With support for 
Keyword: RICHLAND
Reverse Whois » KEYWORD [richland ] { 3,652 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | richland.edu | - | 4 Apr 2002 | 3 Jul 2017 | 31 Jul 2018 |
| 2 | richland.wa.us | Big House Services, Inc. | 5 Feb 2003 | 22 Mar 2015 | 4 Feb 2016 |
| 3 | richland.club | NameCheap, Inc. | 14 Feb 2017 | 6 Mar 2017 | 13 Feb 2018 |
| 4 | richland.tv | Tucows Domains Inc. | 18 Mar 2021 | 28 Apr 2023 | 18 Mar 2023 |
| 5 | richland.org | easyDNS Technologies, Inc. | 6 Apr 1999 | 2 Feb 2022 | 6 Apr 2027 |
| 6 | richland.blackfriday | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 7 | richland.christmas | Uniregistrar Corp | 30 Sep 2014 | 1 Oct 2014 | 30 Sep 2015 |
| 8 | richland.webcam | Alpnames Limited | 28 Oct 2014 | - | 27 Oct 2015 |
| 9 | richland.trade | Alpnames Limited | 28 Oct 2014 | - | 27 Oct 2015 |
| 10 | richland.dental | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 11 | richland.help | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 12 | richland.diet | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 13 | richland.click | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jan 2015 | 3 Feb 2015 | 29 Jan 2016 |
| 14 | richland.property | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 15 | richland.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 16 | richland.science | Alpnames Limited | 24 Feb 2015 | 24 Apr 2015 | 23 Feb 2016 |
| 17 | richland.college | TLD Registrar Solutions Ltd. | 30 Apr 2015 | 11 Jun 2024 | 30 Apr 2024 |
| 18 | richland.solar | 1&1 Internet AG | 10 May 2015 | 10 May 2025 | 10 May 2026 |
| 19 | richland.bank | EnCirca, Inc. | 26 Jun 2015 | 20 Aug 2015 | 26 Jun 2016 |
| 20 | richland.taipei | Net-Chinese Co., Ltd. | 9 Sep 2015 | 14 Oct 2025 | 8 Sep 2026 |
| 21 | richland.school | GoDaddy.com, LLC | 13 Oct 2015 | 14 Oct 2025 | 13 Oct 2027 |
| 22 | richland.xyz | Xiamen ChinaSource Internet Service Co., Ltd. | 14 Aug 2025 | 19 Aug 2025 | 14 Aug 2026 |
| 23 | richland.email | Regtime Ltd. | 24 Apr 2020 | 23 May 2020 | 24 Apr 2021 |
| 24 | richland.city | Mat Bao Trading & Service Company Limited d/b/a Ma… | 10 Aug 2021 | 2 Aug 2024 | - |
| 25 | richland.farm | GoDaddy.com, LLC | 12 Jan 2019 | 26 Feb 2020 | 12 Jan 2021 |
| 26 | richland.tech | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Apr 2021 | 23 Apr 2021 | 23 Apr 2022 |
| 27 | richland.asia | P.A. Viet Nam Company Limited | 30 Mar 2021 | 30 Mar 2021 | 30 Mar 2022 |
| 28 | richland.surgery | Google, Inc. | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 29 | richland.healthcare | Google, Inc. | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 30 | richland.clinic | Google, Inc. | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 31 | richland.properties | - | 23 Sep 2025 | - | 23 Sep 2026 |
| 32 | richland.com | Google, Inc. | 6 Nov 1995 | 21 Jan 2026 | 1 Jan 2026 |
| 33 | richland.net | Network Solutions, LLC | 26 Jun 2005 | 27 Apr 2024 | 26 Jun 2027 |
| 34 | richland.party | Alpnames Limited | 17 Feb 2015 | 3 Mar 2016 | 16 Feb 2017 |
| 35 | richland.tattoo | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 36 | richland.jobs | Name Share, Inc. | 4 Feb 2010 | 21 Mar 2016 | 4 Feb 2017 |
| 37 | richland.top | Jiangsu Bangning Science and technology Co. Ltd. | 24 Jul 2015 | 28 Jun 2017 | 24 Jul 2026 |
| 38 | richland.directory | Wild West Domains, LLC | 17 Apr 2014 | 21 Apr 2020 | 17 Apr 2021 |
| 39 | richland.lol | Uniregistrar Corp | 12 Aug 2015 | 15 Jul 2016 | 12 Aug 2017 |
| 40 | richland.link | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 41 | richland.biz | NameCheap, Inc. | 27 Mar 2002 | 20 Dec 2025 | 30 Dec 2026 |
| 42 | richland.press | NameCheap, Inc. | 25 Jul 2016 | 29 Sep 2017 | 25 Jul 2017 |
| 43 | richland.online | Xiamen ChinaSource Internet Service Co., Ltd. | 14 Sep 2025 | 20 Oct 2025 | 14 Sep 2026 |
| 44 | richland.tel | - | 6 Feb 2010 | 6 Feb 2010 | 5 Feb 2017 |
| 45 | richland.info | NameCheap, Inc. | 18 Sep 2001 | 24 Aug 2024 | 18 Sep 2025 |
| 46 | richland.mobi | GoDaddy.com, LLC | 2 Feb 2019 | 15 Mar 2024 | 2 Feb 2024 |
| 47 | richland.cc | Network Solutions, LLC | 31 May 2001 | 1 Apr 2024 | 31 May 2027 |
| 48 | richland.co.kr | - | 7 Nov 2001 | 12 Dec 2019 | 31 May 2023 |
| 49 | richland.expert | Porkbun, LLC | 7 Apr 2017 | 29 Sep 2017 | 7 Apr 2018 |
| 50 | richland.fr | - | 6 Feb 2017 | 6 Feb 2017 | 2 Jun 2018 |
| 51 | richland.rentals | Tucows Domains Inc. | 5 May 2017 | 11 Apr 2025 | 5 May 2026 |
| 52 | richland.co.uk | Reserved | 11 Mar 1999 | 10 Mar 2017 | 11 Mar 2019 |
| 53 | richland.money | - | 13 Jul 2025 | - | 13 Jul 2026 |
| 54 | richland.life | GoDaddy.com, LLC | 2 Feb 2019 | 7 Feb 2019 | 2 Feb 2020 |
| 55 | richland.pro | CommuniGal Communication Ltd. | 19 Apr 2024 | 1 Jun 2025 | 19 Apr 2025 |
| 56 | richland.estate | Tucows Domains Inc. | 30 Sep 2019 | 4 Oct 2020 | 30 Sep 2021 |
| 57 | richland.productions | GoDaddy.com, LLC | 2 Dec 2019 | 7 Dec 2019 | 2 Dec 2020 |
| 58 | richland.one | Google, Inc. | 13 Nov 2021 | 18 Nov 2022 | 13 Nov 2023 |
| 59 | richland.group | - | 10 Apr 2024 | 23 Jun 2025 | 10 Apr 2025 |
| 60 | richland.world | Web Commerce Communications Limited dba WebNic.cc | 15 Jan 2025 | 15 Jan 2026 | 15 Jan 2027 |
| 61 | richland.wtf | NameKing.com Inc. | 4 Aug 2021 | 4 Aug 2021 | 4 Aug 2022 |
| 62 | richland.realestate | Go Australia Domains, LLC | 27 Nov 2018 | 8 Jan 2024 | 27 Nov 2024 |
| 63 | richland.loan | GoDaddy.com, LLC | 19 Jun 2020 | 19 Jun 2020 | 19 Jun 2021 |
| 64 | richland.fyi | Porkbun, LLC | 19 Jun 2020 | 19 Jun 2020 | 19 Jun 2021 |
| 65 | richland.ltd | GMO Internet Inc. | 23 May 2022 | 23 May 2023 | 23 May 2024 |
| 66 | richland.website | eNom, Inc. | 3 Feb 2020 | 8 Feb 2020 | 3 Feb 2021 |
| 67 | richland.realty | Epik Inc. | 26 Sep 2020 | 14 Nov 2021 | 26 Sep 2022 |
| 68 | richland.rest | Limited Liability Company "Registrar of domain nam… | 29 Nov 2020 | - | 29 Nov 2021 |
| 69 | richland.co | GoDaddy.com, LLC | 26 Dec 2021 | 3 Jun 2025 | 26 Dec 2025 |
| 70 | richland.church | Tucows Domains Inc. | 18 Mar 2021 | 28 May 2023 | 18 Mar 2023 |
| 71 | richland.ventures | Network Solutions, LLC | 23 Mar 2021 | 23 Mar 2021 | 23 Mar 2022 |
| 72 | richland.store | GoDaddy.com, LLC | 18 Feb 2025 | 19 Mar 2025 | 18 Feb 2026 |
| 73 | richland.business | - | 22 Sep 2023 | 23 Sep 2024 | 22 Sep 2025 |
| 74 | richland.co.id | - | 9 Sep 2014 | 24 Oct 2022 | 9 Sep 2023 |
| 75 | richland.ai | GoDaddy.com, LLC | 25 Apr 2021 | 29 Apr 2025 | 25 Apr 2027 |
| 76 | richland.icu | Google, Inc. | 18 Nov 2022 | 18 Nov 2022 | 18 Nov 2023 |
| 77 | richland.ca | Webnames.ca Inc. | 13 May 2004 | 29 Oct 2022 | 13 May 2026 |
| 78 | richland.autos | Porkbun, LLC | 6 Aug 2022 | 19 Aug 2023 | 6 Aug 2024 |
| 79 | richland.band | Tucows Domains Inc. | 6 Dec 2021 | 16 Jan 2023 | 6 Dec 2022 |
| 80 | richland.im | - | - | - | - |
| 81 | richland.cn | - | 20 Apr 2003 | - | 20 Apr 2027 |
| 82 | richland.dev | GoDaddy.com, LLC | 8 Nov 2021 | 9 Oct 2025 | 8 Nov 2033 |
| 83 | richland.homes | Global Domains International, Inc. DBA DomainCostC… | 14 Jun 2021 | 6 Aug 2025 | 14 Jun 2026 |
| 84 | richland.vip | GoDaddy.com, LLC | 21 Apr 2023 | 2 Jun 2024 | 21 Apr 2024 |
| 85 | richland.us | NameCheap, Inc. | 24 Apr 2002 | 29 Mar 2025 | 23 Apr 2026 |
| 86 | richland.uk | - | 9 Feb 2022 | 2 Aug 2023 | 9 Feb 2024 |
| 87 | richland.plus | GoDaddy.com, LLC | 8 Jul 2023 | 18 Sep 2024 | 8 Jul 2024 |
| 88 | richland.uk.net | NameCheap, Inc. | 21 May 2023 | 2 Jul 2024 | 21 May 2024 |
| 89 | richland.rocks | Tucows Domains Inc. | 12 Sep 2022 | 22 Nov 2024 | 12 Sep 2024 |
| 90 | richland.co.jp | - | 27 Jun 2000 | 1 Jul 2025 | - |
| 91 | richland.app | GoDaddy.com, LLC | 19 Jan 2024 | 25 Jan 2026 | 19 Jan 2027 |
| 92 | richland.site | Gabia, Inc. | 10 Feb 2024 | 27 Jan 2025 | 10 Feb 2026 |
| 93 | richland.org.uk | - | 1 Sep 2020 | 2 Sep 2025 | 1 Sep 2026 |
| 94 | richland.ru | - | 30 Apr 2019 | - | 30 Apr 2026 |
| 95 | richland.lighting | NameCheap, Inc. | 4 Mar 2025 | - | - |
| 96 | richland.ag | Name.com, Inc. | 21 Apr 2024 | 29 Nov 2025 | 21 Apr 2026 |
| 97 | richland.de | - | - | 13 Apr 2023 | - |
| 98 | richland.eu | Realtime Register B.V. | - | - | - |
| 99 | richlandbank.com | Network Solutions, LLC | 21 Jan 2000 | 20 Dec 2024 | 21 Jan 2028 |
| 100 | richland2.org | Network Solutions, LLC | 6 Jul 1999 | 11 Jul 2024 | 6 Jul 2034 |
| 101 | richlandone.org | GoDaddy.com, LLC | 31 Jul 1996 | 30 Dec 2025 | 30 Jul 2026 |
| 102 | richlandcollege.edu | - | 10 Jan 2002 | 7 Mar 2014 | 31 Jul 2018 |
| 103 | richlandonline.com | Network Solutions, LLC | 27 Apr 1999 | 28 Apr 2025 | 27 Apr 2035 |
| 104 | richlandf1.com | GoDaddy.com, LLC | 28 Feb 2012 | 1 Mar 2025 | 28 Feb 2026 |
| 105 | richlandlibrary.com | Network Solutions, LLC | 9 Jul 2012 | 10 May 2024 | 9 Jul 2026 |
| 106 | richlandsource.com | GoDaddy.com, LLC | 10 Jan 2013 | 8 Jan 2026 | 10 Jan 2029 |
| 107 | richlandtitleinc.com | DomainFalcon LLC | 24 Oct 2014 | 25 Oct 2017 | 24 Oct 2018 |
| 108 | richlandcountyauditor.org | Namesilo, LLC | 18 Nov 1999 | 19 Jan 2026 | 18 Nov 2026 |
| 109 | richlandfederal.com | GoDaddy.com, LLC | 24 May 2013 | 25 May 2015 | 24 May 2016 |
| 110 | richlandwelldrilling.com | Tucows Domains Inc. | 22 Oct 2013 | 26 Oct 2014 | 22 Oct 2015 |
| 111 | richlandmedia.com | GoDaddy.com, LLC | 14 Sep 2022 | 15 Sep 2024 | 14 Sep 2026 |
| 112 | richlandshortsales.com | GoDaddy.com, LLC | 28 May 2008 | 29 May 2015 | 28 May 2016 |
| 113 | richlandshortsale.com | GoDaddy.com, LLC | 28 May 2008 | 29 May 2015 | 28 May 2016 |
| 114 | richlandbarron.info | GoDaddy.com, LLC | 1 Jun 2014 | 2 Jun 2015 | 1 Jun 2016 |
| 115 | richlandautorepair.com | NameCheap, Inc. | 11 Feb 2019 | 11 Feb 2019 | 11 Feb 2020 |
| 116 | richland-global.com | GoDaddy.com, LLC | 24 May 2012 | 25 May 2015 | 24 May 2016 |
| 117 | richlandtools.com | GoDaddy.com, LLC | 27 Oct 2014 | 25 Oct 2024 | 27 Oct 2026 |
| 118 | richlandtool.com | GoDaddy.com, LLC | 27 Oct 2014 | 25 Oct 2024 | 27 Oct 2026 |
| 119 | richlandbrewing.com | DreamHost, LLC | 27 Oct 2014 | 29 Oct 2017 | 27 Oct 2018 |
| 120 | richlandhillsroofingtx.com | GoDaddy.com, LLC | 5 Jun 2013 | 6 Jun 2015 | 5 Jun 2016 |
| 121 | richlandpost.com | GoDaddy.com, LLC | 27 Sep 2008 | 18 Apr 2015 | 27 Sep 2015 |
| 122 | richlandmanor.com | eNom, Inc. | 10 Nov 2009 | 21 Dec 2016 | 10 Nov 2017 |
| 123 | richlanddevelopment.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Mar 2021 | 12 Mar 2021 | 12 Mar 2022 |
| 124 | richlanddoctor.com | Xin Net Technology Corporation | 22 Feb 2021 | 27 May 2021 | 22 Feb 2022 |
| 125 | richlandgrad.com | GoDaddy.com, LLC | 11 Oct 2007 | 23 Dec 2024 | 11 Oct 2024 |
| 126 | richlandfinance.com | GoDaddy.com, LLC | 31 Mar 2012 | 14 Apr 2015 | 31 Mar 2016 |
| 127 | richlands-realty.com | GoDaddy.com, LLC | 30 Dec 2012 | 11 Jan 2015 | 30 Dec 2015 |
| 128 | richlandco.com | Wix.com Ltd. | 26 Nov 2018 | 18 Nov 2025 | 26 Nov 2027 |
| 129 | richlandproducts.com | GoDaddy.com, LLC | 31 Oct 2014 | 12 Dec 2025 | 31 Oct 2026 |
| 130 | richlandjanitorialservice.com | eNom, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 131 | richlandliving.com | Squarespace Domains LLC | 14 Dec 2023 | 29 Nov 2025 | 14 Dec 2026 |
| 132 | richlandtownshiphomesforsale.com | GoDaddy.com, LLC | 25 Sep 2011 | 27 Apr 2015 | 25 Sep 2015 |
| 133 | richlandtechnologies.com | TurnCommerce, Inc. DBA NameBright.com | 14 May 2019 | 8 May 2021 | 14 May 2026 |
| 134 | richlandcountyfair.com | GoDaddy.com, LLC | 2 Dec 2000 | 2 Dec 2025 | 2 Dec 2026 |
| 135 | richlandcountydems.com | GoDaddy.com, LLC | 25 Jul 2008 | 15 Oct 2013 | 25 Jul 2017 |
| 136 | richlandstatebank.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Mar 2006 | 24 Feb 2017 | 30 Mar 2018 |
| 137 | richlandcounty.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Aug 1999 | 5 Aug 2025 | 29 Aug 2026 |
| 138 | richlandcourtsoh.us | 1&1 Internet AG | 3 Mar 2011 | 17 Apr 2025 | 2 Mar 2026 |
| 139 | richlandautomall.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jul 2007 | 24 Jul 2017 | 24 Jul 2017 |
| 140 | richlanddental.com | GoDaddy.com, LLC | 3 Apr 2002 | 4 Apr 2025 | 3 Apr 2026 |
| 141 | richlandavenueschool.org | GoDaddy.com, LLC | 5 Jun 2012 | 23 Oct 2025 | 5 Jun 2027 |
| 142 | richlandclicks.org | Beijing Lanhai Jiye Technology Co., Ltd | 1 Apr 2025 | 6 Apr 2025 | 1 Apr 2026 |
| 143 | richlandcountysheriff.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2005 | 12 Mar 2015 | 11 Dec 2015 |
| 144 | richlandmaps.com | Network Solutions, LLC | 19 Jun 2000 | 20 Jun 2025 | 19 Jun 2035 |
| 145 | richlandsnc.gov | - | - | - | - |
| 146 | richlandwarealestate.com | Name.com, Inc. | 27 Oct 2005 | 16 Dec 2014 | 27 Oct 2015 |
| 147 | richlandgroup.mobi | GMO Internet Inc. | 31 Oct 2014 | - | 31 Oct 2015 |
| 148 | richlandbank.net | Network Solutions, LLC | 9 Nov 1999 | 10 Sep 2024 | 9 Nov 2026 |
| 149 | richlandredeemer.org | CloudFlare, Inc. | 6 Jan 2013 | 25 Dec 2025 | 6 Jan 2035 |
| 150 | richlandroadster.com | GoDaddy.com, LLC | 27 Aug 2010 | 8 Sep 2022 | 7 Dec 2026 |
| 151 | richlandcso.com | GoDaddy.com, LLC | 24 Apr 2008 | 6 Mar 2023 | 24 Apr 2028 |
| 152 | richlandhillstaxi.us | GoDaddy.com, LLC | 9 Jun 2014 | 1 Dec 2014 | 8 Jun 2015 |
| 153 | richlandcommercialroofing.com | GoDaddy.com, LLC | 10 Jun 2014 | 11 Jun 2015 | 10 Jun 2016 |
| 154 | richlandchamber.com | - | 15 May 2025 | 27 Jun 2025 | 15 May 2026 |
| 155 | richlandfcu.com | Network Solutions, LLC | 16 Nov 2000 | 3 Aug 2022 | 16 Nov 2027 |
| 156 | richlandsewing.com | eNom, Inc. | 3 Jul 2001 | 7 Aug 2025 | 3 Jul 2026 |
| 157 | richlandtoday.com | GoDaddy.com, LLC | 16 Jul 2007 | 2 Oct 2025 | 16 Jul 2026 |
| 158 | richlandayso.com | GoDaddy.com, LLC | 6 Mar 2011 | 5 Feb 2024 | 6 Mar 2029 |
| 159 | richlandcountyrecreation.com | Network Solutions, LLC | 25 Oct 2000 | 27 Oct 2025 | 25 Oct 2028 |
| 160 | richlandrecycles.com | GoDaddy.com, LLC | 4 Jun 2008 | 22 Jul 2023 | 4 Jun 2026 |
| 161 | richlandsd.net | Network Solutions, LLC | 20 Oct 2004 | 13 Aug 2025 | 20 Oct 2026 |
| 162 | richlandshooters.com | NameCheap, Inc. | 30 Dec 2008 | 30 Nov 2025 | 30 Dec 2026 |
| 163 | richlandelementary.org | DomainSite, Inc. | 25 Feb 2002 | 13 Jan 2025 | 25 Feb 2030 |
| 164 | richlandsd.com | Network Solutions, LLC | 20 Oct 2004 | 13 Aug 2025 | 20 Oct 2026 |
| 165 | richland-lutheran.org | FastDomain Inc. | 10 Aug 2011 | 4 Sep 2014 | 10 Aug 2015 |
| 166 | richlandauto.net | GoDaddy.com, LLC | 2 Jun 2007 | 31 May 2024 | 2 Jun 2027 |
| 167 | richlandmo.info | Hosting Concepts B.V. dba Openprovider | 25 Jun 2011 | - | 25 Jun 2026 |
| 168 | richlandbombers.us | GoDaddy.com, LLC | 8 Oct 2012 | 5 Oct 2015 | 7 Oct 2017 |
| 169 | richlandhighschool1965.com | GoDaddy.com, LLC | 6 Jul 2014 | 2 Jul 2015 | 6 Jul 2016 |
| 170 | richlandcountyoh.us | NEUSTAR RESERVE ACCOUNT A|US RESERVE|GDAVIDSO | 18 Apr 2002 | 1 Jul 2022 | 12 Dec 2101 |
| 171 | richlandtransport.com | Domain.com, LLC | 22 Nov 2016 | 7 Nov 2025 | 22 Nov 2026 |
| 172 | richlandsafarifestivals.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 173 | richlandcountysherriff.com | Fabulous.com Pty Ltd. | 18 Oct 2005 | 19 Oct 2017 | 18 Oct 2017 |
| 174 | richland-online.com | Tucows Domains Inc. | 30 Jan 2018 | 30 Jan 2018 | 30 Jan 2019 |
| 175 | richlanddecor.com | Google, Inc. | 19 Aug 2014 | 10 Feb 2016 | 19 Aug 2017 |
| 176 | richlandelectrolysis.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 177 | richlandtv.com | TurnCommerce, Inc. DBA NameBright.com | 18 May 2018 | 28 Jul 2025 | 18 May 2025 |
| 178 | richlandflowershop.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 179 | richlandgp.com | Web Commerce Communications Limited dba WebNic.cc | 30 Nov 2023 | 30 Nov 2023 | 30 Nov 2026 |
| 180 | richlandlanes.com | GoDaddy.com, LLC | 15 Aug 2017 | 1 Aug 2025 | 15 Aug 2026 |
| 181 | richlandsrosesflooringandfurniture.com | CloudFlare, Inc. | 21 Aug 2014 | 1 Oct 2025 | 21 Aug 2026 |
| 182 | richlandbuildingllc.com | 1&1 Internet AG | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 183 | richlandceo.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2017 |
| 184 | richlandrdsanmarcosca.com | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 185 | richlandorchards.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 186 | richlandandmulberryrdsanmarcosca.com | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 187 | richlandbc.org | Tucows Domains Inc. | 25 Aug 2024 | 5 Aug 2025 | 25 Aug 2026 |
| 188 | richlandhousesforsale.com | GoDaddy.com, LLC | 24 Nov 2022 | 25 Nov 2025 | 24 Nov 2026 |
| 189 | richlandparkperch.com | GoDaddy.com, LLC | 22 Aug 2014 | 23 Aug 2025 | 22 Aug 2026 |
| 190 | richlandrealtors.net | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 191 | richland2schoollunchapp.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 192 | richlandchamberslaketx.com | GoDaddy.com, LLC | 24 Aug 2014 | 25 Aug 2016 | 24 Aug 2017 |
| 193 | richlandcenterknightsofcolumbus.com | Wild West Domains, LLC | 12 Aug 2014 | 24 Oct 2024 | 12 Aug 2024 |
| 194 | richlandind.com | GoDaddy.com, LLC | 25 Aug 2014 | 19 Aug 2025 | 25 Aug 2026 |
| 195 | richlandusa.com | GoDaddy.com, LLC | 27 Aug 2014 | 5 Apr 2023 | 27 Aug 2026 |
| 196 | richlandir.com | eNom, Inc. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 197 | richlandohpackages.com | register.com, Inc. | 27 Aug 2014 | 18 Dec 2025 | 27 Aug 2029 |
| 198 | richlands-fast-profits-at-home.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 199 | richland-formula.com | eNom, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 200 | richlandhydrographics.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2016 |
| 201 | richlandsfreedomfestival.com | GoDaddy.com, LLC | 28 Aug 2014 | 14 Mar 2016 | 28 Aug 2017 |
| 202 | richlandgirlsgunners.com | Tucows Domains Inc. | 8 Nov 2012 | 12 Nov 2014 | 8 Nov 2015 |
| 203 | richlandprairie.com | Wild West Domains, LLC | 13 Nov 2014 | 14 Nov 2016 | 13 Nov 2018 |
| 204 | richlandmarketgroceryinc.com | GoDaddy.com, LLC | 14 Nov 2014 | 14 Nov 2015 | 14 Nov 2016 |
| 205 | richland-groupa.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 206 | richlandcountyliving.com | Wild West Domains, LLC | 13 Sep 2014 | 13 Aug 2025 | 13 Sep 2026 |
| 207 | richlandmainstreet.com | GoDaddy.com, LLC | 31 Aug 2014 | 10 Aug 2016 | 31 Aug 2017 |
| 208 | richlandmainstreet.org | GoDaddy.com, LLC | 31 Aug 2014 | 7 Aug 2017 | 31 Aug 2018 |
| 209 | richlandtown.com | GoDaddy.com, LLC | 20 Feb 2019 | 15 Jan 2026 | 20 Feb 2027 |
| 210 | richlandwahomepro.com | Tucows Domains Inc. | 13 Sep 2012 | 17 Sep 2014 | 13 Sep 2015 |
| 211 | richlandbud.com | NameCheap, Inc. | 13 Dec 2017 | 13 Dec 2017 | 13 Dec 2018 |
| 212 | richlandcannabis.com | CloudFlare, Inc. | 26 May 2021 | 16 May 2025 | 26 May 2026 |
| 213 | richlandspresbyterianchurch.org | Domain.com, LLC | 17 Sep 2014 | 19 Oct 2025 | 17 Sep 2026 |
| 214 | richlandfamilycouncil.org | GoDaddy.com, LLC | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 215 | richlandcollege.net | Fabulous.com Pty Ltd. | 6 Sep 2014 | 7 Sep 2025 | 6 Sep 2026 |
| 216 | richlandwordpress.com | Google, Inc. | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 217 | richlandluxuryhomes.com | GoDaddy.com, LLC | 19 Nov 2014 | 10 Dec 2023 | 9 Dec 2027 |
| 218 | richlandfinancing.com | eNom, Inc. | 18 Nov 2014 | 19 Nov 2014 | 18 Nov 2015 |
| 219 | richlandchamberstoday.com | GoDaddy.com, LLC | 18 Nov 2014 | 19 Nov 2024 | 18 Nov 2026 |
| 220 | richlandcenterflowers.com | MarkMonitor Inc. | 8 Sep 2014 | 9 Sep 2024 | 8 Sep 2025 |
| 221 | richlandchurchofchrist.net | - | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2017 |
| 222 | richlandrenaissancefestival.com | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 223 | richlandrenaissancefestival.info | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 224 | richlandrenaissancefestival.net | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 225 | richlandrenaissancefestival.org | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 226 | richlandcertifiedcarsales.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 227 | richlandcommissionsfromhome.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 228 | richlandfastmoneyathome.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 229 | richlandflooring.com | GoDaddy.com, LLC | 19 Nov 2020 | 20 Nov 2024 | 19 Nov 2026 |
| 230 | richlandtree.com | GoDaddy.com, LLC | 1 Oct 2014 | 2 Oct 2016 | 1 Oct 2017 |
| 231 | richlandcertifiedcars.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 232 | richlandtrading.com | GoDaddy.com, LLC | 4 Feb 2019 | 28 Jan 2025 | 4 Feb 2026 |
| 233 | richlandschamber.org | GoDaddy.com, LLC | 18 Nov 2014 | 19 Nov 2016 | 18 Nov 2018 |
| 234 | richlandconsulting.com | TurnCommerce, Inc. DBA NameBright.com | 20 Dec 2017 | 29 Jan 2025 | 20 Dec 2024 |
| 235 | richlandhomesdevelopment.com | GoDaddy.com, LLC | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2015 |
| 236 | richlandhotelandsuites.com | TLD Registrar Solutions Ltd. | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 237 | richlandstutor.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 238 | richlandtownhomes.com | TurnCommerce, Inc. DBA NameBright.com | 17 Nov 2011 | 11 Nov 2025 | 17 Nov 2026 |
| 239 | richlanddevelopments.com | eNom, Inc. | 5 Oct 2014 | 9 Oct 2017 | 5 Oct 2018 |
| 240 | richlandcountymastergardeners.org | Tucows Domains Inc. | 1 Oct 2009 | 5 Oct 2014 | 1 Oct 2015 |
| 241 | richlandhillsrealestateagency.com | eNom, Inc. | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 242 | richlandhillspd.com | Wild West Domains, LLC | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2017 |
| 243 | richlandhill.com | TurnCommerce, Inc. DBA NameBright.com | 13 Jan 2020 | 25 Mar 2025 | 13 Jan 2025 |
| 244 | richland-project.com | Shinjiru MSC Sdn Bhd | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 245 | richland-projects.com | Shinjiru MSC Sdn Bhd | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 246 | richlandcreekapartments.com | NamePal.com #8020 | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 247 | richlandparish.com | AtlanticDomains, LLC | 18 Dec 2024 | 19 Dec 2025 | 18 Dec 2026 |
| 248 | richlandcreek.org | NameCheap, Inc. | 10 Oct 2014 | 25 Aug 2025 | 10 Oct 2026 |
| 249 | richlandirepair.com | GoDaddy.com, LLC | 10 Oct 2014 | 11 Oct 2016 | 10 Oct 2017 |
| 250 | richlandsfitnessandtanning.com | eNom, Inc. | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 251 | richlandaep.com | Wild West Domains, LLC | 12 Oct 2014 | 24 Oct 2016 | 12 Oct 2017 |
| 252 | richlandsc.com | TurnCommerce, Inc. DBA NameBright.com | 13 Oct 2014 | 24 Dec 2025 | 13 Oct 2025 |
| 253 | richlandrepair.com | Wix.com Ltd. | 16 Aug 2019 | 26 Sep 2023 | 16 Aug 2023 |
| 254 | richlanduniformco.com | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 255 | richlanduniforms.com | GoDaddy.com, LLC | 23 Nov 2020 | 24 Nov 2025 | 23 Nov 2027 |
| 256 | richlandhomebuilders.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 257 | richlanddesignbuild.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 258 | richlandconstructionllc.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 259 | richlandbuilderstn.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 260 | richlandstitleutah.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 261 | richlandmarketafricanfood.com | NameCheap, Inc. | 3 Dec 2014 | 3 Nov 2025 | 3 Dec 2026 |
| 262 | richlandconstruction.net | Google, Inc. | 26 Jun 2023 | 11 Jun 2025 | 26 Jun 2026 |
| 263 | richlandjournal.com | AcquiredNames LLC | 7 Dec 2014 | 8 Dec 2016 | 7 Dec 2017 |
| 264 | richlandcountywarrents.com | Fabulous.com Pty Ltd. | 8 Nov 2005 | 1 Dec 2015 | 8 Nov 2016 |
| 265 | richlandcountymall.com | Fabulous.com Pty Ltd. | 8 Nov 2005 | 4 Dec 2017 | 8 Nov 2018 |
| 266 | richlandsmiles.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2024 | 9 Dec 2026 |
| 267 | richlandproductions.com | GoDaddy.com, LLC | 15 Dec 2014 | 16 Dec 2024 | 15 Dec 2034 |
| 268 | richlandkennels.com | DropCatch.com 456 LLC | 4 Mar 2017 | 6 Mar 2017 | 4 Mar 2018 |
| 269 | richlandkennels.net | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2016 |
| 270 | richlandkennels.info | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2016 |
| 271 | richlandkennels.us | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 15 Dec 2016 |
| 272 | richlandkennels.org | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2016 |
| 273 | richlandplantation.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 274 | richlandlady.com | GoDaddy.com, LLC | 18 Dec 2014 | 19 Dec 2025 | 18 Dec 2026 |
| 275 | richlanddiamonds.com | GoDaddy.com, LLC | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2017 |
| 276 | richlandrec.com | TLDs LLC dba SRSplus | 29 Dec 2014 | 30 Dec 2025 | 29 Dec 2026 |
| 277 | richland-cn.com | Chengdu West Dimension Digital Technology Co., Ltd… | 12 Sep 2019 | 12 Sep 2019 | 12 Sep 2020 |
| 278 | richlandpolice.com | TurnCommerce, Inc. DBA NameBright.com | 24 Feb 2020 | 6 Apr 2025 | 24 Feb 2025 |
| 279 | richlandjail.com | Chengdu West Dimension Digital Technology Co., Ltd… | 3 Mar 2019 | 3 Mar 2019 | 3 Mar 2020 |
| 280 | richlandhospital.xyz | Network Solutions, LLC | 19 Jul 2014 | 21 Jul 2014 | 19 Jul 2015 |
| 281 | richlandfire.xyz | Network Solutions, LLC | 24 Jul 2014 | 25 Jul 2014 | 24 Jul 2015 |
| 282 | richlandgop.xyz | Network Solutions, LLC | 28 Jul 2014 | 29 Jul 2014 | 28 Jul 2015 |
| 283 | richlandmarketi.xyz | Network Solutions, LLC | 29 Jul 2014 | 30 Jul 2014 | 29 Jul 2015 |
| 284 | richlandpines.net | GoDaddy.com, LLC | 11 Aug 2015 | 12 Aug 2025 | 11 Aug 2026 |
| 285 | richlandpines.info | GoDaddy.com, LLC | 11 Aug 2015 | 25 Sep 2025 | 11 Aug 2026 |
| 286 | richlandpines.com | Google, Inc. | 11 Aug 2015 | 27 Jul 2025 | 11 Aug 2026 |
| 287 | richlandcountynews.com | - | 11 Aug 2015 | 5 Sep 2025 | 11 Aug 2026 |
| 288 | richlandnewspress.xyz | GMO Internet Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 289 | richlandtown.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 290 | richlandsprings.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 291 | richlands.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 292 | richlandcenter.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 293 | richlands-nchomesforsale.com | Tucows Domains Inc. | 10 Aug 2012 | 14 Aug 2015 | 10 Aug 2016 |
| 294 | richlandfamilydentist.com | Name.com, Inc. | 11 Apr 2018 | 24 Jun 2024 | 11 Apr 2024 |
| 295 | richlandfamilydds.com | eNom, Inc. | 14 Aug 2015 | 16 Jul 2025 | 14 Aug 2026 |
| 296 | richlandfamily.com | GoDaddy.com, LLC | 7 Feb 2017 | 1 Oct 2022 | 7 Feb 2027 |
| 297 | richlandcenterdental.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 298 | richlandbaseballinc.com | Wild West Domains, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 299 | richlandadvisorsusa.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2017 |
| 300 | richlandsourcebackend.info | eNom, Inc. | 4 Jan 2015 | 2 Jan 2017 | 4 Jan 2018 |
| 301 | richlandrdranchette.com | Wild West Domains, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 302 | richlandanimalhospitalmi.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 303 | richlandfaith.com | GoDaddy.com, LLC | 7 Jan 2015 | 8 Jan 2026 | 7 Jan 2027 |
| 304 | richlandcreekhome.com | eNom, Inc. | 21 Sep 2016 | 2 Nov 2017 | 21 Sep 2017 |
| 305 | richlandcares.com | Launchpad, Inc. | 24 Sep 2020 | 12 Aug 2025 | 24 Sep 2026 |
| 306 | richlandband-springswing.com | 1&1 Internet AG | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 307 | richlandasm.com | HiChina Zhicheng Technology Limited | 9 Jan 2015 | 19 Dec 2019 | 9 Jan 2027 |
| 308 | richlandwagardencenter.com | eNom, Inc. | 14 Aug 2015 | 20 Jul 2017 | 14 Aug 2017 |
| 309 | richlandrd.us | Tucows Domains Inc. | 9 Jan 2015 | 2 Jan 2017 | 8 Jan 2018 |
| 310 | richlandcommercialflooring.com | FastDomain Inc. | 14 Jan 2015 | 16 Dec 2025 | 14 Jan 2029 |
| 311 | richlandcorporation.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Sep 2023 | 28 Sep 2024 | 27 Sep 2025 |
| 312 | richlandhotels.review | Alpnames Limited | 3 Jul 2015 | - | 2 Jul 2016 |
| 313 | richlandchamberofcomm.com | Dynadot, LLC | 15 May 2022 | 25 Jul 2023 | 15 May 2023 |
| 314 | richlandonline.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jan 2015 | 12 Jan 2026 | 16 Jan 2027 |
| 315 | richlandnewhomes.com | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 316 | richlandmbc.com | Tucows Domains Inc. | 15 Sep 2017 | 19 Sep 2021 | 15 Sep 2021 |
| 317 | richlandsnowdrifters.com | GoDaddy.com, LLC | 22 Jan 2015 | 4 Mar 2025 | 22 Jan 2025 |
| 318 | richlandcountyrealestateagent.com | Tucows Domains Inc. | 21 Jan 2015 | 25 Jan 2017 | 21 Jan 2017 |
| 319 | richlandah.com | Amazon Registrar, Inc. | 18 Aug 2015 | 22 Dec 2025 | 18 Aug 2026 |
| 320 | richlandauction.org | GoDaddy.com, LLC | 28 Jan 2015 | 17 Jan 2017 | 28 Jan 2018 |
| 321 | richlandwebdesign.com | GoDaddy.com, LLC | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 322 | richlandschool.com | Namesilo, LLC | 18 Jan 2005 | 1 Jan 2026 | 18 Jan 2027 |
| 323 | richlandcountyschooldistrictone.com | Fabulous.com Pty Ltd. | 1 Jan 2006 | 30 Jan 2017 | 1 Jan 2018 |
| 324 | richlandcoda.org | eNom, Inc. | 30 Jan 2015 | 28 Jan 2025 | 30 Jan 2026 |
| 325 | richland-motel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 326 | richlandtattoo.com | DROPCATCH.COM 805 LLC | 23 Apr 2017 | 23 Apr 2017 | 23 Apr 2018 |
| 327 | richlandchambersdockbuilders.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2017 |
| 328 | richlandchambersboatliftrepair.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2017 |
| 329 | richlandcountytitle.com | GMO Internet Inc. | 6 Jul 2023 | 16 Sep 2024 | 6 Jul 2024 |
| 330 | richlandbank.bank | EnCirca, Inc. | 24 Jun 2015 | 20 Aug 2015 | 24 Jun 2016 |
| 331 | richlandvitalsigns.org | GoDaddy.com, LLC | 21 Aug 2015 | 12 Jun 2017 | 21 Aug 2018 |
| 332 | richlandvitalsigns.com | Network Solutions, LLC | 21 Aug 2015 | 11 Jul 2016 | 21 Aug 2017 |
| 333 | richlandmientrung.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 334 | richlanddelivery.com | eNom, Inc. | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 335 | richlandtransportation.com | eNom, Inc. | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 336 | richlandresourcesonline.com | TPP Wholesale Pty Ltd. | 13 Feb 2015 | 15 Jun 2017 | 13 Feb 2021 |
| 337 | richlandgemsonline.com | TPP Wholesale Pty Ltd. | 13 Feb 2015 | 14 Jun 2017 | 13 Feb 2021 |
| 338 | richlandgems.com | TPP Wholesale Pty Ltd. | 13 Feb 2015 | 14 Jun 2017 | 13 Feb 2021 |
| 339 | richlandgem.com | TPP Wholesale Pty Ltd. | 13 Feb 2015 | 14 Jun 2017 | 13 Feb 2021 |
| 340 | richlandaviation.net | GoDaddy.com, LLC | 11 Feb 2015 | 12 Feb 2017 | 11 Feb 2019 |
| 341 | richlandtwp.us | GoDaddy.com, LLC | 12 Feb 2015 | 17 Feb 2024 | 11 Feb 2026 |
| 342 | richlandgop.org | Network Solutions, LLC | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 343 | richlandcountycorruption.com | GoDaddy.com, LLC | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2016 |
| 344 | richlandstrong.org | GoDaddy.com, LLC | 21 Aug 2015 | 22 Aug 2016 | 21 Aug 2017 |
| 345 | richlandstrong.net | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 346 | richlandstrong.info | GoDaddy.com, LLC | 21 Aug 2015 | 22 Aug 2016 | 21 Aug 2017 |
| 347 | richlandstrong.com | TurnCommerce, Inc. DBA NameBright.com | 8 Nov 2018 | 2 Nov 2020 | 8 Nov 2026 |
| 348 | richlandpercussion.com | GoDaddy.com, LLC | 16 Dec 2022 | 27 Feb 2024 | 16 Dec 2023 |
| 349 | richlanddailynews.com | NameCheap, Inc. | 29 Aug 2022 | 11 Nov 2023 | 29 Aug 2023 |
| 350 | richlandofstfrancisville.com | GoDaddy.com, LLC | 4 Feb 2019 | 4 Feb 2019 | 4 Feb 2020 |
| 351 | richlandmedicalcenter.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Nov 2021 | 28 Dec 2025 | 26 Nov 2025 |
| 352 | richlandroots.com | GoDaddy.com, LLC | 23 Feb 2015 | 7 Apr 2025 | 23 Feb 2026 |
| 353 | richlandcountypolitics.com | Tucows Domains Inc. | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 354 | richlandscaping.net | GoDaddy.com, LLC | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2016 |
| 355 | richland748.org | Domain.com, LLC | 21 Feb 2015 | 25 Jun 2025 | 21 Feb 2026 |
| 356 | richlandchamberssportsmensassociations.com | GoDaddy.com, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2017 |
| 357 | richlandchamberssportsmensassociation.info | GoDaddy.com, LLC | 23 Feb 2015 | - | 23 Feb 2017 |
| 358 | richlandmiinsuranceprovider.com | eNom, Inc. | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 359 | richlandllc.info | Melbourne IT, Ltd | 26 Feb 2015 | - | 26 Feb 2016 |
| 360 | richlandadvisors.com | GoDaddy.com, LLC | 15 Feb 2021 | 16 Feb 2025 | 15 Feb 2026 |
| 361 | richlandexpressinc.com | register.com, Inc. | 3 Mar 2015 | 29 Mar 2016 | 3 Mar 2021 |
| 362 | richlandhealth.com | TurnCommerce, Inc. DBA NameBright.com | 29 Apr 2016 | 23 Apr 2021 | 29 Apr 2026 |
| 363 | richlandcountyfairgrounds.com | Fabulous.com Pty Ltd. | 24 Feb 2005 | 1 Mar 2017 | 24 Feb 2018 |
| 364 | richlandcountycourts.com | - | - | - | - |
| 365 | richlandonemiddlecollege.org | eNom, Inc. | 5 Mar 2015 | 12 Feb 2017 | 5 Mar 2018 |
| 366 | richlandfriendsmeeting.org | Key-Systems GmbH | 26 May 2014 | 8 Jul 2017 | 26 May 2018 |
| 367 | richlandpizza.net | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2017 |
| 368 | richlandcountylandbank.org | Domain.com, LLC | 24 Aug 2015 | 24 Jun 2025 | 24 Aug 2026 |
| 369 | richland-pizza.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2017 |
| 370 | richlandheritagesociety.org | Network Solutions, LLC | 8 Mar 2015 | 16 Jun 2024 | 8 Mar 2027 |
| 371 | richlandtermiteandconstruction.com | GoDaddy.com, LLC | 11 Mar 2015 | 21 Apr 2025 | 11 Mar 2025 |
| 372 | richlandjewelry.com | OnlineNIC, Inc. | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 373 | richlandgunners.com | GoDaddy.com, LLC | 30 May 2017 | 30 May 2025 | 30 May 2027 |
| 374 | richlanddanang.com | OnlineNIC, Inc. | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 375 | richlandshipping.com | HiChina Zhicheng Technology Limited | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2020 |
| 376 | richlandslimsystem.com | Key-Systems GmbH | 17 Mar 2015 | 29 Apr 2015 | 17 Mar 2016 |
| 377 | richlanddreamhome.com | eNom, Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 378 | richland-investment.com | Lemon Shark Domains, LLC | 25 May 2023 | 8 Jul 2024 | 25 May 2024 |
| 379 | richlandstorage.com | GoDaddy.com, LLC | 20 Mar 2015 | 20 Feb 2024 | 20 Mar 2029 |
| 380 | richlandinnlewisburg.com | GoDaddy.com, LLC | 26 Jul 2017 | 5 Sep 2017 | 26 Jul 2018 |
| 381 | richlandcorp.com | TurnCommerce, Inc. DBA NameBright.com | 26 Aug 2015 | 11 Nov 2025 | 26 Aug 2026 |
| 382 | richlandhills.net | GoDaddy.com, LLC | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2016 |
| 383 | richlandcountyhealthoffice.org | GoDaddy.com, LLC | 19 Mar 2015 | 3 May 2025 | 19 Mar 2026 |
| 384 | richlandhair.com | GoDaddy.com, LLC | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2016 |
| 385 | richlandfashion.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Jan 2022 | 27 Dec 2024 | 24 Jan 2028 |
| 386 | richlandgemstones.com | - | 18 Aug 2023 | 25 Dec 2025 | 18 Aug 2026 |
| 387 | richlandcountydivorcelawyer.com | GoDaddy.com, LLC | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 388 | richlandparkhorsetrials.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 389 | richlandhillpropertymanager.com | eNom, Inc. | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 390 | richlandcreative.com | GoDaddy.com, LLC | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 391 | richlandcemeteries.com | Name.com, Inc. | 14 Jun 2016 | 4 Jun 2025 | 14 Jun 2026 |
| 392 | richlandparties.com | Tucows Domains Inc. | 28 Mar 2014 | 1 Apr 2015 | 28 Mar 2016 |
| 393 | richlandcountydetention.com | Fabulous.com Pty Ltd. | 12 Mar 2006 | 2 Apr 2017 | 12 Mar 2018 |
| 394 | richlandcollage.com | Fabulous.com Pty Ltd. | 19 Mar 2005 | 28 Jan 2018 | 19 Mar 2018 |
| 395 | richland2schools.com | Fabulous.com Pty Ltd. | 28 Nov 2004 | 2 Apr 2017 | 27 Mar 2018 |
| 396 | richlandbsm.com | Tucows Domains Inc. | 28 Aug 2015 | 27 Aug 2025 | 28 Aug 2026 |
| 397 | richlandrefrigeration.com | Name.com, Inc. | 7 Apr 2015 | 22 Mar 2017 | 7 Apr 2018 |
| 398 | richlandcommercialrefrigeration.com | Name.com, Inc. | 7 Apr 2015 | 22 Mar 2017 | 7 Apr 2018 |
| 399 | richlandnorml.org | Google, Inc. | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 400 | richlandhomeservices.com | eNom, Inc. | 1 Sep 2015 | 27 Aug 2016 | 1 Sep 2017 |
| 401 | richlandcd.org | GoDaddy.com, LLC | 31 Aug 2015 | 15 Oct 2025 | 31 Aug 2030 |
| 402 | richland02.org | Key-Systems GmbH | 26 Nov 2022 | 7 Feb 2024 | 26 Nov 2023 |
| 403 | richlandsmsa.com | Melbourne IT, Ltd | 11 Apr 2015 | 12 Aug 2025 | 11 Apr 2027 |
| 404 | richlandcenterconsignment.com | GoDaddy.com, LLC | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 405 | richlanddogtrainer.com | Tucows Domains Inc. | 1 Sep 2011 | 5 Sep 2015 | 1 Sep 2016 |
| 406 | richlandestates.com | Dynadot, LLC | 31 Oct 2022 | 11 Dec 2023 | 31 Oct 2023 |
| 407 | richlandchambersfishingguide.com | GoDaddy.com, LLC | 15 Apr 2015 | 15 Apr 2015 | 15 Apr 2017 |
| 408 | richlandwashingtonrealestate.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 25 Jul 2023 | 2 Aug 2024 | 25 Jul 2024 |
| 409 | richlandministorage.com | eNom, Inc. | 16 Apr 2015 | 18 Mar 2025 | 16 Apr 2026 |
| 410 | richlandiowa.com | DropCatch.com 1198 LLC | 6 Jul 2022 | 16 Sep 2023 | 6 Jul 2023 |
| 411 | richlandglobalservices.com | 007Names, Inc. | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 412 | richlandchambers-lake.com | GoDaddy.com, LLC | 20 Apr 2015 | 21 Apr 2025 | 20 Apr 2026 |
| 413 | richlandrocks.com | GoDaddy.com, LLC | 23 Apr 2015 | 4 Apr 2025 | 23 Apr 2026 |
| 414 | richlandmechanical.com | Wild West Domains, LLC | 13 Mar 2010 | 5 Mar 2025 | 13 Mar 2028 |
| 415 | richland-northeast-spring-valley-reunion.com | Tucows Domains Inc. | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2017 |
| 416 | richlandtournamentchallenge.com | GoDaddy.com, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 417 | richlandcountyprosecutorbambicouchpage.com | GoDaddy.com, LLC | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2017 |
| 418 | richlandcountygov.net | GMO Internet Inc. | 9 Sep 2015 | 29 Sep 2016 | 8 Sep 2017 |
| 419 | richlandwindowco.com | eNom, Inc. | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 420 | richland-property.com | NetRegistry Pty Ltd. | 17 Apr 2014 | 30 Apr 2015 | 17 Apr 2016 |
| 421 | richlandphotography.com | DropCatch.com 1301 LLC | 22 Jul 2018 | 22 Jul 2018 | 22 Jul 2019 |
| 422 | richlandcountyattorney.com | GoDaddy.com, LLC | 6 May 2015 | 6 May 2015 | 6 May 2016 |
| 423 | richlandsrescue.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 424 | richlandpriso.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 425 | richlandflips.com | GoDaddy.com, LLC | 12 May 2015 | 12 May 2015 | 12 May 2016 |
| 426 | richlandlibray.com | Hebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.… | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 427 | richlandlibary.com | Key-Systems GmbH | 2 Dec 2024 | 2 Dec 2025 | 2 Dec 2026 |
| 428 | richlandinnlewisberg.com | eNom, Inc. | 18 May 2015 | 19 Apr 2019 | 18 May 2020 |
| 429 | richlandpatternsinc.com | eNom, Inc. | 19 May 2015 | 20 Apr 2025 | 19 May 2026 |
| 430 | richlandjobs.com | GoDaddy.com, LLC | 20 May 2015 | 18 Jun 2025 | 20 May 2026 |
| 431 | richlandcreekwhitetailsfarm.com | Tucows Domains Inc. | 18 May 2014 | 22 May 2015 | 18 May 2016 |
| 432 | richlandbears.com | GoDaddy.com, LLC | 19 Feb 2019 | 18 Oct 2022 | 19 Feb 2026 |
| 433 | richlandcountyrealestate.com | - | 3 May 2021 | 22 Sep 2025 | 3 May 2026 |
| 434 | richlandcommunitycollege.org | Fabulous.com Pty Ltd. | 23 May 2015 | 13 Apr 2017 | 23 May 2018 |
| 435 | richlandrecreation.org | GoDaddy.com, LLC | 24 May 2015 | 24 May 2015 | 24 May 2016 |
| 436 | richlandcenterfurniturewi.com | Tucows Domains Inc. | 24 May 2012 | 28 May 2015 | 24 May 2016 |
| 437 | richlandhospitel.com | - | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2017 |
| 438 | richlandchiropracticcare.com | eNom, Inc. | 14 Sep 2015 | 14 Sep 2015 | 14 Sep 2016 |
| 439 | richlandrealestateagent.com | GoDaddy.com, LLC | 6 Jul 2024 | 21 Jul 2025 | 6 Jul 2026 |
| 440 | richlandenterprisesinc.com | eNom, Inc. | 28 May 2015 | 28 May 2015 | 28 May 2018 |
| 441 | richlandsearch.com | DROPCATCH.COM 766 LLC | 1 Jun 2018 | 1 Jun 2018 | 1 Jun 2019 |
| 442 | richlandfrenchacademy.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 443 | richlandcreekdental.com | GoDaddy.com, LLC | 30 May 2015 | 11 Mar 2025 | 30 May 2027 |
| 444 | richlandoneline.com | NameCheap, Inc. | 9 Apr 2024 | 21 Jun 2025 | 9 Apr 2025 |
| 445 | richlandmusicfest.com | GoDaddy.com, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 446 | richlandgeeks.com | GoDaddy.com, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 447 | richlandladyrebelsbasketball.com | NameCheap, Inc. | 15 Sep 2015 | 26 Aug 2025 | 15 Sep 2026 |
| 448 | richlandhillsfoundationrepair.com | 1&1 Internet AG | 3 Jun 2015 | 5 May 2017 | 3 Jun 2018 |
| 449 | richlandcreekgifts.com | GoDaddy.com, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 450 | richlandoffice.com | Wild West Domains, LLC | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 451 | richlandmusicfestival.org | Tucows Domains Inc. | 2 Jun 2015 | 24 May 2025 | 2 Jun 2026 |
| 452 | richlandmusicfest.org | Tucows Domains Inc. | 2 Jun 2015 | 24 May 2025 | 2 Jun 2026 |
| 453 | richlandcountycare.com | GoDaddy.com, LLC | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 454 | richlandpower.com | TurnCommerce, Inc. DBA NameBright.com | 5 Jul 2017 | 29 Jun 2020 | 5 Jul 2026 |
| 455 | richlandheatingcooling.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 456 | richlandsgroupofcompanies.com | 1&1 Internet AG | 9 Jun 2015 | 9 Jul 2017 | 9 Jun 2018 |
| 457 | richlandfencecompany.com | - | 16 Nov 2023 | 30 Jan 2025 | 16 Nov 2024 |
| 458 | richlandheatingcooling.org | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 459 | richlandheatingcooling.net | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 460 | richlandheatingcooling.info | GoDaddy.com, LLC | 8 Jun 2015 | - | 8 Jun 2016 |
| 461 | richlandhall.net | GoDaddy.com, LLC | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2017 |
| 462 | richlandhall.com | - | 5 Dec 2024 | 6 Dec 2025 | 5 Dec 2026 |
| 463 | richlandsthouse.com | Tucows Domains Inc. | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2017 |
| 464 | richlandpersonalinjury.com | OnlineNIC, Inc. | 18 Sep 2015 | 4 Aug 2025 | 18 Sep 2026 |
| 465 | richlandlbrary.com | - | 19 Sep 2015 | 19 Sep 2015 | 19 Sep 2017 |
| 466 | richlandlandscaping.com | NameCheap, Inc. | 27 May 2024 | 15 May 2025 | 27 May 2026 |
| 467 | richlandgives.com | GoDaddy.com, LLC | 16 Jun 2015 | 19 May 2025 | 16 Jun 2027 |
| 468 | richlandccshop.com | CSC Corporate Domains, Inc. | 17 Jun 2015 | 13 Jun 2025 | 17 Jun 2026 |
| 469 | richlandgives.org | GoDaddy.com, LLC | 16 Jun 2015 | 9 Jul 2024 | 16 Jun 2029 |
| 470 | richlandfall.com | GoDaddy.com, LLC | 18 Jun 2015 | 18 Jun 2015 | 18 Jun 2016 |
| 471 | richlandwatch.com | Tucows Domains Inc. | 17 Jun 2013 | 21 Jun 2015 | 17 Jun 2016 |
| 472 | richlandace.us | Wild West Domains, LLC | 19 Jun 2015 | 19 Jun 2015 | 18 Jun 2017 |
| 473 | richlandtricountyfair.com | GoDaddy.com, LLC | 25 Mar 2019 | 31 Mar 2025 | 25 Mar 2026 |
| 474 | richlandbombertrack.com | register.com, Inc. | 22 Jun 2015 | 30 Jul 2022 | 22 Jun 2028 |
| 475 | richland-homesforsale.com | GoDaddy.com, LLC | 22 Jun 2015 | 23 Jun 2024 | 22 Jun 2027 |
| 476 | richlandseguros.com | Wild West Domains, LLC | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 477 | richlandrealestate.net | GoDaddy.com, LLC | 22 Jun 2015 | 23 Jun 2024 | 22 Jun 2027 |
| 478 | richlandhousesforsale.net | GoDaddy.com, LLC | 22 Jun 2015 | 23 Jun 2024 | 22 Jun 2027 |
| 479 | richland-realestate.net | GoDaddy.com, LLC | 22 Jun 2015 | 23 Jun 2024 | 22 Jun 2027 |
| 480 | richland-homes.net | GoDaddy.com, LLC | 22 Jun 2015 | 23 Jun 2024 | 22 Jun 2027 |
| 481 | richlandschiro.com | GoDaddy.com, LLC | 25 Jun 2015 | 5 Jan 2026 | 25 Jun 2026 |
| 482 | richlandcountyregulators.com | eNom, Inc. | 22 Jun 2009 | 3 Feb 2017 | 22 Jun 2018 |
| 483 | richlandtownkia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2016 |
| 484 | richlandcountyhsband.org | register.com, Inc. | 25 Jun 2015 | 27 Jun 2017 | 25 Jun 2018 |
| 485 | richlandhillstexashomes.com | GoDaddy.com, LLC | 23 Sep 2015 | 5 Oct 2025 | 23 Sep 2026 |
| 486 | richlandduilawyer.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2017 |
| 487 | richlanddivorce.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2017 |
| 488 | richlandbeaconnews.com | GMO Internet Inc. | 3 Jan 2023 | 13 Feb 2024 | 3 Jan 2024 |
| 489 | richlandnc.com | Fabulous.com Pty Ltd. | 10 Jun 2005 | 4 Feb 2018 | 10 Jun 2018 |
| 490 | richlandmovers.com | GoDaddy.com, LLC | 26 Jan 2022 | 9 Mar 2025 | 26 Jan 2025 |
| 491 | richlandbeacon.com | Fabulous.com Pty Ltd. | 16 Jun 2005 | 29 Jul 2020 | 16 Jun 2020 |
| 492 | richlandpoolbuilders.com | eNom, Inc. | 3 Jul 2015 | 6 Jul 2017 | 3 Jul 2017 |
| 493 | richlandspestcontrol.net | GoDaddy.com, LLC | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2016 |
| 494 | richlandspestcontrol.com | GoDaddy.com, LLC | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2016 |
| 495 | richlandmasoniclodge385.org | register.com, Inc. | 24 Sep 2015 | 24 Aug 2024 | 24 Sep 2026 |
| 496 | richlandduplex.com | eNom, Inc. | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2016 |
| 497 | richlandlionsfoundation.com | GoDaddy.com, LLC | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2020 |
| 498 | richlandsprings-tx.com | GoDaddy.com, LLC | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 499 | richlandfarmsltd.com | eNom, Inc. | 9 Jul 2015 | 12 Jul 2017 | 9 Jul 2017 |
| 500 | richlandcreeknashville.com | MAFF Inc. | 25 Dec 2021 | 27 Dec 2021 | 25 Dec 2022 |
| 501 | richlandhillshoa.com | GoDaddy.com, LLC | 15 Nov 2017 | 16 Nov 2025 | 15 Nov 2027 |
| 502 | richlandems.net | FastDomain Inc. | 10 Jul 2015 | 25 Jun 2025 | 10 Jul 2026 |
| 503 | richland-county-lawyers.com | GoDaddy.com, LLC | 13 Jul 2015 | 13 Jul 2015 | 13 Jul 2016 |
| 504 | richlandbankmansfield.com | MarkMonitor Inc. | 13 Jul 2015 | 13 Jul 2015 | 13 Jul 2016 |
| 505 | richlandmsautosales.com | - | 3 Oct 2023 | 17 Dec 2025 | 3 Oct 2025 |
| 506 | richlandparkway.com | Tucows Domains Inc. | 8 Jan 2019 | 24 Dec 2025 | 8 Jan 2027 |
| 507 | richlandsportsmensclub.org | Squarespace Domains LLC | 9 Sep 2025 | 14 Sep 2025 | 9 Sep 2026 |
| 508 | richlandscents.com | eNom, Inc. | 20 Jul 2015 | 24 Jul 2017 | 20 Jul 2017 |
| 509 | richlandcambersrvpark.com | GoDaddy.com, LLC | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2020 |
| 510 | richlandcamberslake.com | GoDaddy.com, LLC | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2020 |
| 511 | richlandautopros.com | Internet Domain Services BS Corp | 20 Jul 2015 | 10 Apr 2017 | 20 Jul 2018 |
| 512 | richlandteambuilding.com | DomainsAtCost Corporation | 28 Sep 2015 | 14 Aug 2016 | 28 Sep 2017 |
| 513 | richlandjewelers.com | GoDaddy.com, LLC | 8 Oct 2018 | 8 Oct 2018 | 8 Oct 2019 |
| 514 | richlandhillsappliancerepairmen.us | GoDaddy.com, LLC | 28 Sep 2015 | 28 Sep 2016 | 27 Sep 2017 |
| 515 | richlandac.com | eNom, Inc. | 23 Jul 2015 | 26 Jul 2017 | 23 Jul 2017 |
| 516 | richlandforest.com | enom453, Incorporated | 1 Jan 2026 | 2 Jan 2026 | 1 Jan 2027 |
| 517 | richlandtownshipfire.com | DreamHost, LLC | 29 Sep 2015 | 28 Sep 2025 | 29 Sep 2026 |
| 518 | richlandhillsbailbonds.com | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 519 | richlandwreckerservice.com | NameCheap, Inc. | 27 Jul 2015 | 27 Jun 2025 | 27 Jul 2026 |
| 520 | richlandrealty.com | GoDaddy.com, LLC | 28 Jul 2015 | 30 Sep 2025 | 28 Jul 2026 |
| 521 | richlandcarpetcleaners.com | eNom, Inc. | 28 Jul 2015 | 29 Jul 2015 | 28 Jul 2016 |
| 522 | richlandhallnashville.com | GoDaddy.com, LLC | 30 Sep 2015 | 12 Oct 2025 | 30 Sep 2026 |
| 523 | richlandgolfclub.com | GoDaddy.com, LLC | 30 Sep 2015 | 10 Jan 2026 | 30 Sep 2027 |
| 524 | richlandus.com | GoDaddy.com, LLC | 12 Jun 2023 | 24 Aug 2025 | 12 Jun 2025 |
| 525 | richlandmckenziegroup.com | Interweb Advertising D.B.A. Profile Builder | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2016 |
| 526 | richlandchamberslandscape.com | Google, Inc. | 1 Oct 2015 | 10 May 2024 | 1 Oct 2026 |
| 527 | richlandlegal.com | GoDaddy.com, LLC | 30 Jul 2015 | 31 Jul 2025 | 30 Jul 2027 |
| 528 | richlandexpress.com | GMO Internet Inc. | 22 Oct 2012 | 12 Sep 2016 | 22 Oct 2017 |
| 529 | richlandcompany.com | FastDomain Inc. | 31 Jul 2015 | 12 Dec 2025 | 31 Jul 2026 |
| 530 | richlandlegal.net | GoDaddy.com, LLC | 30 Jul 2015 | 31 Jul 2025 | 30 Jul 2027 |
| 531 | richlandhillsnews.com | Go Canada Domains, LLC | 1 Aug 2015 | 1 Aug 2015 | 1 Aug 2016 |
| 532 | richlandelderlaw.com | GoDaddy.com, LLC | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2017 |
| 533 | richlandcreekwhitetails.com | Domain.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 534 | richland-properties.com | CloudFlare, Inc. | 4 Mar 2025 | 14 Mar 2025 | 4 Mar 2026 |
| 535 | richlandhelp.com | GoDaddy.com, LLC | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2016 |
| 536 | richlandgroup.net | GoDaddy.com, LLC | 5 Aug 2015 | 5 Aug 2025 | 5 Aug 2026 |
| 537 | richlandschiropractor.com | GoDaddy.com, LLC | 8 Aug 2015 | 11 Aug 2025 | 8 Aug 2026 |
| 538 | richlandschiropractic.com | GoDaddy.com, LLC | 8 Aug 2015 | 9 Aug 2025 | 8 Aug 2026 |
| 539 | richlandforest.org | GoDaddy.com, LLC | 7 Aug 2015 | 21 Sep 2025 | 7 Aug 2026 |
| 540 | richlandcountyredribbonweek.com | register.com, Inc. | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2016 |
| 541 | richlandslittleleague.org | GoDaddy.com, LLC | 5 Oct 2015 | 17 Oct 2025 | 5 Oct 2026 |
| 542 | richlandslittleleague.net | GoDaddy.com, LLC | 5 Oct 2015 | 5 Oct 2015 | 5 Oct 2018 |
| 543 | richlandslittleleague.com | Coral Reef Domains LLC | 23 Dec 2023 | 5 Feb 2025 | 23 Dec 2024 |
| 544 | richlandlocksmith.com | GoDaddy.com, LLC | 5 Oct 2015 | 6 Oct 2025 | 5 Oct 2026 |
| 545 | richlandforesthome.com | GoDaddy.com, LLC | 5 Sep 2025 | 5 Sep 2025 | 5 Sep 2026 |
| 546 | richlandcreektimber.com | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2017 |
| 547 | richlandsebainfo.com | DreamHost, LLC | 10 Oct 2015 | 9 Oct 2015 | 10 Oct 2018 |
| 548 | richlandpa.com | GoDaddy.com, LLC | 5 Jul 2024 | 5 Jul 2024 | 5 Jul 2026 |
| 549 | richlandbellfurniture.com | GoDaddy.com, LLC | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 550 | richlandregatta.com | GoDaddy.com, LLC | 17 Oct 2015 | 12 Dec 2024 | 17 Oct 2026 |
| 551 | richlandmosley.com | GoDaddy.com, LLC | 12 Feb 2020 | 13 Feb 2025 | 12 Feb 2027 |
| 552 | richlandsupc.com | eNom, Inc. | 27 Oct 2015 | 12 Sep 2025 | 27 Oct 2026 |
| 553 | richlandfs.com | Google, Inc. | 11 Sep 2024 | 27 Aug 2025 | 11 Sep 2026 |
| 554 | richlandsaccounting.com | - | - | - | - |
| 555 | richlandsaccountancy.com | GoDaddy.com, LLC | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2020 |
| 556 | richlandtennis.mobi | GoDaddy.com, LLC | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 557 | richlandcreekdentistry.com | GoDaddy.com, LLC | 2 Nov 2015 | 3 Nov 2025 | 2 Nov 2026 |
| 558 | richlandbombers.org | Porkbun, LLC | 5 Apr 2018 | 9 Apr 2025 | 5 Apr 2026 |
| 559 | richlandcountybank.info | Network Solutions, LLC | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 560 | richlandgolfclub.net | Squarespace Domains LLC | 22 Apr 2021 | 8 Apr 2025 | 22 Apr 2026 |
| 561 | richlandems.com | eNom, Inc. | 23 May 2022 | 23 May 2022 | 23 May 2023 |
| 562 | richlandcenterautomotiverepair.com | eNom, Inc. | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 563 | richland2proudparents.com | GoDaddy.com, LLC | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 564 | richlandbrothers.org | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 565 | richlandbrothers.net | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 566 | richlandbrothers.info | GoDaddy.com, LLC | 10 Nov 2015 | - | 10 Nov 2016 |
| 567 | richlandbrothers.com | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2017 |
| 568 | richlandbros.com | Wild West Domains, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 569 | richlandstate.org | FastDomain Inc. | 11 Nov 2015 | 31 Oct 2025 | 11 Nov 2026 |
| 570 | richlandgrovetreefarm.com | GoDaddy.com, LLC | 11 Nov 2015 | 12 Nov 2025 | 11 Nov 2027 |
| 571 | richlanddispensary.com | Wild West Domains, LLC | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2016 |
| 572 | richlandoneedmodo.com | GoDaddy.com, LLC | 20 Dec 2016 | 20 Dec 2016 | 20 Dec 2017 |
| 573 | richlandnursery.com | GoDaddy.com, LLC | 26 Dec 2023 | 27 Dec 2025 | 26 Dec 2027 |
| 574 | richland-official.com | Network Solutions, LLC | 16 Nov 2015 | 17 Oct 2025 | 16 Nov 2027 |
| 575 | richlandstate.info | Network Solutions, LLC | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2016 |
| 576 | richlandsfs.com | Synergy Wholesale Pty Ltd | 19 Nov 2015 | 29 Oct 2025 | 19 Nov 2026 |
| 577 | richlandsfinance.com | Synergy Wholesale Pty Ltd | 18 Nov 2015 | 29 Oct 2025 | 18 Nov 2026 |
| 578 | richlandpreview.net | GMO Internet Inc. | 20 Nov 2015 | 20 Nov 2015 | 20 Nov 2016 |
| 579 | richland3.org | - | 23 Dec 2025 | 23 Dec 2025 | 23 Dec 2026 |
| 580 | richlandshomecare.com | eNom, Inc. | 12 Apr 2019 | 5 Apr 2025 | 12 Apr 2026 |
| 581 | richlandgroupcorp.com | Network Solutions, LLC | 23 Aug 2018 | 29 Jul 2025 | 23 Aug 2026 |
| 582 | richlandrealestate.info | Google, Inc. | 23 Dec 2019 | 5 Mar 2025 | 23 Dec 2024 |
| 583 | richlandsbubblesoccer.com | GoDaddy.com, LLC | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 584 | richlandsbubbleball.com | GoDaddy.com, LLC | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 585 | richlandmirealestateagent.com | eNom, Inc. | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2016 |
| 586 | richlandcommunityprayer.com | Launchpad, Inc. | 3 Dec 2015 | 18 Nov 2025 | 3 Dec 2026 |
| 587 | richlandapts.com | GoDaddy.com, LLC | 7 Sep 2021 | 8 Sep 2025 | 7 Sep 2026 |
| 588 | richlandhoteldanang.com | OnlineNIC, Inc. | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2016 |
| 589 | richlandtrikes.com | GoDaddy.com, LLC | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2017 |
| 590 | richlandcountycomputers.com | Tucows Domains Inc. | 4 Dec 2013 | 8 Dec 2015 | 4 Dec 2016 |
| 591 | richlandphotography.net | Tucows Domains Inc. | 8 Dec 2015 | 12 Dec 2016 | 8 Dec 2016 |
| 592 | richlandcountyland.com | GoDaddy.com, LLC | 8 Dec 2015 | 8 Dec 2015 | 8 Dec 2020 |
| 593 | richlandtechnologiescanada.com | GoDaddy.com, LLC | 10 Dec 2015 | 10 Dec 2015 | 10 Dec 2016 |
| 594 | richlandtechcanada.com | GoDaddy.com, LLC | 10 Dec 2015 | 10 Dec 2015 | 10 Dec 2016 |
| 595 | richlandrestaurant.com | GoDaddy.com, LLC | 10 Dec 2015 | 10 Dec 2015 | 10 Dec 2016 |
| 596 | richland-baptist-church.com | eNom, Inc. | 11 Dec 2015 | 12 Nov 2016 | 11 Dec 2017 |
| 597 | richlandwisdomtooth.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 598 | richlandwisdomteeth.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 599 | richlandoralsurgery.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 600 | richlandoralsurgeons.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 601 | richlanddentalimplant.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 602 | richlandcitylandscaper.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 603 | richlandhomestores.com | GoDaddy.com, LLC | 17 Dec 2015 | 17 Dec 2015 | 17 Dec 2016 |
| 604 | richlandlivestock.info | Network Solutions, LLC | 20 Dec 2015 | 20 Dec 2015 | 20 Dec 2016 |
| 605 | richlandgac.com | Google, Inc. | 10 Sep 2024 | 22 Oct 2025 | 10 Sep 2025 |
| 606 | richlandcountydetentioncenter.com | Epik Inc. | 25 Dec 2007 | 16 Mar 2017 | 25 Dec 2017 |
| 607 | richlandrestorationexperts.com | eNom, Inc. | 29 Dec 2015 | 30 Nov 2016 | 29 Dec 2017 |
| 608 | richlandplumbingexperts.com | eNom, Inc. | 29 Dec 2015 | 30 Nov 2016 | 29 Dec 2017 |
| 609 | richlandheatingandairconditioning.com | eNom, Inc. | 29 Dec 2015 | 30 Nov 2016 | 29 Dec 2017 |
| 610 | richlandpsychology.com | GoDaddy.com, LLC | 1 Jan 2016 | 1 Jan 2026 | 1 Jan 2027 |
| 611 | richlandwageneralcontracting.com | eNom, Inc. | 7 Jan 2016 | 28 Dec 2016 | 7 Jan 2018 |
| 612 | richlandproperty.com | TurnCommerce, Inc. DBA NameBright.com | 7 Jan 2016 | 1 Jan 2021 | 7 Jan 2026 |
| 613 | richlandprogreen.com | Paragon Internet Group Ltd t/a Paragon Names | 8 Jan 2016 | 16 Jan 2018 | 8 Jan 2019 |
| 614 | richlandholdingllc.com | 1&1 Internet AG | 8 Jan 2016 | 9 Jan 2023 | 8 Jan 2027 |
| 615 | richlandlords.com | 1API GmbH | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 616 | richlandholdingsllc.com | 1&1 Internet AG | 11 Jan 2016 | 12 Jan 2023 | 11 Jan 2027 |
| 617 | richlandsglass.com | Tucows Domains Inc. | 13 Jan 2016 | 17 Jan 2017 | 13 Jan 2017 |
| 618 | richlandveterinaryservicellc.com | Google, Inc. | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 619 | richlandmould.com | Xin Net Technology Corporation | 6 Jan 2004 | 5 Jan 2026 | 6 Jan 2027 |
| 620 | richlandpainsuranceagency.com | eNom, Inc. | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 621 | richlandforeclosures.com | eNom, Inc. | 16 Jan 2016 | 3 Jan 2017 | 16 Jan 2018 |
| 622 | richlandwahomesforsale.com | GoDaddy.com, LLC | 15 Apr 2024 | 15 Apr 2024 | 15 Apr 2029 |
| 623 | richlandtsa.us | GoDaddy.com, LLC | 16 Jan 2016 | 16 Jan 2016 | 15 Jan 2017 |
| 624 | richlandssda.com | Tucows Domains Inc. | 18 Jan 2016 | 22 Jan 2018 | 18 Jan 2018 |
| 625 | richlandareabeekeeper.com | GoDaddy.com, LLC | 24 Aug 2021 | 24 Aug 2021 | 24 Aug 2022 |
| 626 | richlandwildcats.org | GoDaddy.com, LLC | 21 Jan 2016 | 22 Jan 2017 | 21 Jan 2018 |
| 627 | richlandgllass.com | Tucows Domains Inc. | 20 Jan 2016 | 24 Jan 2017 | 20 Jan 2017 |
| 628 | richlandbilliards.com | eNom, Inc. | 6 Jan 2016 | 20 Jan 2016 | 6 Jan 2017 |
| 629 | richlandsinserts.com | register.com, Inc. | 23 Jan 2016 | 8 Jan 2017 | 23 Jan 2018 |
| 630 | richlandmiddleschool.com | DropCatch.com 419 LLC | 23 Jan 2016 | 24 Jan 2017 | 23 Jan 2018 |
| 631 | richlandplace.com | 1&1 Internet AG | 19 Jun 2000 | 22 Dec 2025 | 2 Feb 2026 |
| 632 | richlandswildcats.org | GoDaddy.com, LLC | 25 Jan 2016 | 26 Jan 2017 | 25 Jan 2018 |
| 633 | richlandgarment.com | HiChina Zhicheng Technology Limited | 27 Jan 2016 | 27 Jan 2016 | 27 Jan 2021 |
| 634 | richlandwillslawyer.com | Domain.com, LLC | 29 Jan 2016 | 14 Jan 2017 | 29 Jan 2018 |
| 635 | richlandrealestatelawyer.com | Domain.com, LLC | 29 Jan 2016 | 14 Jan 2017 | 29 Jan 2018 |
| 636 | richlandprobatelawyer.com | Domain.com, LLC | 29 Jan 2016 | 14 Jan 2017 | 29 Jan 2018 |
| 637 | richlandadoptionlawyer.com | Domain.com, LLC | 29 Jan 2016 | 14 Jan 2017 | 29 Jan 2018 |
| 638 | richlandrental.com | CloudFlare, Inc. | 2 Feb 2016 | 3 Jan 2026 | 2 Feb 2027 |
| 639 | richlandmassagetherapist.com | GoDaddy.com, LLC | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 640 | richlandsvrs-nc.org | register.com, Inc. | 4 Feb 2016 | 3 May 2017 | 4 Feb 2018 |
| 641 | richlandadventures.com | register.com, Inc. | 4 Feb 2016 | 25 Mar 2019 | 4 Feb 2020 |
| 642 | richlandwapropertymanagement.com | eNom, Inc. | 8 Feb 2016 | 8 Feb 2016 | 8 Feb 2017 |
| 643 | richlandheritage.org | GoDaddy.com, LLC | 20 Apr 2022 | 4 Jun 2025 | 20 Apr 2026 |
| 644 | richlandfirstumc.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Feb 2016 | 18 Jan 2017 | 9 Feb 2018 |
| 645 | richlandalliance.com | TurnCommerce, Inc. DBA NameBright.com | 21 May 2019 | 15 May 2020 | 21 May 2026 |
| 646 | richlandcc.com | Network Solutions, LLC | 16 Oct 1997 | 30 Sep 2025 | 15 Oct 2026 |
| 647 | richlandhomes4sale.com | GoDaddy.com, LLC | 14 Feb 2016 | 14 Feb 2016 | 14 Feb 2018 |
| 648 | richlandtricofair.com | GoDaddy.com, LLC | 15 Feb 2016 | 15 Feb 2016 | 15 Feb 2017 |
| 649 | richlandheating.com | GoDaddy.com, LLC | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 650 | richlandhospital.com | Network Solutions, LLC | 19 Nov 1997 | 18 Nov 2022 | 18 Nov 2032 |
| 651 | richlandcenterseniorexpo.com | GoDaddy.com, LLC | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 652 | richland21.com | Gabia, Inc. | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 653 | richlandsewingcenter.com | Namesilo, LLC | 30 Jan 2005 | 7 May 2025 | 30 Jan 2026 |
| 654 | richlandmarijuanadelivery.com | GoDaddy.com, LLC | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 655 | richlandcountyonline.net | Fabulous.com Pty Ltd. | 31 Jan 2006 | 18 Feb 2016 | 31 Jan 2017 |
| 656 | richlandpediatrics.org | DNC Holdings, Inc. | 23 Feb 2016 | 27 Feb 2025 | 23 Feb 2026 |
| 657 | richlandtrojans.com | GoDaddy.com, LLC | 23 Feb 2016 | 5 Jun 2025 | 30 Jul 2027 |
| 658 | richlandscandystore.com | GoDaddy.com, LLC | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2017 |
| 659 | richlandpediatrics.com | DNC Holdings, Inc. | 23 Feb 2016 | 26 Mar 2025 | 23 Feb 2026 |
| 660 | richlandcres.com | GoDaddy.com, LLC | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2017 |
| 661 | richlandsoutdoorpower.com | Tucows Domains Inc. | 21 Feb 2013 | 25 Feb 2016 | 21 Feb 2017 |
| 662 | richlandcommons.com | Wix.com Ltd. | 2 Sep 2020 | 13 Oct 2024 | 2 Sep 2024 |
| 663 | richlandnukeclash.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Feb 2016 | 3 Apr 2017 | 26 Feb 2018 |
| 664 | richlandcremation.com | Name.com, Inc. | 25 Feb 2016 | 4 Jun 2025 | 25 Feb 2026 |
| 665 | richlandprosecutoroh.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Feb 2016 | 28 Feb 2025 | 27 Feb 2025 |
| 666 | richlandoutreachcenter.com | GoDaddy.com, LLC | 27 Feb 2016 | 27 Feb 2016 | 27 Feb 2017 |
| 667 | richlandhillsapartments.com | CloudFlare, Inc. | 1 Jan 2025 | 2 Dec 2025 | 1 Jan 2027 |
| 668 | richlandgl.com | HiChina Zhicheng Technology Limited | 27 Feb 2016 | 20 Feb 2017 | 27 Feb 2018 |
| 669 | richlandcenterautomotive.com | GoDaddy.com, LLC | 26 Feb 2016 | 27 Feb 2025 | 26 Feb 2026 |
| 670 | richlandinfo.com | GoDaddy.com, LLC | 25 Feb 1997 | 6 Feb 2025 | 26 Feb 2026 |
| 671 | richlandhillsapts.com | Namesilo, LLC | 13 Feb 2018 | 14 Feb 2018 | 13 Feb 2019 |
| 672 | richlandtacotime.com | GoDaddy.com, LLC | 3 Mar 2016 | 4 Mar 2025 | 3 Mar 2027 |
| 673 | richlandconnect.com | GoDaddy.com, LLC | 4 Mar 2016 | 16 May 2024 | 4 Mar 2024 |
| 674 | richlandexpress.com.au | - | - | 16 Jul 2025 | - |
| 675 | richlandbraces.com | NameCheap, Inc. | 5 May 2023 | 17 Jul 2024 | 5 May 2024 |
| 676 | richlandcrane.com | Tucows Domains Inc. | 9 Mar 2016 | 13 Mar 2018 | 9 Mar 2018 |
| 677 | richlanduptown.com | DropCatch.com 371 LLC | 11 Mar 2016 | 25 Apr 2020 | 11 Mar 2026 |
| 678 | richlandareabeekeepers.com | GoDaddy.com, LLC | 19 Jan 2018 | 19 Jan 2026 | 19 Jan 2027 |
| 679 | richlandmall.com | Network Solutions, LLC | 8 Dec 1999 | 10 Feb 2025 | 8 Dec 2026 |
| 680 | richlandparishtrafficticketlawyer.com | GoDaddy.com, LLC | 14 Mar 2016 | 23 May 2025 | 29 Jan 2035 |
| 681 | richlandtowninn.net | GoDaddy.com, LLC | 16 Nov 2018 | 16 Nov 2018 | 16 Nov 2019 |
| 682 | richlandstewardshipproject.com | Automattic Inc. | 20 Aug 2017 | 17 Dec 2025 | 20 Aug 2026 |
| 683 | richlandforklift.com | HiChina Zhicheng Technology Limited | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 684 | richlandatomic.online | NameCheap, Inc. | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 685 | richlandpartnership.org | GoDaddy.com, LLC | 18 Mar 2016 | 1 Mar 2017 | 18 Mar 2018 |
| 686 | richlandpartnership.com | GoDaddy.com, LLC | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2017 |
| 687 | richlandfcu.info | Network Solutions, LLC | 18 Mar 2016 | 18 Jan 2022 | 18 Mar 2027 |
| 688 | richlandacademy.com | Domain.com, LLC | 15 Oct 2001 | 25 Sep 2025 | 15 Oct 2026 |
| 689 | richlandcare.com | TurnCommerce, Inc. DBA NameBright.com | 19 Mar 2016 | 13 Feb 2025 | 19 Mar 2026 |
| 690 | richlandstatecollege.net | GoDaddy.com, LLC | 21 Mar 2016 | 22 Mar 2025 | 21 Mar 2026 |
| 691 | richlandstatecollege.com | GoDaddy.com, LLC | 21 Mar 2016 | 22 Mar 2025 | 21 Mar 2026 |
| 692 | richlandsprings.net | GoDaddy.com, LLC | 24 Mar 2016 | 24 Mar 2016 | 24 Mar 2017 |
| 693 | richlandlocker.com | GoDaddy.com, LLC | 28 Jun 2012 | 29 Jun 2025 | 28 Jun 2027 |
| 694 | richlandcapitalgroupllc.com | GoDaddy.com, LLC | 26 Mar 2016 | 26 Mar 2016 | 26 Mar 2017 |
| 695 | richlandbrandsllc.com | FastDomain Inc. | 29 Mar 2016 | 14 Mar 2025 | 29 Mar 2026 |
| 696 | richlandbrands.com | FastDomain Inc. | 29 Mar 2016 | 14 Mar 2025 | 29 Mar 2026 |
| 697 | richlandlive.org | GoDaddy.com, LLC | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 698 | richlandlive.info | GoDaddy.com, LLC | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 699 | richlandlive.net | GoDaddy.com, LLC | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 700 | richlandlive.com | GoDaddy.com, LLC | 30 Mar 2016 | 31 Mar 2024 | 30 Mar 2026 |
| 701 | richlandindustries.com | Domain.com, LLC | 24 Jun 2019 | 3 Dec 2025 | 18 Jun 2027 |
| 702 | richlandathletics.org | GoDaddy.com, LLC | 1 Apr 2016 | 16 May 2025 | 1 Apr 2026 |
| 703 | richlandpest.biz | Tucows Domains Inc. | 2 Apr 2009 | 2 Apr 2009 | 1 Apr 2016 |
| 704 | richlandspringsjewelry.com | GoDaddy.com, LLC | 5 Apr 2016 | 5 Apr 2016 | 5 Apr 2017 |
| 705 | richlandagro.com | Google, Inc. | 5 Jul 2020 | 16 Aug 2025 | 5 Jul 2025 |
| 706 | richlandcarpetcleaning.com | GoDaddy.com, LLC | 24 Aug 2016 | 29 Jul 2025 | 24 Aug 2026 |
| 707 | richlandmtg.com | NameCheap, Inc. | 25 Apr 2024 | 25 Apr 2024 | 25 Apr 2025 |
| 708 | richlandvibecard.com | Network Solutions, LLC | 13 Apr 2016 | 6 Mar 2017 | 13 Apr 2018 |
| 709 | richlanddistribution.info | Network Solutions, LLC | 13 Apr 2016 | 12 Feb 2025 | 13 Apr 2026 |
| 710 | richlandhillsandthe-t.com | Network Solutions, LLC | 14 Apr 2016 | 5 Mar 2017 | 14 Apr 2018 |
| 711 | richlandcounselingcenter.com | GoDaddy.com, LLC | 17 Apr 2016 | 17 Apr 2016 | 17 Apr 2018 |
| 712 | richlandcounseling.com | GoDaddy.com, LLC | 17 Apr 2016 | 17 Apr 2016 | 17 Apr 2018 |
| 713 | richlandcountymuseumnd.com | register.com, Inc. | 18 Apr 2016 | 6 Apr 2024 | 18 Apr 2026 |
| 714 | richlandlogistics.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 30 Mar 2012 | 16 Aug 2025 | 30 Mar 2026 |
| 715 | richland-county-appliance.net | GoDaddy.com, LLC | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 716 | richlandane.org | - | 23 Apr 2016 | 23 Apr 2016 | 23 Apr 2017 |
| 717 | richlandpizza.com | Epik Inc. | 14 Jul 2021 | 25 Sep 2023 | 14 Jul 2023 |
| 718 | richlandinnlewisburgtn.com | GoDaddy.com, LLC | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 719 | richlandhillsfarm.com | Dynadot, LLC | 14 Mar 2025 | 17 Mar 2025 | 14 Mar 2026 |
| 720 | richlandcoffeeroasters.com | GoDaddy.com, LLC | 30 Apr 2016 | 30 Apr 2016 | 30 Apr 2018 |
| 721 | richlandcoffee.com | GoDaddy.com, LLC | 26 Jun 2024 | 27 Jun 2025 | 26 Jun 2026 |
| 722 | richlandcarecenter.com | NameCheap, Inc. | 29 Apr 2016 | 30 Mar 2025 | 29 Apr 2026 |
| 723 | richlandcafe.com | GoDaddy.com, LLC | 12 Nov 2019 | 12 Nov 2019 | 12 Nov 2020 |
| 724 | richlandchambersmarina.com | Tucows Domains Inc. | 27 Apr 2011 | 27 Apr 2011 | 27 Apr 2017 |
| 725 | richlandlutheran.church | eNom, Inc. | 5 May 2016 | 9 Apr 2025 | 5 May 2026 |
| 726 | richlandmi.org | GoDaddy.com, LLC | 4 May 2016 | 5 May 2017 | 4 May 2018 |
| 727 | richlandmi.com | GoDaddy.com, LLC | 4 May 2016 | 4 May 2016 | 4 May 2017 |
| 728 | richlandreatlyinc.com | Tucows Domains Inc. | 1 May 2003 | 1 May 2003 | 1 May 2017 |
| 729 | richlandpestandbeecontrol.com | Tucows Domains Inc. | 1 May 2009 | 1 May 2009 | 1 May 2017 |
| 730 | richlandroadtrip.com | GoDaddy.com, LLC | 5 May 2016 | 5 Apr 2024 | 5 May 2026 |
| 731 | richlandchildcounseling.com | Tucows Domains Inc. | 2 May 2011 | 2 May 2011 | 2 May 2017 |
| 732 | richlandgac.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 May 2016 | 8 May 2016 | 8 May 2017 |
| 733 | richlandhomesforrent.com | GoDaddy.com, LLC | 8 May 2016 | 8 May 2016 | 8 May 2017 |
| 734 | richlandareachamber.com | GoDaddy.com, LLC | 15 Jun 2011 | 16 Jun 2025 | 15 Jun 2026 |
| 735 | richlandyachtclub.info | Network Solutions, LLC | 10 May 2016 | 10 May 2016 | 10 May 2017 |
| 736 | richlandrealtor.com | GoDaddy.com, LLC | 1 Mar 2025 | 1 Mar 2025 | 1 Mar 2026 |
| 737 | richlandrealestatebroker.com | GoDaddy.com, LLC | 11 May 2016 | 11 May 2016 | 11 May 2018 |
| 738 | richlandco-op.com | Google, Inc. | 11 May 2016 | 20 Apr 2017 | 11 May 2018 |
| 739 | richlandswoodproducts.com | GoDaddy.com, LLC | 16 May 2016 | 21 Sep 2022 | 16 May 2026 |
| 740 | richlandhardwarenashville.com | Tucows Domains Inc. | 18 May 2016 | 22 May 2020 | 18 May 2020 |
| 741 | richlandsleepcenter.com | Network Solutions, LLC | 15 Oct 2009 | 16 Aug 2024 | 15 Oct 2029 |
| 742 | richlandsuites.com | GoDaddy.com, LLC | 6 Jan 2010 | 8 Dec 2025 | 6 Jan 2028 |
| 743 | richland-chambers-lake-real-estate.com | GoDaddy.com, LLC | 16 May 2009 | 6 Sep 2022 | 16 May 2029 |
| 744 | richlandglory.com | Media Elite Holdings Limited | 26 Aug 2022 | 9 Nov 2023 | 26 Aug 2023 |
| 745 | richlandhabitat.org | Tucows Domains Inc. | 20 May 2007 | 23 May 2017 | 20 May 2018 |
| 746 | richlandhighschoolrebelssportsteamapparel.com | GoDaddy.com, LLC | 24 May 2016 | 24 May 2016 | 24 May 2017 |
| 747 | richlandschools.org | GoDaddy.com, LLC | 25 May 2016 | 18 May 2025 | 25 May 2026 |
| 748 | richlandhillsfarms.com | FastDomain Inc. | 25 May 2016 | 10 May 2025 | 25 May 2026 |
| 749 | richlandforvince.com | GoDaddy.com, LLC | 25 May 2016 | 25 May 2016 | 25 May 2017 |
| 750 | richlandsgreatoutdoors.com | GoDaddy.com, LLC | 26 May 2016 | 31 Mar 2025 | 26 May 2026 |
| 751 | richlandschooldistrict.com | Wild West Domains, LLC | 7 Apr 2021 | 7 Apr 2021 | 7 Apr 2022 |
| 752 | richlands.city | Epik Inc. | 31 May 2016 | 15 Jul 2017 | 31 May 2018 |
| 753 | richlandone.info | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 754 | richlandeq.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Feb 2024 | 27 Feb 2024 | 26 Feb 2025 |
| 755 | richlandfalls.com | GoDaddy.com, LLC | 25 Mar 2011 | 25 Mar 2025 | 25 Mar 2026 |
| 756 | richlandskate.com | GoDaddy.com, LLC | 24 Jun 2005 | 13 Jun 2024 | 24 Jun 2030 |
| 757 | richlandbooster.com | GoDaddy.com, LLC | 17 Aug 2009 | 18 Aug 2014 | 17 Aug 2019 |
| 758 | richlandhills.xyz | Uniregistrar Corp | 1 Jun 2016 | 23 Sep 2016 | 1 Jun 2017 |
| 759 | richlandtown.xyz | Uniregistrar Corp | 1 Jun 2016 | 23 Sep 2016 | 1 Jun 2017 |
| 760 | richlandsprings.xyz | Uniregistrar Corp | 1 Jun 2016 | 23 Sep 2016 | 1 Jun 2017 |
| 761 | richlands.xyz | Uniregistrar Corp | 31 May 2016 | 23 Sep 2016 | 31 May 2017 |
| 762 | richlandcenter.xyz | Uniregistrar Corp | 1 Jun 2016 | 23 Sep 2016 | 1 Jun 2017 |
| 763 | richlandsolutions.com | Tucows Domains Inc. | 23 Sep 2021 | 4 Dec 2024 | 23 Sep 2024 |
| 764 | richlandhills.com | Wild West Domains, LLC | 22 Sep 1997 | 21 Sep 2024 | 21 Sep 2026 |
| 765 | richlandfinancialsolutions.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 9 Jun 2016 | 9 Jun 2016 | 9 Jun 2017 |
| 766 | richlandsclassifieds.com | eNom, Inc. | 14 Jun 2016 | 14 Jun 2016 | 14 Jun 2017 |
| 767 | richlandcenter.city | Epik Inc. | 13 Jun 2016 | 28 Jul 2017 | 13 Jun 2018 |
| 768 | richlandresidential.com | Network Solutions, LLC | 17 Apr 2013 | 17 Feb 2024 | 17 Apr 2027 |
| 769 | richlandscape.com | NameCheap, Inc. | 15 Jun 2016 | 28 Jun 2025 | 15 Jun 2026 |
| 770 | richlandcollegeet.com | Tucows Domains Inc. | 15 Jun 2016 | 19 Jun 2018 | 15 Jun 2018 |
| 771 | richlandcreekrun.com | GoDaddy.com, LLC | 5 Jan 2007 | 2 Jan 2024 | 5 Jan 2029 |
| 772 | richlandfitness.com | TurnCommerce, Inc. DBA NameBright.com | 27 Oct 2011 | 11 Nov 2025 | 27 Oct 2026 |
| 773 | richlandfabric.com | HiChina Zhicheng Technology Limited | 20 Jun 2016 | 29 May 2024 | 20 Jun 2028 |
| 774 | richlandso.com | GoDaddy.com, LLC | 21 Jun 2016 | 21 Jun 2016 | 21 Jun 2017 |
| 775 | richlandrehabcenter.com | eNom, Inc. | 21 Jun 2016 | 21 Jun 2016 | 21 Jun 2017 |
| 776 | richlandfinancialsolutions.net | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 22 Jun 2016 | 22 Jun 2016 | 22 Jun 2017 |
| 777 | richlandmississippi.com | DropCatch.com 951 LLC | 23 Jun 2016 | 24 Jun 2017 | 23 Jun 2018 |
| 778 | richlandcenterroofing.com | eNom, Inc. | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 779 | richlandpersonalinjurylawyer.com | GoDaddy.com, LLC | 28 Jun 2016 | 22 Sep 2022 | 28 Jun 2026 |
| 780 | richlandduilaw.com | GoDaddy.com, LLC | 28 Jun 2016 | 22 Sep 2022 | 28 Jun 2026 |
| 781 | richlandemerald.xyz | NameCheap, Inc. | 1 Jul 2016 | 29 Jul 2016 | 1 Jul 2017 |
| 782 | richlandcountyfoundation.org | GoDaddy.com, LLC | 21 Dec 2001 | 29 Nov 2025 | 21 Dec 2028 |
| 783 | richlanduptowngirls.com | eNom, Inc. | 5 Jul 2016 | 21 Jun 2017 | 5 Jul 2018 |
| 784 | richlandwacpa.com | NameCheap, Inc. | 6 Jul 2016 | 6 Jun 2025 | 6 Jul 2026 |
| 785 | richlandprobationhomestudy.com | Wild West Domains, LLC | 8 Jul 2016 | 8 Jul 2016 | 8 Jul 2017 |
| 786 | richland-propertymanagement.com | GoDaddy.com, LLC | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 787 | richlandhills.city | Epik Inc. | 8 Jun 2016 | 23 Jul 2017 | 8 Jun 2018 |
| 788 | richlandtown.city | Epik Inc. | 10 Jun 2016 | 25 Jul 2017 | 10 Jun 2018 |
| 789 | richlands.win | Namesilo, LLC | 17 Jun 2016 | 20 Oct 2025 | 16 Jun 2026 |
| 790 | richlandcemetary.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jul 2016 | 13 Jul 2016 | 13 Jul 2017 |
| 791 | richlandcounty.directory | Wild West Domains, LLC | 17 Apr 2014 | 1 Jun 2016 | 17 Apr 2017 |
| 792 | richlandwashington.jobs | Name Share, Inc. | 26 Jan 2011 | 21 Mar 2016 | 26 Jan 2017 |
| 793 | richlands.in | - | 29 Nov 2013 | 14 Sep 2017 | 29 Nov 2018 |
| 794 | richlandcenter.jobs | Name Share, Inc. | 4 Feb 2010 | 21 Mar 2016 | 4 Feb 2017 |
| 795 | richlandhills.jobs | Name Share, Inc. | 4 Feb 2010 | 21 Mar 2016 | 4 Feb 2017 |
| 796 | richlandgrouprealestate.com | Crazy Domains FZ-LLC | 14 Jul 2016 | 25 Jul 2018 | 14 Jul 2018 |
| 797 | richlandgrouprealty.com | Crazy Domains FZ-LLC | 14 Jul 2016 | 25 Jul 2018 | 14 Jul 2018 |
| 798 | richlandlanding.com | GoDaddy.com, LLC | 14 Jul 2016 | 14 Jul 2016 | 14 Jul 2017 |
| 799 | richlandshoppes.com | GoDaddy.com, LLC | 14 Jul 2016 | 14 Jul 2016 | 14 Jul 2017 |
| 800 | richlandshops.com | GoDaddy.com, LLC | 14 Jul 2016 | 14 Jul 2016 | 14 Jul 2017 |
| 801 | richlandscafe.com | GoDaddy.com, LLC | 1 Dec 2018 | 2 Dec 2025 | 1 Dec 2026 |
| 802 | richlandwageneralcontractor.com | eNom, Inc. | 15 Jul 2016 | 27 Aug 2017 | 15 Jul 2017 |
| 803 | richlandelectric.net | Google, Inc. | 24 Nov 2022 | 9 Nov 2025 | 24 Nov 2026 |
| 804 | richlandpumpinc.biz | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 5 Dec 2013 | 18 Nov 2015 | 4 Dec 2016 |
| 805 | richlandshooters.biz | NameCheap, Inc. | 26 Jan 2006 | 26 Jan 2018 | 25 Jan 2018 |
| 806 | richlandpremier.biz | GoDaddy.com, LLC | 12 Apr 2007 | 24 Oct 2025 | 11 Apr 2026 |
| 807 | richlandhome.biz | Tucows Domains Inc. | 26 May 2014 | 10 Aug 2025 | 25 May 2026 |
| 808 | richlandmall.biz | Network Solutions, LLC | 12 Sep 2013 | 24 Oct 2025 | 11 Sep 2025 |
| 809 | richlandbank.biz | Network Solutions, LLC | 17 Dec 2010 | 21 May 2018 | 16 Dec 2020 |
| 810 | richlandfarm.net | GoDaddy.com, LLC | 17 Jul 2016 | 18 Jul 2024 | 17 Jul 2026 |
| 811 | richlandcountytechsupport.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 812 | richlandinnsuites.com | Dynadot, LLC | 26 Oct 2019 | 26 Oct 2019 | 26 Oct 2020 |
| 813 | richlandplaceseniorlivingcenterportland.com | - | 16 Jul 2012 | 16 Jul 2012 | 16 Jul 2017 |
| 814 | richlandcountycomputerrepair.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 815 | richlandcountyhsbands.org | register.com, Inc. | 20 Jul 2016 | 24 May 2017 | 20 Jul 2022 |
| 816 | richlandbrewingco.com | - | 22 Jul 2016 | 22 Jul 2016 | 22 Jul 2018 |
| 817 | richlandmotorcars.com | Domain.com, LLC | 24 Jul 2016 | 24 Jul 2016 | 24 Jul 2021 |
| 818 | richlandhomes.forsale | eNom, Inc. | 26 Jul 2016 | 7 Sep 2017 | 26 Jul 2017 |
| 819 | richlandbuilder.com | - | 30 Jul 2016 | 30 Jul 2016 | 30 Jul 2018 |
| 820 | richlandcitys.com | GMO Internet Inc. | 2 Aug 2016 | 4 Aug 2016 | 2 Aug 2017 |
| 821 | richland-resources.com | Hostinger, UAB | 31 Jul 2001 | 2 Jun 2025 | 31 Jul 2026 |
| 822 | richlandcitynhontrach.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 6 Mar 2023 | 7 Mar 2025 | 6 Mar 2026 |
| 823 | richlandcityhiepphuoc.com | P.A. Viet Nam Company Limited | 2 Aug 2016 | 2 Aug 2016 | 2 Aug 2017 |
| 824 | richlandcitynhontrach.net | GMO Internet Inc. | 2 Aug 2016 | 2 Aug 2016 | 2 Aug 2017 |
| 825 | richlandcity.org | GoDaddy.com, LLC | 31 Jul 2016 | 31 Jul 2016 | 31 Jul 2017 |
| 826 | richlandcity.com | Network Solutions, LLC | 4 Jan 2019 | 4 Jan 2019 | 4 Jan 2020 |
| 827 | richlandcity.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Jul 2016 | 10 Sep 2017 | 30 Jul 2017 |
| 828 | richlandcity.xyz | P.A. Viet Nam Company Limited | 30 Jul 2016 | 4 Aug 2016 | 30 Jul 2017 |
| 829 | richlandcity.online | - | 30 Jul 2016 | 30 Jul 2016 | 30 Jul 2017 |
| 830 | richlandestate.com | - | 1 Aug 2016 | 1 Aug 2016 | 1 Aug 2021 |
| 831 | richlandcity.top | P.A. Viet Nam Company Limited | 30 Jul 2016 | 4 Sep 2017 | 4 Sep 2017 |
| 832 | richlandscaping.com | GoDaddy.com, LLC | 13 Dec 2000 | 17 Dec 2025 | 13 Dec 2035 |
| 833 | richlanddeveloper.com | - | 4 Aug 2016 | 4 Aug 2016 | 4 Aug 2017 |
| 834 | richlandfurniturestore.com | GoDaddy.com, LLC | 4 Aug 2016 | 5 Aug 2025 | 4 Aug 2026 |
| 835 | richlanddistribution.net | HiChina Zhicheng Technology Limited | 3 Aug 2016 | 2 Aug 2022 | 3 Aug 2028 |
| 836 | richlandweddings.com | eNom, Inc. | 10 Aug 2016 | 15 Aug 2017 | 10 Aug 2018 |
| 837 | richlandsrealty.net | Network Solutions, LLC | 10 Aug 2016 | 21 Jul 2021 | 10 Aug 2026 |
| 838 | richlandforeclosurehomes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Aug 2016 | 23 Sep 2017 | 12 Aug 2017 |
| 839 | richlanddocksandservices.com | - | 14 Aug 2016 | 14 Aug 2016 | 14 Aug 2017 |
| 840 | richlandgardens.org | GMO Internet Inc. | 13 Aug 2016 | 23 Sep 2017 | 13 Aug 2018 |
| 841 | richlandsgear.com | - | 16 Aug 2016 | 16 Aug 2016 | 16 Aug 2017 |
| 842 | richlandshale.com | GoDaddy.com, LLC | 17 Aug 2016 | 18 Aug 2024 | 17 Aug 2026 |
| 843 | richlandhcrc.com | - | 19 Aug 2016 | 19 Aug 2016 | 19 Aug 2019 |
| 844 | richlandhomesomaha.com | GoDaddy.com, LLC | 21 Oct 2020 | 22 Oct 2024 | 21 Oct 2026 |
| 845 | richlandhousesomaha.com | - | 19 Aug 2016 | 19 Aug 2016 | 19 Aug 2017 |
| 846 | richlandhcrc.net | GoDaddy.com, LLC | 19 Aug 2016 | 19 Aug 2020 | 19 Aug 2022 |
| 847 | richlandhomesomaha.net | - | 19 Aug 2016 | 19 Aug 2016 | 19 Aug 2017 |
| 848 | richlandhomesomaha.org | GoDaddy.com, LLC | 19 Aug 2016 | 19 Aug 2016 | 19 Aug 2017 |
| 849 | richlandhomesomaha.us | - | 19 Aug 2016 | 19 Aug 2016 | 18 Aug 2017 |
| 850 | richlandbears.us | GoDaddy.com, LLC | 19 Jan 2011 | 24 Jan 2025 | 18 Jan 2027 |
| 851 | richlandcommunitydays.com | NameCheap, Inc. | 3 Jan 2023 | 16 Mar 2024 | 3 Jan 2024 |
| 852 | richlandcountyathletics.com | GoDaddy.com, LLC | 26 Aug 2016 | 27 Aug 2025 | 26 Aug 2026 |
| 853 | richlandcabinetdesigns.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Sep 2016 | 19 Oct 2017 | 7 Sep 2017 |
| 854 | richlandtaxservice.com | GoDaddy.com, LLC | 8 Sep 2016 | 20 Sep 2025 | 8 Sep 2026 |
| 855 | richlandproperties.net | NameCheap, Inc. | 19 Nov 2021 | 26 Oct 2022 | 19 Nov 2023 |
| 856 | richlandcountytransit.com | Network Solutions, LLC | 9 Sep 2016 | 30 Sep 2024 | 9 Sep 2029 |
| 857 | richlandwahomes.com | GoDaddy.com, LLC | 9 Sep 2016 | 10 Sep 2025 | 9 Sep 2026 |
| 858 | richlandba.org | Network Solutions, LLC | 9 Sep 2016 | 15 Aug 2024 | 9 Sep 2026 |
| 859 | richlandmarketgrocery.com | eNom, Inc. | 27 Aug 2013 | 31 Aug 2016 | 27 Aug 2016 |
| 860 | richlandsdairyfarm.com | DreamHost, LLC | 13 Sep 2016 | 13 Aug 2025 | 13 Sep 2026 |
| 861 | richlandblackstudents.org | Google, Inc. | 14 Sep 2016 | 2 Sep 2017 | 14 Sep 2018 |
| 862 | richland-foreclosurehomes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Sep 2016 | 2 Nov 2017 | 21 Sep 2017 |
| 863 | richland-web-design.com | GoDaddy.com, LLC | 27 May 2011 | 28 May 2016 | 27 May 2017 |
| 864 | richlandautism.com | - | 22 Sep 2016 | 22 Sep 2016 | 22 Sep 2017 |
| 865 | richlandsreality.com | Melbourne IT, Ltd | 7 Apr 2009 | 2 Jul 2017 | 7 Apr 2018 |
| 866 | richlandcourtapartments.com | GoDaddy.com, LLC | 23 Jun 2021 | 15 Oct 2022 | 23 Jun 2026 |
| 867 | richlandgasprices.com | Tucows Domains Inc. | 14 May 2024 | 25 Jul 2025 | 14 May 2025 |
| 868 | richlandgolfspecials.com | eNom, Inc. | 16 Nov 2006 | 18 Oct 2017 | 16 Nov 2018 |
| 869 | richlanddems.com | eNom, Inc. | 17 Aug 2008 | 20 Aug 2016 | 17 Aug 2016 |
| 870 | richlandeducation.com | Annulet LLC | 21 May 2005 | 6 Jul 2017 | 21 May 2018 |
| 871 | richlandcountyscbusinesslist.com | eNom, Inc. | 11 Jan 2008 | 13 Dec 2016 | 11 Jan 2018 |
| 872 | richlandcrm.com | HiChina Zhicheng Technology Limited | 21 May 2003 | 30 Apr 2024 | 21 May 2026 |
| 873 | richlandbr.com | GoDaddy.com, LLC | 5 Jan 2011 | 6 Jan 2026 | 5 Jan 2027 |
| 874 | richlandsfarm.com | HiChina Zhicheng Technology Limited | 3 Aug 2011 | 15 Jul 2025 | 3 Aug 2026 |
| 875 | richlandhillsplumbing.com | eNom, Inc. | 28 Jul 2006 | 29 Jun 2025 | 28 Jul 2026 |
| 876 | richlandmanorhc.com | DropCatch.com 1298 LLC | 2 Sep 2022 | 13 Oct 2023 | 2 Sep 2023 |
| 877 | richlandcenterdaily.com | GoDaddy.com, LLC | 27 Nov 2013 | 28 Nov 2015 | 27 Nov 2016 |
| 878 | richlandmemorialchapel.com | GoDaddy.com, LLC | 8 Aug 2003 | 2 Jun 2025 | 8 Aug 2026 |
| 879 | richlandssatellitetv.com | GoDaddy.com, LLC | 29 Sep 2011 | 24 Mar 2014 | 29 Sep 2016 |
| 880 | richlandhillshomes.com | eNom, Inc. | 22 Feb 2004 | 24 Jan 2025 | 22 Feb 2026 |
| 881 | richlandlivestock.com | Network Solutions, LLC | 12 Sep 2011 | 12 Sep 2021 | 12 Sep 2031 |
| 882 | richlandbees.com | register.com, Inc. | 3 Mar 2014 | 16 May 2023 | 3 Mar 2023 |
| 883 | richlandmeadows.com | eNom, Inc. | 30 Mar 2006 | 15 Jan 2024 | 30 Mar 2026 |
| 884 | richlandclo2.com | HiChina Zhicheng Technology Limited | 25 Apr 2011 | 10 Apr 2017 | 25 Apr 2020 |
| 885 | richlandcandles.com | Google, Inc. | 5 May 2011 | 16 Jun 2025 | 5 May 2025 |
| 886 | richlandcountysports.com | GoDaddy.com, LLC | 4 Jun 2003 | 4 Jun 2025 | 4 Jun 2026 |
| 887 | richlandchristiancounseling.com | NameCheap, Inc. | 8 Aug 2013 | 9 Jul 2025 | 8 Aug 2026 |
| 888 | richlandchambersmortgage.com | GoDaddy.com, LLC | 21 May 2014 | 14 Mar 2016 | 21 May 2017 |
| 889 | richlandchevy.com | MarkMonitor Inc. | 18 Oct 2005 | 16 Sep 2025 | 18 Oct 2026 |
| 890 | richlandsfirerescue.com | Tucows Domains Inc. | 2 Apr 2007 | 4 Mar 2025 | 2 Apr 2026 |
| 891 | richlandschooldistrictone.com | DNC Holdings, Inc. | 11 Nov 2005 | 7 Oct 2017 | 11 Nov 2018 |
| 892 | richlandmarkets.com | TurnCommerce, Inc. DBA NameBright.com | 14 May 2017 | 8 May 2021 | 14 May 2026 |
| 893 | richlandhillschateau.com | GoDaddy.com, LLC | 20 Jan 2012 | 20 Jan 2012 | 20 Jan 2017 |
| 894 | richlandhillslawyers.com | eNom, Inc. | 28 Jan 2011 | 30 Dec 2024 | 28 Jan 2026 |
| 895 | richlandblueprint.com | 1&1 Internet AG | 20 Jul 2005 | 21 Jul 2025 | 20 Jul 2026 |
| 896 | richlandhillsnursing.com | eNom, Inc. | 19 Dec 2007 | 23 Jan 2016 | 19 Dec 2016 |
| 897 | richlandselfstorage.com | GoDaddy.com, LLC | 21 Nov 2023 | 21 Nov 2023 | 21 Nov 2024 |
| 898 | richlandresource.com | GoDaddy.com, LLC | 21 Aug 2013 | 16 Jul 2016 | 21 Aug 2017 |
| 899 | richlandbasketball.com | GoDaddy.com, LLC | 24 Oct 2011 | 25 Oct 2015 | 24 Oct 2016 |
| 900 | richlandmotors.com | Uniregistrar Corp | 10 May 2008 | 14 May 2025 | 10 May 2026 |
| 901 | richlandmspd.com | TLDs LLC dba SRSplus | 15 Oct 2009 | 16 Sep 2025 | 15 Oct 2030 |
| 902 | richlanddig.com | GoDaddy.com, LLC | 13 Feb 2006 | 14 Feb 2025 | 13 Feb 2026 |
| 903 | richlandmastergardeners.com | Wix.com Ltd. | 27 Jul 2009 | 8 Jul 2025 | 27 Jul 2026 |
| 904 | richlandlegionriders.com | GoDaddy.com, LLC | 23 May 2020 | 4 Jul 2023 | 23 May 2023 |
| 905 | richlandgis.com | Network Solutions, LLC | 19 Jun 2000 | 20 Jun 2025 | 19 Jun 2035 |
| 906 | richlandsprings-news.com | GoDaddy.com, LLC | 5 Apr 2013 | 4 Feb 2015 | 5 Apr 2017 |
| 907 | richlandcastle.com | Tucows Domains Inc. | 18 Jan 2014 | 22 Jan 2017 | 18 Jan 2017 |
| 908 | richlandasset.com | GoDaddy.com, LLC | 27 Apr 2011 | 27 Apr 2016 | 27 Apr 2017 |
| 909 | richlandadvertiser.com | Brandsight, Inc. | 27 Jun 2007 | 28 May 2025 | 27 Jun 2026 |
| 910 | richlandonemiddlecollege.com | NameCheap, Inc. | 19 Sep 2024 | 31 Oct 2025 | 19 Sep 2025 |
| 911 | richlandlord.com | GoDaddy.com, LLC | 2 Mar 2006 | 28 Dec 2024 | 2 Mar 2026 |
| 912 | richlandshomes.com | GoDaddy.com, LLC | 10 Jul 2008 | 11 Jul 2025 | 10 Jul 2026 |
| 913 | richlandhillsrealestate.com | eNom, Inc. | 22 Feb 2004 | 24 Jan 2025 | 22 Feb 2026 |
| 914 | richlandmvp.com | GoDaddy.com, LLC | 28 Jun 2018 | 28 Jun 2018 | 28 Jun 2020 |
| 915 | richlandblog.com | Fabulous.com Pty Ltd. | 16 Apr 2007 | 6 Dec 2016 | 16 Apr 2018 |
| 916 | richlandcollege.com | GoDaddy.com, LLC | 22 Aug 2024 | 23 Aug 2025 | 22 Aug 2026 |
| 917 | richlandterraceapts.com | Wild West Domains, LLC | 22 Nov 2011 | 23 Nov 2025 | 22 Nov 2026 |
| 918 | richlanddisplay.com | GoDaddy.com, LLC | 14 Sep 2013 | 14 Sep 2013 | 14 Sep 2018 |
| 919 | richlandhillsrootcanal.com | GoDaddy.com, LLC | 17 Apr 2011 | 17 Apr 2016 | 17 Apr 2021 |
| 920 | richlandsmedical.com | eNom, Inc. | 4 Dec 2011 | 5 Dec 2023 | 4 Dec 2024 |
| 921 | richlandobserver.com | NameCheap, Inc. | 26 Dec 2008 | 26 Nov 2025 | 26 Dec 2026 |
| 922 | richlandlumberinc.com | NameCheap, Inc. | 4 Oct 2002 | 15 Sep 2025 | 4 Oct 2027 |
| 923 | richlandhillsforsale.com | eNom, Inc. | 8 Jul 2004 | 9 Jun 2025 | 8 Jul 2026 |
| 924 | richlandchurchofchrist.com | DROPCATCH.COM 824 LLC | 6 Feb 2017 | 7 Feb 2017 | 6 Feb 2018 |
| 925 | richlandchem.com | - | 24 Oct 2004 | 24 Oct 2004 | 25 Oct 2026 |
| 926 | richlandproperties.com | Dynadot, LLC | 14 Mar 2014 | 11 Apr 2025 | 14 Mar 2026 |
| 927 | richland83.com | MAFF Inc. | 17 Jun 2022 | 26 Aug 2024 | 17 Jun 2024 |
| 928 | richlandparkapts.com | MarkMonitor Inc. | 16 Aug 2013 | 19 Jul 2017 | 16 Aug 2018 |
| 929 | richlandfineart.com | GoDaddy.com, LLC | 2 Jul 2003 | 14 Aug 2025 | 2 Jul 2026 |
| 930 | richlandranch.com | GoDaddy.com, LLC | 3 Oct 1998 | 2 Oct 2025 | 2 Oct 2026 |
| 931 | richlando.com | GMO Internet Inc. | 28 Nov 2001 | 31 Oct 2025 | 29 Nov 2026 |
| 932 | richlandinsurance.com | Dynadot, LLC | 3 Jul 2010 | 4 Jul 2025 | 3 Jul 2026 |
| 933 | richlandhillshome.com | eNom, Inc. | 9 Jan 2005 | 11 Dec 2025 | 9 Jan 2027 |
| 934 | richlandhillslocksmiths.com | GoDaddy.com, LLC | 14 Jun 2009 | 14 Jun 2025 | 14 Jun 2026 |
| 935 | richlandsurgical.com | Network Solutions, LLC | 18 Jan 2013 | 29 Jan 2015 | 18 Jan 2018 |
| 936 | richlandwashington.com | Uniregistrar Corp | 7 Dec 1999 | 8 Dec 2025 | 7 Dec 2026 |
| 937 | richlandrotary.com | Namesilo, LLC | 24 Oct 2000 | 2 Jan 2026 | 24 Oct 2026 |
| 938 | richlandhillsmls.com | eNom, Inc. | 28 Mar 2006 | 27 Feb 2025 | 28 Mar 2026 |
| 939 | richlandintl.com | OnlineNIC, Inc. | 21 May 2003 | 21 May 2003 | 21 May 2026 |
| 940 | richlandeconomicdevelopment.com | Brandon Gray Internet Services, Inc. (dba NameJuic… | 7 Feb 2002 | 24 Dec 2025 | 4 Apr 2034 |
| 941 | richlandonlinetitleloans.com | GoDaddy.com, LLC | 19 Apr 2010 | 20 Apr 2025 | 19 Apr 2027 |
| 942 | richlandsundries.com | Wild West Domains, LLC | 6 Jul 2009 | 21 Jul 2025 | 6 Jul 2026 |
| 943 | richland-china.com | Xiamen ChinaSource Internet Service Co., Ltd. | 25 Apr 2002 | 11 Apr 2025 | 25 Apr 2026 |
| 944 | richlandmentalhealth.com | GoDaddy.com, LLC | 21 Feb 2013 | 22 Feb 2024 | 21 Feb 2026 |
| 945 | richlandent.com | CSC Corporate Domains, Inc. | 16 Jun 2010 | 6 Sep 2024 | 16 Jun 2027 |
| 946 | richlandscoc.com | eNom, Inc. | 2 Jun 2010 | 4 May 2025 | 2 Jun 2026 |
| 947 | richlandphotobooth.com | GoDaddy.com, LLC | 14 Aug 2012 | 18 Aug 2016 | 14 Aug 2018 |
| 948 | richlandcountytoyota.com | GoDaddy.com, LLC | 31 Oct 2008 | 20 Nov 2025 | 19 Nov 2027 |
| 949 | richlandhomecare.com | Wix.com Ltd. | 19 Oct 2025 | 3 Nov 2025 | 19 Oct 2028 |
| 950 | richlandsolutionsinc.com | Tucows Domains Inc. | 9 Sep 2009 | 13 Sep 2018 | 9 Sep 2018 |
| 951 | richlandhomevalues.com | GoDaddy.com, LLC | 30 Jun 2009 | 1 Jul 2016 | 30 Jun 2017 |
| 952 | richlandveterinarian.com | GoDaddy.com, LLC | 28 Mar 2011 | 10 Mar 2025 | 28 Mar 2030 |
| 953 | richlandrockresources.com | Tucows Domains Inc. | 16 Nov 2015 | 1 Nov 2025 | 16 Nov 2026 |
| 954 | richlandsparestorage.com | Network Solutions, LLC | 7 Apr 2008 | 6 Feb 2023 | 7 Apr 2028 |
| 955 | richlandhillsdentist.com | eNom, Inc. | 9 Jul 2004 | 10 Jun 2025 | 9 Jul 2026 |
| 956 | richlandlawncare.com | GoDaddy.com, LLC | 30 Sep 2024 | 1 Oct 2025 | 30 Sep 2026 |
| 957 | richlandorganics.com | GoDaddy.com, LLC | 12 Aug 1999 | 22 Jun 2023 | 12 Aug 2026 |
| 958 | richlanddesign.com | TurnCommerce, Inc. DBA NameBright.com | 13 Mar 2022 | 14 Apr 2024 | 13 Mar 2024 |
| 959 | richlandchambersreservoir.com | GoDaddy.com, LLC | 27 Jan 2009 | 27 Jan 2025 | 27 Jan 2027 |
| 960 | richlandcatering.com | Fabulous.com Pty Ltd. | 16 Apr 2007 | 6 Dec 2016 | 16 Apr 2018 |
| 961 | richlandparishlibrary.com | Tucows Domains Inc. | 6 Mar 2014 | 25 Jan 2026 | 6 Mar 2026 |
| 962 | richlandrealtyny.com | Porkbun, LLC | 21 Jun 2024 | 3 Aug 2025 | 21 Jun 2025 |
| 963 | richlandextendedstay.com | GoDaddy.com, LLC | 11 Jun 2014 | 12 Jun 2016 | 11 Jun 2017 |
| 964 | richlandjetcenter.com | GoDaddy.com, LLC | 9 Jan 2013 | 15 Feb 2016 | 9 Jan 2019 |
| 965 | richlandhelpwanted.com | Network Solutions, LLC | 10 Oct 2006 | 25 Sep 2025 | 10 Oct 2026 |
| 966 | richlandcreekbassclub.com | GoDaddy.com, LLC | 26 Jan 2013 | 27 Jan 2016 | 26 Jan 2017 |
| 967 | richlandcourtsoh.com | 1&1 Internet AG | 3 Mar 2011 | 19 Mar 2018 | 3 Mar 2026 |
| 968 | richlandjointreplacement.com | GoDaddy.com, LLC | 1 Feb 2014 | 4 Feb 2023 | 1 Feb 2028 |
| 969 | richlandcenterarea.com | Tucows Domains Inc. | 19 May 2009 | 23 May 2018 | 19 May 2018 |
| 970 | richlandcinemas.com | GoDaddy.com, LLC | 21 Oct 2003 | 1 Sep 2022 | 21 Oct 2026 |
| 971 | richlandcountyfriendsofanimals.com | Key-Systems GmbH | 18 Apr 2013 | 11 Jun 2017 | 18 Apr 2018 |
| 972 | richlandbaptist.com | 1&1 Internet AG | 26 Oct 2000 | 21 Nov 2018 | 26 Oct 2026 |
| 973 | richlandtownshiplibrary.com | GoDaddy.com, LLC | 13 Feb 2010 | 14 Feb 2025 | 13 Feb 2026 |
| 974 | richlandcarsales.com | Tucows Domains Inc. | 27 Jun 2008 | 26 Jun 2025 | 27 Jun 2026 |
| 975 | richlandthecenter.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 May 2023 | 21 Dec 2025 | 11 May 2026 |
| 976 | richlandglass.com | Domain.com, LLC | 21 Mar 1996 | 24 Jun 2025 | 22 Mar 2027 |
| 977 | richlandhillsflower.com | eNom, Inc. | 27 Apr 2006 | 29 Mar 2025 | 27 Apr 2026 |
| 978 | richlandpennypartners.com | GoDaddy.com, LLC | 11 Oct 2013 | 11 Oct 2015 | 11 Oct 2016 |
| 979 | richlanddentalwellness.com | Name.com, Inc. | 7 Apr 2009 | 22 Dec 2015 | 7 Apr 2017 |
| 980 | richland-chambers.com | GoDaddy.com, LLC | 14 Feb 2003 | 2 Sep 2022 | 14 Feb 2027 |
| 981 | richlandford.com | GoDaddy.com, LLC | 20 Nov 2011 | 20 Nov 2011 | 20 Nov 2016 |
| 982 | richlandband.com | Google, Inc. | 18 Jul 2025 | 18 Jul 2025 | 18 Jul 2026 |
| 983 | richlandsfootball.com | GoDaddy.com, LLC | 16 Nov 2005 | 27 Oct 2025 | 16 Nov 2026 |
| 984 | richlandcarshopping.com | GoDaddy.com, LLC | 14 Sep 2005 | 26 Nov 2025 | 14 Sep 2025 |
| 985 | richlandanimalhospital.com | GoDaddy.com, LLC | 13 May 2017 | 13 May 2017 | 13 May 2018 |
| 986 | richlandcountybank.com | Network Solutions, LLC | 7 Mar 2000 | 7 Mar 2024 | 7 Mar 2034 |
| 987 | richlandhillsloans.com | eNom, Inc. | 8 Aug 2004 | 10 Jul 2025 | 8 Aug 2026 |
| 988 | richlandinjurylaw.com | OnlineNIC, Inc. | 30 Dec 2011 | 1 Dec 2025 | 30 Dec 2026 |
| 989 | richlandplumber.com | GoDaddy.com, LLC | 26 Nov 2009 | 3 Dec 2025 | 26 Nov 2026 |
| 990 | richlandseniors.com | GoDaddy.com, LLC | 14 Feb 2004 | 28 Apr 2025 | 14 Feb 2025 |
| 991 | richlandtransportationpenny.com | GoDaddy.com, LLC | 11 Oct 2013 | 11 Oct 2015 | 11 Oct 2016 |
| 992 | richlandhillsglass.com | GoDaddy.com, LLC | 5 Jun 2010 | 15 Jun 2016 | 5 Jun 2017 |
| 993 | richlanddentalms.com | eNom, Inc. | 3 Jul 2007 | 4 Jun 2025 | 3 Jul 2026 |
| 994 | richlandraiders.com | GoDaddy.com, LLC | 29 Jul 2002 | 12 Feb 2025 | 1 Jan 2025 |
| 995 | richlandsealcoating.com | Wild West Domains, LLC | 12 Mar 2007 | 3 Mar 2025 | 12 Mar 2026 |
| 996 | richlandtrade.com | Xin Net Technology Corporation | 25 Nov 2013 | 6 Nov 2024 | 25 Nov 2026 |
| 997 | richlandlodging.com | NameCheap, Inc. | 6 Oct 2025 | 6 Oct 2025 | 6 Oct 2026 |
| 998 | richlandhighschool.com | GoDaddy.com, LLC | 28 Jul 2002 | 12 Feb 2025 | 1 Jan 2025 |
| 999 | richlandhotels.com | GoDaddy.com, LLC | 7 Jan 2002 | 18 Dec 2025 | 7 Jan 2027 |
| 1000 | richlanddui.com | GoDaddy.com, LLC | 8 Jun 2009 | 10 Jun 2014 | 8 Jun 2017 |
Displaying 1,000 out of 3,652 domains starting with the keyword "RICHLAND". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=richland
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |