 Jan 2016 | 2 Feb 2017 | 29 Jan 2017 |
| 760 | rockersmagazine.com | Name.com, Inc. | 10 Dec 2022 | 18 Nov 2025 | 10 Dec 2026 |
| 761 | rockersandgentlemenmfg.com | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 30 Jan 2018 |
| 762 | rockerpreneur.com | GoDaddy.com, LLC | 12 Dec 2025 | 12 Dec 2025 | 12 Dec 2026 |
| 763 | rockersblog.com | Wild West Domains, LLC | 31 Jan 2016 | 31 Jan 2016 | 31 Jan 2017 |
| 764 | rockersconstruction.com | TurnCommerce, Inc. DBA NameBright.com | 1 Feb 2016 | 4 Jan 2025 | 1 Feb 2026 |
| 765 | rockerswebsolutions.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 766 | rockeretentionsystems.com | GoDaddy.com, LLC | 6 Feb 2016 | 6 Feb 2016 | 6 Feb 2019 |
| 767 | rockeros.online | GoDaddy.com, LLC | 24 Jul 2017 | 24 Jul 2017 | 24 Jul 2018 |
| 768 | rockerstickers.com | register.com, Inc. | 9 Feb 2016 | 9 Feb 2016 | 9 Feb 2017 |
| 769 | rockersonly.com | Annulet LLC | 10 Feb 2016 | 11 Feb 2025 | 10 Feb 2026 |
| 770 | rockergt.com | GoDaddy.com, LLC | 11 Feb 2016 | 11 Feb 2016 | 11 Feb 2017 |
| 771 | rockerba63.com | register.com, Inc. | 10 Feb 2016 | 10 Feb 2016 | 10 Feb 2017 |
| 772 | rockerjackets.com | GoDaddy.com, LLC | 3 May 2019 | 3 May 2019 | 3 May 2020 |
| 773 | rockerfashion.com | Annulet LLC | 17 Nov 2018 | 3 Nov 2025 | 17 Nov 2026 |
| 774 | rockerolla.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 775 | rockernet.com | GoDaddy.com, LLC | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 776 | rockerit.com | DropCatch.com 921 LLC | 6 May 2017 | 15 Jul 2017 | 6 May 2018 |
| 777 | rockergods.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jun 2018 | 1 Nov 2025 | 13 Jun 2026 |
| 778 | rockercity.com | GoDaddy.com, LLC | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 779 | rockersreggae.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 19 Nov 2021 | 19 Nov 2021 | 19 Nov 2022 |
| 780 | rockerofilms.com | - | 15 Jul 2011 | 15 Jul 2011 | 15 Jul 2017 |
| 781 | rockerdojo.com | GoDaddy.com, LLC | 18 Feb 2016 | 20 Sep 2022 | 18 Feb 2026 |
| 782 | rockersbloodpills.com | FastDomain Inc. | 20 Feb 2016 | 21 Feb 2017 | 20 Feb 2018 |
| 783 | rockerroomstudios.com | Tucows Domains Inc. | 19 Feb 2008 | 23 Feb 2016 | 19 Feb 2017 |
| 784 | rockernrail.com | GoDaddy.com, LLC | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 785 | rockerandrail.com | GoDaddy.com, LLC | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 786 | rockerfeller.biz | GoDaddy.com, LLC | 25 Feb 2016 | 7 Apr 2025 | 24 Feb 2025 |
| 787 | rockerminibmx.com | GoDaddy.com, LLC | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 788 | rockerfeller.info | GoDaddy.com, LLC | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 789 | rockerfeller.rocks | GoDaddy.com, LLC | 25 Feb 2016 | 11 Apr 2025 | 25 Feb 2026 |
| 790 | rockersretail.com | GoDaddy.com, LLC | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 791 | rockermusictools.com | Misk.com, Inc. | 18 Feb 2006 | 10 Mar 2025 | 18 Feb 2026 |
| 792 | rockermomnetwork.com | GoDaddy.com, LLC | 25 Feb 2016 | 21 Sep 2022 | 25 Feb 2026 |
| 793 | rockerfeller.net | Squarespace Domains LLC | 3 Jan 2024 | 15 Feb 2025 | 3 Jan 2025 |
| 794 | rockerz.org | RegistryGate GmbH | 21 Mar 2023 | 20 Nov 2025 | 21 Mar 2026 |
| 795 | rockers.info | NameCheap, Inc. | 3 Aug 2024 | - | 3 Aug 2025 |
| 796 | rockerbabyshop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Feb 2016 | 26 Feb 2016 | 26 Feb 2017 |
| 797 | rockerylandscapes.com | GoDaddy.com, LLC | 1 Mar 2016 | 12 Mar 2025 | 1 Mar 2026 |
| 798 | rockersentertainers.com | GoDaddy.com, LLC | 22 May 2017 | 9 May 2025 | 22 May 2026 |
| 799 | rockertran.com | OnlineNIC, Inc. | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 800 | rockerized.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 801 | rockerize.com | 35 Technology Co., Ltd. | 16 May 2021 | 20 May 2021 | 17 May 2022 |
| 802 | rockerscreed.com | GoDaddy.com, LLC | 6 Mar 2016 | 6 Mar 2016 | 6 Mar 2017 |
| 803 | rockeraudio.com | GoDaddy.com, LLC | 14 Mar 2022 | 21 Mar 2025 | 14 Mar 2026 |
| 804 | rockercables.com | GoDaddy.com, LLC | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2018 |
| 805 | rockerandvain.com | GoDaddy.com, LLC | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2017 |
| 806 | rockersridersribs.net | Google, Inc. | 9 Mar 2016 | 9 Mar 2017 | 9 Mar 2018 |
| 807 | rockersridersribs.com | Porkbun, LLC | 9 Mar 2016 | 24 Feb 2025 | 9 Mar 2026 |
| 808 | rockerchris.com | GoDaddy.com, LLC | 10 Mar 2016 | 11 Mar 2025 | 10 Mar 2026 |
| 809 | rockersworld.net | Vautron Rechenzentrum AG | 13 Mar 2016 | 13 Mar 2016 | 13 Mar 2017 |
| 810 | rockersadda.com | GoDaddy.com, LLC | 13 Mar 2016 | 13 Mar 2016 | 13 Mar 2017 |
| 811 | rockerbox.bike | GoDaddy.com, LLC | 13 Mar 2016 | 13 Mar 2016 | 13 Mar 2017 |
| 812 | rockerstextures.com | GoDaddy.com, LLC | 14 Mar 2016 | 14 Mar 2016 | 14 Mar 2017 |
| 813 | rockermamameals.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 814 | rockerian.com | Interweb Advertising D.B.A. Profile Builder | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 815 | rockers.irish | Name.com, Inc. | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 816 | rockerchickwellness.com | GoDaddy.com, LLC | 5 Nov 2022 | 16 Jan 2024 | 5 Nov 2023 |
| 817 | rockery.com | GoDaddy.com, LLC | 2 Mar 1999 | 3 Mar 2024 | 2 Mar 2026 |
| 818 | rockers.com | Tucows Domains Inc. | 13 Dec 1998 | 7 Oct 2025 | 12 Dec 2026 |
| 819 | rockeries.com | TurnCommerce, Inc. DBA NameBright.com | 15 Dec 2009 | 31 Jan 2020 | 15 Dec 2025 |
| 820 | rockerblind.com | GoDaddy.com, LLC | 20 Mar 2016 | 1 May 2025 | 20 Mar 2025 |
| 821 | rockeroniandcheeses.com | GoDaddy.com, LLC | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 822 | rockeroniandcheese.com | GoDaddy.com, LLC | 23 Mar 2016 | 24 Mar 2025 | 23 Mar 2026 |
| 823 | rockeroni.com | GoDaddy.com, LLC | 23 Mar 2016 | 24 Mar 2025 | 23 Mar 2026 |
| 824 | rockerfellow.com | Name.com, Inc. | 23 Mar 2016 | 21 Mar 2017 | 23 Mar 2018 |
| 825 | rockerdeathchannel.com | DreamHost, LLC | 23 Mar 2016 | 25 Mar 2017 | 23 Mar 2018 |
| 826 | rockersofnote.com | Network Solutions, LLC | 25 Mar 2016 | 25 Mar 2016 | 25 Mar 2017 |
| 827 | rockerslockers.com | GoDaddy.com, LLC | 9 Nov 2002 | 10 Nov 2025 | 9 Nov 2026 |
| 828 | rockers.site | NameCheap, Inc. | 28 Mar 2016 | 28 Mar 2016 | 28 Mar 2017 |
| 829 | rockertshirt.com | NameCheap, Inc. | 5 Aug 2021 | - | 5 Aug 2022 |
| 830 | rockermom.love | - | 29 Mar 2016 | 29 Mar 2016 | 29 Mar 2017 |
| 831 | rockerhaugen.org | Tucows Domains Inc. | 8 Apr 2003 | 12 Feb 2025 | 8 Apr 2026 |
| 832 | rockerpipe.com | Mesh Digital Limited | 1 Apr 2016 | 11 Sep 2024 | 1 Apr 2026 |
| 833 | rockerpub.com | TurnCommerce, Inc. DBA NameBright.com | 2 Apr 2016 | 4 May 2024 | 2 Apr 2024 |
| 834 | rockerfashions.com | GoDaddy.com, LLC | 2 Apr 2016 | 2 Apr 2016 | 2 Apr 2017 |
| 835 | rockersusc.com | register.com, Inc. | 12 Jul 2024 | 11 Jun 2025 | 12 Jul 2026 |
| 836 | rockercomputer.tech | GoDaddy.com, LLC | 31 Aug 2021 | 31 Aug 2021 | 31 Aug 2022 |
| 837 | rockercomputer.org | GoDaddy.com, LLC | 5 Apr 2016 | 20 May 2025 | 5 Apr 2026 |
| 838 | rockercomputer.net | GoDaddy.com, LLC | 31 Aug 2021 | 30 Aug 2021 | 31 Aug 2022 |
| 839 | rockercomputer.info | GoDaddy.com, LLC | 5 Apr 2016 | 20 May 2025 | 5 Apr 2026 |
| 840 | rockercomputer.com | GoDaddy.com, LLC | 5 Apr 2016 | 8 Apr 2025 | 5 Apr 2026 |
| 841 | rockerosdelosmuertos.com | Wild West Domains, LLC | 7 Apr 2016 | 7 Apr 2016 | 7 Apr 2017 |
| 842 | rockerooboutique.com | Tucows Domains Inc. | 7 Apr 2016 | 9 Mar 2025 | 7 Apr 2026 |
| 843 | rockerfilms.com | GoDaddy.com, LLC | 9 Apr 2016 | 9 Apr 2016 | 9 Apr 2017 |
| 844 | rockersphotos.com | DropCatch.com 1028 LLC | 21 May 2018 | 21 May 2018 | 21 May 2019 |
| 845 | rockerkasarunk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Apr 2016 | 10 Apr 2016 | 10 Apr 2017 |
| 846 | rockernation.com | TurnCommerce, Inc. DBA NameBright.com | 12 Apr 2016 | 6 Apr 2021 | 12 Apr 2026 |
| 847 | rockershovel.com | HiChina Zhicheng Technology Limited | 15 Apr 2016 | 24 Apr 2017 | 15 Apr 2018 |
| 848 | rockerscoffee.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Mar 2023 | 27 Feb 2025 | 1 Mar 2026 |
| 849 | rockermomstore.com | Tucows Domains Inc. | 19 Aug 2025 | 19 Aug 2025 | 19 Aug 2026 |
| 850 | rockerio.com | TurnCommerce, Inc. DBA NameBright.com | 4 Jul 2017 | 3 Aug 2024 | 4 Jul 2024 |
| 851 | rockerstribune.com | GoDaddy.com, LLC | 17 Apr 2016 | 17 Apr 2016 | 17 Apr 2017 |
| 852 | rockersislandwireless.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 853 | rockersislandstyles.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 854 | rockersislandstyle.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 855 | rockersislandshows.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 856 | rockersislandmotors.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 857 | rockersislandmobile.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 858 | rockersislandhotels.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 859 | rockersislandhotel.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 860 | rockersislandfashion.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 861 | rockersislandcondos.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 862 | rockersislandclubs.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 863 | rockersislandclub.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 864 | rockersislandcellular.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 865 | rockersislandcars.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 866 | rockeria.club | GoDaddy.com, LLC | 17 Apr 2016 | 17 Apr 2016 | 16 Apr 2018 |
| 867 | rockersinroad.com | GoDaddy.com, LLC | 19 Apr 2016 | 20 Apr 2025 | 19 Apr 2026 |
| 868 | rockertshirt.net | BigRock Solutions Ltd. | 21 Apr 2016 | 4 May 2017 | 21 Apr 2018 |
| 869 | rockerpty.com | NameCheap, Inc. | 26 Jun 2017 | 11 Jan 2018 | 26 Jun 2019 |
| 870 | rockerswap.com | NameCheap, Inc. | 12 Jun 2023 | 24 Aug 2024 | 12 Jun 2024 |
| 871 | rocker-rente.com | RegistryGate GmbH | 22 Apr 2016 | 23 Apr 2017 | 22 Apr 2018 |
| 872 | rockerhost.top | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 873 | rockerbd.com | One.com A/S | 8 Feb 2024 | 26 Nov 2025 | 8 Feb 2026 |
| 874 | rockeramp.com | DropCatch.com 1110 LLC | 14 Jul 2018 | 14 Jul 2018 | 14 Jul 2019 |
| 875 | rockeranime.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 876 | rockercover.com | 1&1 Internet AG | 27 Apr 2016 | 9 Jun 2025 | 27 Apr 2025 |
| 877 | rockertatoos.com | GoDaddy.com, LLC | 19 Jan 2017 | 19 Jan 2017 | 19 Jan 2018 |
| 878 | rocker-internet.com | Beijing Lanhai Jiye Technology Co., Ltd | 28 Feb 2023 | 28 Oct 2025 | 28 Feb 2026 |
| 879 | rockerblog.com | 1&1 Internet AG | 1 May 2016 | 1 May 2016 | 1 May 2018 |
| 880 | rockerbelles.com | Google, Inc. | 2 May 2016 | 17 Apr 2025 | 2 May 2026 |
| 881 | rockersmotosg.com | GoDaddy.com, LLC | 6 May 2016 | 6 May 2016 | 6 May 2017 |
| 882 | rockerschiropracticllc.com | GoDaddy.com, LLC | 6 May 2016 | 6 May 2016 | 6 May 2017 |
| 883 | rockerenterprises.com | GoDaddy.com, LLC | 6 May 2016 | 2 May 2025 | 6 May 2027 |
| 884 | rockerprocessing.com | 1&1 Internet AG | 10 May 2016 | 19 Mar 2018 | 10 May 2026 |
| 885 | rockerfeller.center | NameCheap, Inc. | 11 Dec 2020 | 11 Dec 2020 | 11 Dec 2021 |
| 886 | rockersheaven.com | Tucows Domains Inc. | 21 May 2016 | 22 Apr 2017 | 21 May 2018 |
| 887 | rockersdating.com | Tucows Domains Inc. | 21 May 2016 | 22 Apr 2017 | 21 May 2018 |
| 888 | rockerdo.download | Alpnames Limited | 22 Apr 2016 | 22 Apr 2016 | 21 Apr 2017 |
| 889 | rockerkinetic.com | 1&1 Internet AG | 25 May 2016 | 10 Jul 2022 | 25 May 2026 |
| 890 | rockertops.com | GoDaddy.com, LLC | 26 May 2016 | 26 May 2016 | 26 May 2017 |
| 891 | rockerbike.com | GoDaddy.com, LLC | 26 May 2016 | 31 Dec 2024 | 26 May 2026 |
| 892 | rockers.top | West263 International Limited | 8 Aug 2017 | - | 8 Aug 2018 |
| 893 | rocker-room.com | GMO Internet Inc. | 2 Jun 2014 | 3 May 2017 | 2 Jun 2018 |
| 894 | rockerglamour.com | Hostinger, UAB | 7 Aug 2023 | 21 Nov 2024 | 7 Aug 2026 |
| 895 | rockersareus.org | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 896 | rockersareus.net | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 897 | rockersareus.info | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 898 | rockershop.com | Network Solutions, LLC | 9 Feb 2011 | 11 Dec 2025 | 9 Feb 2027 |
| 899 | rockersareus.com | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2018 |
| 900 | rockersandlovers.com | eNom, Inc. | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 901 | rockervibe.com | DropCatch.com 858 LLC | 8 May 2024 | 9 May 2024 | 8 May 2026 |
| 902 | rockervibeamps.com | GoDaddy.com, LLC | 3 Jun 2016 | 3 Jun 2016 | 3 Jun 2017 |
| 903 | rockertackle.com | GoDaddy.com, LLC | 3 Jun 2016 | 3 Jun 2016 | 3 Jun 2018 |
| 904 | rockerstakeon.com | - | 4 Jun 2016 | 4 Jun 2016 | 4 Jun 2017 |
| 905 | rockerosenmichigan.com | GoDaddy.com, LLC | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 906 | rockermusic.com | GoDaddy.com, LLC | 30 Mar 2003 | 10 Sep 2022 | 30 Mar 2026 |
| 907 | rockerdoll.xyz | NameCheap, Inc. | 1 Jun 2016 | 27 Jun 2016 | 1 Jun 2017 |
| 908 | rockerarm.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 28 Sep 2016 | 2 Jun 2017 |
| 909 | rockers4wildlife.com | GoDaddy.com, LLC | 14 Jul 2020 | 19 Jul 2025 | 14 Jul 2026 |
| 910 | rockerbplantfarms.com | Google, Inc. | 8 Jun 2016 | 24 May 2025 | 8 Jun 2026 |
| 911 | rockerbplantfarm.com | Google, Inc. | 8 Jun 2016 | 24 May 2025 | 8 Jun 2026 |
| 912 | rockermen.men | Lexsynergy Limited | 9 Jun 2016 | 9 Jun 2016 | 9 Jun 2017 |
| 913 | rockerspphone.com | Namesilo, LLC | 9 Jun 2016 | 9 Jun 2016 | 9 Jun 2017 |
| 914 | rockerbbeg.com | eNom, Inc. | 9 Jun 2016 | 9 Jun 2016 | 9 Jun 2017 |
| 915 | rockeramps.com | Network Solutions, LLC | 10 Jun 2016 | 5 Mar 2017 | 10 Jun 2018 |
| 916 | rockermen.com | Realtime Register B.V. | 10 Feb 2021 | 6 Feb 2025 | 10 Feb 2026 |
| 917 | rockerdenim.com | GoDaddy.com, LLC | 10 Jun 2016 | 11 Jun 2025 | 10 Jun 2026 |
| 918 | rockerband.xyz | GoDaddy.com, LLC | 10 Jun 2016 | 14 Sep 2016 | 10 Jun 2017 |
| 919 | rockersbmx.com | GoDaddy.com, LLC | 13 Jun 2016 | 13 Jun 2016 | 13 Jun 2017 |
| 920 | rockertip.com | Namesilo, LLC | 13 Jun 2016 | 2 Sep 2016 | 13 Jun 2017 |
| 921 | rockerskull.com | 1&1 Internet AG | 11 Feb 2009 | 12 Feb 2025 | 11 Feb 2026 |
| 922 | rockersquare.com | NameCheap, Inc. | 15 Jun 2016 | 16 May 2025 | 15 Jun 2026 |
| 923 | rockerboxstrategies.com | GoDaddy.com, LLC | 14 Jun 2016 | 15 Jun 2025 | 14 Jun 2026 |
| 924 | rockerboxconsulting.com | GoDaddy.com, LLC | 14 Jun 2016 | 15 Jun 2025 | 14 Jun 2026 |
| 925 | rockerboxrealestate.com | GoDaddy.com, LLC | 14 Jun 2016 | 15 Jun 2025 | 14 Jun 2026 |
| 926 | rockerboxinc.com | GoDaddy.com, LLC | 14 Jun 2016 | 15 Jun 2025 | 14 Jun 2026 |
| 927 | rockerboxminingequipment.com | GoDaddy.com, LLC | 3 Apr 2013 | 3 Apr 2017 | 3 Apr 2018 |
| 928 | rockermeddle.com | register.com, Inc. | 16 Jun 2016 | 16 Jun 2016 | 16 Jun 2017 |
| 929 | rockerheead.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jun 2016 | 17 Jun 2016 | 17 Jun 2017 |
| 930 | rockerbabes.com | GoDaddy.com, LLC | 10 Nov 2019 | 21 Nov 2025 | 10 Nov 2026 |
| 931 | rockermomjams.com | GoDaddy.com, LLC | 22 Jun 2016 | 22 Jun 2016 | 22 Jun 2017 |
| 932 | rockersgifts.com | Tucows Domains Inc. | 22 Jun 2016 | 26 Jun 2018 | 22 Jun 2018 |
| 933 | rockerschristmas.com | Tucows Domains Inc. | 22 Jun 2016 | 26 Jun 2018 | 22 Jun 2018 |
| 934 | rockerscheat.com | Namesilo, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2017 |
| 935 | rockersagree.com | Namesilo, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2017 |
| 936 | rockertmail.com | Dynadot, LLC | 11 Sep 2017 | 1 Aug 2025 | 11 Sep 2026 |
| 937 | rockersrevengereunited.com | GoDaddy.com, LLC | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 938 | rockersrevengeofficial.com | GoDaddy.com, LLC | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 939 | rockerp.top | Alpnames Limited | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 940 | rockerinabox.com | GoDaddy.com, LLC | 13 Oct 2021 | 25 Dec 2025 | 13 Oct 2025 |
| 941 | rockersbottomshoes.com | Xin Net Technology Corporation | 29 Jun 2016 | 29 Jun 2016 | 29 Jun 2017 |
| 942 | rockerbabyclothes.com | ZigZagNames.com LLC | 21 May 2013 | 3 Jul 2017 | 21 May 2018 |
| 943 | rockeranch.com | GoDaddy.com, LLC | 10 Jul 2023 | 10 Jul 2023 | 10 Jul 2024 |
| 944 | rockertshirts.xyz | NameCheap, Inc. | 30 Jun 2016 | 29 Jul 2016 | 30 Jun 2017 |
| 945 | rockeradecorazon80.com | GoDaddy.com, LLC | 1 Jul 2016 | 1 Jul 2016 | 1 Jul 2017 |
| 946 | rockerbandz.com | GoDaddy.com, LLC | 3 Jul 2016 | 3 Jul 2016 | 3 Jul 2017 |
| 947 | rockerboxresources.com | GoDaddy.com, LLC | 25 Jan 2012 | 25 Jan 2016 | 25 Jan 2017 |
| 948 | rockerdoll.com | 1&1 Internet AG | 26 Jan 2011 | 27 Jan 2017 | 26 Jan 2018 |
| 949 | rockercoatl.com | Wild West Domains, LLC | 6 Jul 2016 | 6 Jul 2016 | 6 Jul 2017 |
| 950 | rockertcollectibles.com | Tucows Domains Inc. | 6 Jul 2016 | 20 Aug 2025 | 6 Jul 2027 |
| 951 | rockersreflect.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Jun 2016 | 7 Jun 2016 | 7 Jun 2017 |
| 952 | rockeribaraichi.xyz | GMO Internet Inc. | 7 Jun 2016 | 29 Jul 2016 | 7 Jun 2017 |
| 953 | rockeries.xyz | Uniregistrar Corp | 2 Jun 2016 | 6 Dec 2016 | 2 Jun 2017 |
| 954 | rockerfrench.xyz | GMO Internet Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 955 | rockerbplant.farm | Google, Inc. | 8 Jun 2016 | 3 Jun 2025 | 8 Jun 2026 |
| 956 | rockerge.men | 101domain, Inc. | 15 Jun 2016 | 20 Jun 2016 | 15 Jun 2017 |
| 957 | rockery.xyz | GMO Internet Inc. | 19 Aug 2025 | 24 Aug 2025 | 19 Aug 2026 |
| 958 | rockeriesldegc3566.xyz | NameCheap, Inc. | 21 Jun 2016 | 27 Jun 2016 | 21 Jun 2017 |
| 959 | rockery.vip | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Jun 2016 | - | 17 Jun 2017 |
| 960 | rockermoji.com | GoDaddy.com, LLC | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 961 | rockercollusion.xyz | GMO Internet Inc. | 8 Jun 2016 | 17 Jun 2016 | 8 Jun 2017 |
| 962 | rocker-chick.com | Tucows Domains Inc. | 18 Jan 2023 | 22 Jan 2024 | 18 Jan 2025 |
| 963 | rockersbarandgrill.com | GoDaddy.com, LLC | 11 Jul 2016 | 11 Jul 2016 | 11 Jul 2017 |
| 964 | rockerline.clothing | Mesh Digital Limited | 22 May 2014 | 20 May 2017 | 22 May 2018 |
| 965 | rockerzzz.co.in | - | 1 Sep 2017 | 16 Oct 2025 | 1 Sep 2026 |
| 966 | rockeragency.com | Google, Inc. | 15 Dec 2024 | 30 Nov 2025 | 15 Dec 2026 |
| 967 | rockerhocker.com | - | 12 Jul 2010 | 12 Jul 2010 | 12 Jul 2017 |
| 968 | rockerfellabarbers.london | 1&1 Internet AG | 9 Sep 2014 | 22 Sep 2025 | 9 Sep 2026 |
| 969 | rockers-fm.cologne | united-domains AG | 21 Sep 2014 | 5 Nov 2015 | 21 Sep 2016 |
| 970 | rockercompany.com | NameCheap, Inc. | 16 Jul 2016 | 24 Jul 2025 | 16 Jul 2026 |
| 971 | rockers.biz | Dynadot, LLC | 28 Feb 2018 | 31 Oct 2025 | 28 Feb 2026 |
| 972 | rockerobics.biz | GoDaddy.com, LLC | 2 May 2010 | 23 Mar 2017 | 1 May 2018 |
| 973 | rockersdive.biz | DomainPeople, Inc. | 26 Sep 2014 | 27 Sep 2015 | 25 Sep 2016 |
| 974 | rockermomdiary.com | - | 19 Jul 2016 | 19 Jul 2016 | 19 Jul 2017 |
| 975 | rockerztech.com | - | 21 Jul 2016 | 21 Jul 2016 | 21 Jul 2018 |
| 976 | rockerssalute.com | - | 22 Jul 2016 | 22 Jul 2016 | 22 Jul 2017 |
| 977 | rockersforrepublicans.com | - | 23 Jul 2016 | 23 Jul 2016 | 23 Jul 2017 |
| 978 | rockersforrepublicans.info | GoDaddy.com, LLC | 23 Jul 2016 | 3 Sep 2017 | 23 Jul 2018 |
| 979 | rockersforrepublicans.net | - | 23 Jul 2016 | 23 Jul 2016 | 23 Jul 2017 |
| 980 | rockersforrepublicans.org | GoDaddy.com, LLC | 23 Jul 2016 | 3 Sep 2017 | 23 Jul 2018 |
| 981 | rockersforrepublicans.us | - | 23 Jul 2016 | 23 Jul 2016 | 22 Jul 2017 |
| 982 | rockerman.club | GoDaddy.com, LLC | 22 Jul 2016 | 1 Sep 2017 | 21 Jul 2017 |
| 983 | rockerlee.com | Wild West Domains, LLC | 12 Jun 2025 | 12 Jun 2025 | 12 Jun 2026 |
| 984 | rockerplus.com | - | 24 Jul 2016 | 24 Jul 2016 | 24 Jul 2017 |
| 985 | rockersalive.com | - | 24 Jul 2016 | 24 Jul 2016 | 24 Jul 2017 |
| 986 | rockerrae08.com | - | 26 Jul 2016 | 26 Jul 2016 | 26 Jul 2017 |
| 987 | rockersnrollers.com | GoDaddy.com, LLC | 25 Jul 2016 | 26 Jul 2024 | 25 Jul 2026 |
| 988 | rockerbeeshipping.com | - | 31 Jul 2016 | 31 Jul 2016 | 31 Jul 2017 |
| 989 | rockersfortrump.com | GoDaddy.com, LLC | 31 Jul 2016 | 1 Aug 2025 | 31 Jul 2026 |
| 990 | rockerranger.com | eNom, Inc. | 31 Jul 2016 | 11 Sep 2017 | 31 Jul 2017 |
| 991 | rockermassage.com | Domain.com, LLC | 12 Mar 2013 | 24 Jun 2025 | 12 Mar 2026 |
| 992 | rockerburger.com | GoDaddy.com, LLC | 19 Apr 2024 | 19 Apr 2025 | 19 Apr 2026 |
| 993 | rockero.info | GMO Internet Inc. | 20 Nov 2023 | 1 Jan 2025 | 20 Nov 2024 |
| 994 | rockergarage.com | GoDaddy.com, LLC | 12 Mar 2022 | 2 Oct 2022 | 12 Mar 2032 |
| 995 | rockergirllook.com | eNom, Inc. | 5 Aug 2016 | 4 Jul 2017 | 5 Aug 2018 |
| 996 | rockersisland.xyz | GoDaddy.com, LLC | 5 Aug 2016 | 24 Sep 2016 | 5 Aug 2017 |
| 997 | rockersaw.com | - | 6 Aug 2016 | 6 Aug 2016 | 6 Aug 2018 |
| 998 | rockerbillybear.com | Tucows Domains Inc. | 9 Aug 2016 | 13 Aug 2019 | 9 Aug 2019 |
| 999 | rockercomputers.com | Tucows Domains Inc. | 9 Aug 2016 | 13 Aug 2017 | 9 Aug 2017 |
| 1000 | rockermeier-mde.net | Mesh Digital Limited | 9 Aug 2016 | 8 Aug 2017 | 9 Aug 2018 |
Displaying 1,000 out of 4,382 domains starting with the keyword "ROCKER". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=rocker
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |