Our database now contains whois records of 636 Million (636,600,133) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [636 Million Domains] $10,000 Details

Keyword: RENFREW

Reverse Whois » KEYWORD [renfrew ]  { 910 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1renfrew.propertyUniregistrar Corp31 Jan 20154 Feb 201531 Jan 2016
2renfrew.accountantsBB Online Ltd9 Feb 201518 Jan 20169 Feb 2016
3renfrew.cleaning1&1 Internet AG24 Feb 20159 Apr 202024 Feb 2021
4renfrew.scienceAlpnames Limited24 Feb 201525 Apr 201523 Feb 2016
5renfrew.websiteSuper Registry Inc.24 Jun 201524 Jun 201524 Jun 2016
6renfrew.linkAlpnames Limited4 Mar 201614 Apr 20174 Mar 2017
7renfrew.comGoDaddy.com, LLC9 Jan 199528 Jul 20258 Jan 2026
8renfrew.topAlpnames Limited18 Apr 201618 Apr 201618 Apr 2017
9renfrew.cityEpik Inc.10 Jun 201629 Sep 201710 Jun 2018
10renfrew.partyAlpnames Limited17 Feb 20154 Mar 201616 Feb 2017
11renfrew.tradeAlpnames Limited9 Jun 20149 Jun 20178 Jun 2017
12renfrew.bizNameScout Corp.1 Feb 200417 Dec 201931 Jan 2021
13renfrew.plumbingGoDaddy.com, LLC3 Aug 201617 Sep 20193 Aug 2020
14renfrew.onlineCSL Computer Service Langenbach GmbH d/b/a joker.c…7 Aug 201624 Sep 20167 Aug 2017
15renfrew.infoSuper Registry Inc.4 Jul 20134 Jul 20254 Jul 2026
16renfrew.netTucows Domains Inc.4 Jun 19975 May 20253 Jun 2026
17renfrew.orgNetwork Solutions, LLC30 Sep 199629 Sep 201829 Sep 2028
18renfrew.xyzNameCheap, Inc.2 Jun 20166 Jun 20172 Jun 2018
19renfrew.ca-12 Dec 201314 Jan 202512 Dec 2027
20renfrew.co.uk--18 Feb 202517 Feb 2026
21renfrew.org.uk-28 Feb 202516 Jul 202528 Feb 2026
22renfrew.dentalNameCheap, Inc.25 Jul 201829 Jun 202525 Jul 2026
23renfrew.coNetwork Solutions, LLC18 Jun 201023 Jun 202117 Jun 2026
24renfrew.todayDynadot, LLC11 Oct 201911 Oct 201911 Oct 2020
25renfrew.emailGoDaddy.com, LLC15 Nov 201930 Dec 202415 Nov 2025
26renfrew.homesPorkbun, LLC14 May 201926 Jun 202014 May 2021
27renfrew.centerNetwork Solutions, LLC5 Jul 20227 Jul 20235 Jul 2024
28renfrew.fishingGoDaddy.com, LLC2 Mar 202113 Apr 20232 Mar 2023
29renfrew.co.ke-5 Dec 202225 Nov 20245 Dec 2025
30renfrew.ru-16 Feb 2023-16 Feb 2026
31renfrew.de--9 May 2025-
32renfrew.eventsSuper Registry Inc.3 Nov 20248 Nov 20243 Nov 2025
33renfrew.storeTucows Domains Inc.9 Jan 202510 Feb 20259 Jan 2026
34renfrewshire.gov.uk----
35renfrewcenter.comNetwork Solutions, LLC7 Feb 20009 Dec 20237 Feb 2029
36renfrewshiregreenmap.orgTucows Domains Inc.15 Oct 201020 Sep 202415 Oct 2025
37renfrewhomes.comTurnCommerce, Inc. DBA NameBright.com1 Dec 202312 Sep 20241 Dec 2027
38renfrewshire.clubNameCheap, Inc.2 Mar 20175 Apr 20171 Mar 2018
39renfrewcalgaryhomes.comGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2015
40renfrewukegroup.caTucows Domains Inc.24 Jan 201316 Jan 201524 Jan 2016
41renfrewglen.comXin Net Technology Corporation29 Jun 201916 Nov 201929 Jun 2020
42renfrewvalleyinn.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Apr 200628 Dec 20166 Apr 2019
43renfrewshire.netDynadot, LLC22 Jun 199811 Jul 201721 Jun 2018
44renfrewshire.infoGoDaddy.com, LLC7 Aug 20238 Aug 20257 Aug 2026
45renfrewlanark.comGoDaddy.com, LLC5 Sep 20086 Sep 20245 Sep 2025
46renfrewmuseum.orgTucows Domains Inc.10 Jan 20048 Jan 202510 Jan 2026
47renfrewshireit.bizTucows Domains Inc.21 Aug 201324 Aug 201420 Aug 2014
48renfrewchristianschool.comDynadot, LLC10 Nov 201410 Nov 201410 Nov 2015
49renfrewchiropractic.comTucows Domains Inc.15 Aug 201431 Jul 202515 Aug 2026
50renfrewhouseforsale.comeNom, Inc.14 Nov 201414 Nov 201414 Nov 2015
51renfrewhomeforsale.comeNom, Inc.14 Nov 201414 Nov 201414 Nov 2015
52renfrewmilano.comTucows Domains Inc.28 Aug 20131 Sep 201428 Aug 2015
53renfrewtoday.comeNom, Inc.16 Feb 201615 Feb 202516 Feb 2026
54renfrewchiropractors.com1API GmbH6 Sep 201419 Aug 20246 Sep 2025
55renfrewshirecoaching.comGoDaddy.com, LLC2 Oct 20143 Oct 20162 Oct 2018
56renfrewframing.comWebfusion Ltd.22 Sep 201415 Sep 201722 Sep 2018
57renfrewparanormalinvestigators.comTucows Domains Inc.20 Sep 201123 Sep 201420 Sep 2015
58renfrewautoglass.com1API GmbH24 Sep 201425 Sep 202424 Sep 2025
59renfrewcalgary.comGoDaddy.com, LLC8 Mar 201831 Mar 20258 Mar 2026
60renfrewshirerising.orgMesh Digital Limited16 Oct 20148 Oct 201716 Oct 2018
61renfrewshirecarers.comDomainTact LLC29 Dec 201430 Dec 201629 Dec 2017
62renfrewshirelibraries.orgMesh Digital Limited15 Oct 201415 Oct 201415 Oct 2016
63renfrewshirefoodbank.orgGoDaddy.com, LLC29 Nov 201429 Nov 201429 Nov 2015
64renfrewshiressp.infoGoDaddy.com, LLC1 Dec 20141 Dec 20141 Dec 2015
65renfrewshirerocks.comTucows Domains Inc.18 Dec 201222 Dec 201418 Dec 2015
66renfrewunifiedtreatmentmodel.comGoDaddy.com, LLC23 Dec 201417 Sep 202223 Dec 2025
67renfrewcountywatcheast.comLaunchpad, Inc.23 Dec 201423 Dec 201423 Dec 2015
68renfrewcenters.bizGoDaddy.com, LLC23 Dec 201426 Jun 202422 Dec 2025
69renfrewunifiedtreatmentmodel.infoGoDaddy.com, LLC23 Dec 20146 Jul 202423 Dec 2025
70renfrewcenters.infoGoDaddy.com, LLC23 Dec 20146 Jul 202423 Dec 2025
71renfrewunifiedtreatmentmodel.orgGoDaddy.com, LLC23 Dec 20147 Jul 202423 Dec 2025
72renfrewunifiedtreatmentmodel.netGoDaddy.com, LLC23 Dec 201417 Sep 202223 Dec 2025
73renfrewcenters.orgGoDaddy.com, LLC23 Dec 20147 Jul 202423 Dec 2025
74renfrewcenters.netGoDaddy.com, LLC23 Dec 201417 Sep 202223 Dec 2025
75renfrewbaptistchurch.comNamesilo, LLC26 Dec 200531 Dec 202426 Dec 2025
76renfrewshirecouncilsnp.com1&1 Internet AG2 Jan 20153 Jan 20172 Jan 2018
77renfrewshire.tradeAlpnames Limited22 Oct 201422 Oct 201421 Oct 2015
78renfrewshire.scienceAlpnames Limited24 Feb 201525 Apr 201523 Feb 2016
79renfrewcommunitymarket.orgFastDomain Inc.10 Jan 201510 Jan 201510 Jan 2016
80renfrewinsurancecalgary.websiteAlpnames Limited26 Jun 201526 Jun 201526 Jun 2016
81renfrewshire.reviewAlpnames Limited2 Jul 2015-1 Jul 2016
82renfrewshire.faithAlpnames Limited2 Jul 2015-1 Jul 2016
83renfrewshire.dateAlpnames Limited2 Jul 2015-1 Jul 2016
84renfrewcountyesplocal.websiteeNom, Inc.2 Jul 20153 Jul 20172 Jul 2018
85renfrewhotels.reviewAlpnames Limited4 Jul 2015-3 Jul 2016
86renfrewshiresouthsnpmsp.scotTucows Domains Inc.13 Jul 201513 Jul 201513 Jul 2016
87renfrew-pontiacalcoholicsanonymous.orgFastDomain Inc.2 Feb 201519 Jan 20172 Feb 2018
88renfrew-houses-condos.comRegister.ca Inc.9 Feb 201113 Feb 20159 Feb 2016
89renfrew-heights-houses-condos.comRegister.ca Inc.9 Feb 201113 Feb 20159 Feb 2016
90renfrewshire.loanAlpnames Limited22 Aug 2015-21 Aug 2016
91renfrewmedicalgroup.comTucows Domains Inc.19 Feb 201523 Feb 201619 Feb 2017
92renfrewnews.comTurnCommerce, Inc. DBA NameBright.com10 Nov 20234 Nov 202410 Nov 2025
93renfrew-chrysler.netWebnames.ca Inc.2 Mar 20154 Jun 20172 Mar 2018
94renfrew-opendi.comKey-Systems GmbH11 Mar 201511 Mar 201511 Mar 2016
95renfrewontario.comTucows Domains Inc.16 Mar 19983 Mar 202215 Mar 2027
96renfrewwindowcleaning.comWild West Domains, LLC27 Mar 20159 May 202527 Mar 2026
97renfrewbowlingclub.comTucows Domains Inc.3 Apr 201514 Jun 20233 Apr 2023
98renfrewheightsrealtor.comGoDaddy.com, LLC4 Apr 20154 Apr 20154 Apr 2016
99renfrewymca.comGoogle, Inc.14 Aug 202030 Jul 202514 Aug 2026
100renfrewbusinessgroupinc.comEranet International Limited8 Jul 202419 Jul 20258 Jul 2025
101renfrewcountymediation.comName.com, Inc.21 Apr 201511 Apr 201721 Apr 2018
102renfrewcountymediation.netName.com, Inc.21 Apr 201511 Apr 201721 Apr 2018
103renfrewcountymediation.orgName.com, Inc.21 Apr 201511 Apr 201721 Apr 2018
104renfrewdrteam.comTucows Domains Inc.21 Apr 201425 Apr 201521 Apr 2016
105renfrewfleamarket.comGoDaddy.com, LLC26 Apr 201526 Apr 201526 Apr 2016
106renfrewflags.comGoDaddy.com, LLC26 Apr 201526 Apr 201526 Apr 2016
107renfrewco.comBizcn.com, Inc.15 Jul 202116 Jul 202115 Jul 2022
108renfrewshiremums.comTucows Domains Inc.7 Sep 201111 Sep 20157 Sep 2016
109renfrewnorth.netGoDaddy.com, LLC8 May 20158 May 20158 May 2016
110renfrewnorth.infoGoDaddy.com, LLC8 May 2015-8 May 2016
111renfrewrealestatetx.comTucows Domains Inc.16 May 201217 Apr 202516 May 2026
112renfrewshire-executive-mpv.comGoDaddy.com, LLC30 May 201530 May 201530 May 2017
113renfrewshireluxurympvs.comGoDaddy.com, LLC1 Jun 20151 Jun 20151 Jun 2016
114renfrewshireluxurympv.comGoDaddy.com, LLC1 Jun 20151 Jun 20151 Jun 2016
115renfrewrocks.comGoDaddy.com, LLC7 Jun 20157 Jun 20157 Jun 2016
116renfrewinc.comGoDaddy.com, LLC17 Jun 201517 Jun 201517 Jun 2017
117renfrewvictoriahospital.comeNom, Inc.28 Jun 201528 Jun 201528 Jun 2016
118renfrewapparel.comGoDaddy.com, LLC10 Jul 201510 Jul 201510 Jul 2016
119renfrewfurs.com-17 Dec 202218 Dec 202317 Dec 2024
120renfrewhospice.comTucows Domains Inc.8 Feb 20172 May 20238 Feb 2027
121renfrewriverside.comMedia Elite Holdings Limited5 Mar 20215 Mar 20215 Mar 2022
122renfrewlawfirm.comGoDaddy.com, LLC2 Oct 20152 Oct 20152 Oct 2016
123renfrewshireskiphire.scotTucows Domains Inc.30 Sep 20144 Oct 201730 Sep 2017
124renfrewcf.comNetwork Solutions, LLC13 Oct 201515 Jun 202413 Oct 2025
125renfrewbungalow.comGoDaddy.com, LLC14 Oct 201514 Oct 201514 Oct 2016
126renfrewmedicine.comNetwork Solutions, LLC21 Oct 201521 Sep 202421 Oct 2025
127renfrewshireafterschoolcare.comGoDaddy.com, LLC21 Oct 201521 Oct 201521 Oct 2016
128renfrewroofing.comeNom, Inc.29 Oct 201528 Sep 201829 Oct 2019
129renfrewshirewidecreditunion.comWebfusion Ltd.5 Nov 201529 Aug 20165 Nov 2017
130renfrewdebtadvice.comGoDaddy.com, LLC5 Nov 20157 May 20245 Nov 2025
131renfrewreenactment.comGoDaddy.com, LLC14 Nov 20157 Jan 201914 Nov 2019
132renfrewpizzaria.com1API GmbH17 Nov 201518 Nov 202417 Nov 2025
133renfrewshire.accountantTucows Domains Inc.19 Nov 201527 Oct 202418 Nov 2025
134renfrewknight.comRegister.it SPA30 Nov 20154 Nov 202030 Nov 2025
135renfrewconference2011.org1API GmbH1 Dec 20151 Dec 20151 Dec 2016
136renfrewtrappertape.comNetwork Solutions, LLC1 Dec 20152 Oct 20241 Dec 2027
137renfrewgolf.com1API GmbH5 Dec 20003 Oct 20245 Dec 2025
138renfrewhighschool.comWebfusion Ltd.22 Dec 201519 Apr 202122 Dec 2025
139renfrewshirepcrepairs.comeNom, Inc.3 Jan 20163 Jan 20163 Jan 2017
140renfrewchrysler.ca-20 Aug 200221 Aug 202520 Aug 2026
141renfrewshirenews.comUniregistrar Corp11 Apr 202023 Jun 202311 Apr 2023
142renfrew2nd.comGoDaddy.com, LLC26 Jan 201626 Jan 201626 Jan 2017
143renfrewchamber.comGoogle, Inc.4 Feb 20162 Mar 202517 Mar 2026
144renfrewshire.landTucows Domains Inc.19 Feb 201423 Feb 201619 Feb 2017
145renfrewhydro.comGoDaddy.com, LLC15 Mar 200120 Mar 202515 Mar 2026
146renfrewshiremusictuition.onlineeNom, Inc.25 Mar 201625 Mar 201625 Mar 2017
147renfrewshirecarers.org.uk-1 Dec 20111 Dec 20231 Dec 2025
148renfrewcommunitycouncil.orgregister.com, Inc.5 Apr 201613 Jul 20165 Apr 2018
149renfrewconcreteworks.comSibername Internet and Software Technologies Inc.5 Apr 201321 May 20255 Apr 2026
150renfrewshire.comGoDaddy.com, LLC24 Jul 200413 Jul 202524 Jul 2026
151renfrewglobal.comDynadot, LLC2 May 20162 May 20162 May 2017
152renfrewbros.com-3 May 20163 May 20163 May 2017
153renfrewgolfclub.netTucows Domains Inc.1 Jun 20092 May 20231 Jun 2028
154renfrewoptics.comeNom, Inc.23 May 201623 May 201623 May 2017
155renfrewoptical.comeNom, Inc.23 May 201623 May 201623 May 2017
156renfrewcarbreakers.comGMO Internet Inc.9 Dec 20249 Dec 20249 Dec 2025
157renfrewpartworntyres.comWebfusion Ltd.27 May 201627 May 201627 May 2018
158renfrewrealty.comregister.com, Inc.29 Mar 201929 Mar 201929 Mar 2022
159renfrewheightsliving.comGoDaddy.com, LLC16 Jun 201616 Jun 201616 Jun 2017
160renfrewcountyhomeschool.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Jun 201623 Jul 201717 Jun 2018
161renfrewrealtors.comregister.com, Inc.29 Mar 201929 Mar 201929 Mar 2022
162renfreweducation.orgNetwork Solutions, LLC14 Jul 199814 Jul 202113 Jul 2031
163renfrewshirelawyers.comTucows Domains Inc.26 Jun 200626 Jun 200626 Jun 2017
164renfrewbc.comeNom, Inc.29 Jun 201629 Jun 201629 Jun 2017
165renfrewmortgages.comWild West Domains, LLC24 Sep 201225 Sep 202424 Sep 2025
166renfrewshire-property.netTucows Domains Inc.4 Jul 20024 Jul 20024 Jul 2017
167renfrewbmx.comPromo People inc.8 Jul 20161 Jul 20248 Jul 2026
168renfrewtape.bizNetwork Solutions, LLC27 Mar 20067 Nov 202426 Mar 2029
169renfrewolympics.comGoDaddy.com, LLC17 Jul 201617 Jul 201617 Jul 2018
170renfrewshire-finest.com-21 Jul 201621 Jul 201621 Jul 2017
171renfrewchrysler.netGoDaddy.com, LLC10 Oct 200912 Jan 202510 Oct 2030
172renfrewskatingclub.comTucows Domains Inc.31 Jul 20164 Aug 201831 Jul 2018
173renfrewtandoori.comGoDaddy.com, LLC14 Jun 202215 Jun 202414 Jun 2026
174renfrewlandowners.com-9 Sep 20169 Sep 20169 Sep 2017
175renfrewbadminton.comAscio Technologies, Inc. Danmark - Filial af Ascio…8 Sep 20169 Sep 20178 Sep 2018
176renfrewgolfclub.comGoDaddy.com, LLC3 Aug 20203 Aug 20203 Aug 2021
177renfrewkoa.comNetwork Solutions, LLC24 Feb 200426 Dec 202124 Feb 2027
178renfrewfineart.comNetwork Solutions, LLC28 Jul 200929 May 201628 Jul 2017
179renfrewshire2013.comRegister.it SPA31 Jan 201431 Jan 201431 Jan 2017
180renfrewshiresportsnetwork.comGoDaddy.com, LLC5 Jun 200919 May 20165 Jun 2017
181renfrewglass.comTucows Domains Inc.15 Nov 201115 Nov 202415 Nov 2025
182renfrewmercury.comUniregistrar Corp---
183renfrew96hoursale.comFastDomain Inc.29 Feb 20123 Mar 201728 Feb 2017
184renfrewre.comGoDaddy.com, LLC18 Aug 200924 Aug 202518 Aug 2027
185renfrewshirecabco-online.comDynamic Network Services, Inc.26 Oct 201215 Oct 201826 Oct 2019
186renfrewhockeytape.comNetwork Solutions, LLC4 Nov 19995 Sep 20224 Nov 2025
187renfrewmuseum.comTucows Domains Inc.18 Jul 200130 Apr 202518 Jul 2028
188renfrewpac.comeNom, Inc.21 Aug 201321 Jul 201921 Aug 2020
189renfrewpawn.comVitalwerks Internet Solutions, LLC DBA No-IP11 Feb 201418 Feb 202212 Feb 2024
190renfrews.comDomain.com, LLC14 Jan 20029 Jul 202514 Jan 2026
191renfrewinsuranceagency.comeNom, Inc.2 Feb 200724 Jan 20252 Feb 2026
192renfrewshirevets.comInternetters Limited15 Aug 201115 Sep 201515 Aug 2016
193renfrew-realestate.comNetwork Solutions, LLC16 Jul 199720 Dec 202315 Jul 2026
194renfrewselfstorage.com1API GmbH14 Oct 20113 Oct 202414 Oct 2025
195renfrewclearout.comFastDomain Inc.29 Aug 201228 Jun 201629 Aug 2016
196renfrewcomputers.comGoDaddy.com, LLC21 Oct 201321 Oct 201521 Oct 2017
197renfrewtinytots.comeName Technology Co., Ltd.7 Nov 20207 Nov 20207 Nov 2021
198renfrewartguild.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…1 Apr 20239 May 20241 Apr 2024
199renfrewsoccer.comSibername Internet and Software Technologies Inc.19 Mar 20025 May 202519 Mar 2026
200renfrewlive.comName.com, Inc.18 Jan 201316 Jan 202518 Jan 2026
201renfrewcountyartists.comTucows Domains Inc.28 Jul 20121 Aug 201728 Jul 2017
202renfrewkendodojo.comTucows Domains Inc.12 Mar 200825 Apr 202512 Mar 2026
203renfrewmarine.comGoDaddy.com, LLC27 Oct 20038 Jan 202527 Oct 2024
204renfrewtoyota.comGoDaddy.com, LLC19 May 201020 May 202519 May 2026
205renfrewcenters.comEnom5, Inc.9 Apr 201812 Feb 20259 Apr 2026
206renfrewshirebootcamp.comWebfusion Ltd.18 Jan 201216 Jan 201618 Jan 2018
207renfrewbank.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.6 Jul 19997 Jul 20256 Jul 2026
208renfrewontheweb.comTucows Domains Inc.21 Nov 20082 Nov 201521 Nov 2016
209renfrewconference.comFastDomain Inc.27 Apr 201216 Apr 202527 Apr 2026
210renfrewshire2023.comGMO Internet Inc.21 Apr 20222 Jul 202321 Apr 2023
211renfrewathletics.comNetwork Solutions, LLC12 Jun 200213 Apr 202312 Jun 2026
212renfrewconsulting.comeNom, Inc.8 Nov 200925 Oct 20178 Nov 2018
213renfrewcountyrollerderby.comFastDomain Inc.7 Sep 201213 Oct 20217 Sep 2021
214renfrewanderskinegazette.comRegister.it SPA14 May 200913 Jan 201527 Jan 2017
215renfrewshirehotels.comDomain.com, LLC5 Jan 200321 Dec 20165 Jan 2018
216renfrewshirebusiness.com1API GmbH11 Jul 201125 Jun 201511 Jul 2017
217renfrewshireskiphire.comTucows Domains Inc.1 Mar 20117 Apr 20171 Mar 2018
218renfrewfiatfirstbigdealevent.comDomain.com, LLC24 Jan 20149 Jan 201624 Jan 2017
219renfrewrealestate.comTurnCommerce, Inc. DBA NameBright.com27 Nov 201321 Nov 202027 Nov 2025
220renfrewbigdeals.comFastDomain Inc.7 Feb 201223 Jan 20167 Feb 2017
221renfrewinsurance.comGandi SAS10 May 20109 Apr 202510 May 2026
222renfrewductcleaning.comGoDaddy.com, LLC23 Jan 201324 Jan 202523 Jan 2026
223renfrewresistors.comGoDaddy.com, LLC7 Oct 20108 Oct 20157 Oct 2016
224renfrewlistings.comGoDaddy.com, LLC16 Jan 201321 Nov 201416 Jan 2017
225renfrewlaw.comNetwork Solutions, LLC24 Jul 199627 Feb 202323 Jul 2027
226renfrewchryslerjeepdodgeram.comGoDaddy.com, LLC24 May 201327 Mar 202524 May 2026
227renfrewhouse.comDomainnovations, Inc.25 Mar 202229 Mar 202325 Mar 2024
228renfrewchurch.comGoDaddy.com, LLC8 Oct 201214 Jan 20258 Oct 2026
229renfrewrecycle.comBeijing Lanhai Jiye Technology Co., Ltd25 Mar 202227 May 202325 Mar 2023
230renfrewcalvarypentecostal.comTucows Domains Inc.25 Aug 202425 Aug 202425 Aug 2025
231renfrewshirecouncil.comCSL Computer Service Langenbach GmbH d/b/a joker.c…28 Feb 20041 Jan 202528 Feb 2026
232renfrewhomesforsale.comGoDaddy.com, LLC24 Jul 202524 Jul 202524 Jul 2026
233renfrewtape.comNetwork Solutions, LLC19 Jun 200120 Apr 202319 Jun 2026
234renfrewelectric.comTucows Domains Inc.7 May 199812 May 20256 May 2026
235renfrewchryslerrewards.comDomain.com, LLC28 Jan 20143 Feb 201728 Jan 2018
236renfrewfiat.comTucows Domains Inc.16 Sep 200920 Sep 201716 Sep 2017
237renfrewfarmersmarket.comNameCheap, Inc.22 Jan 20144 Apr 202422 Jan 2026
238renfrewcountywends.comDropCatch.com 698 LLC13 Apr 201713 Apr 201713 Apr 2018
239renfrewfamily.comGoDaddy.com, LLC12 Feb 201813 Feb 202412 Feb 2026
240renfrewhouses.comGoDaddy.com, LLC15 Mar 200716 Mar 201615 Mar 2017
241renfrewcountyrealestateboard.comGoDaddy.com, LLC14 May 201315 May 202514 May 2026
242renfrewditti.comGoDaddy.com, LLC4 Feb 201322 Feb 20154 Feb 2017
243renfrew-insurance.comCSC Corporate Domains, Inc.22 Nov 199617 Nov 202421 Nov 2025
244renfrewpacific.comGoDaddy.com, LLC3 Nov 20084 Aug 20253 Nov 2025
245renfrewcc.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Sep 200524 Oct 202217 Sep 2027
246renfrewfair.comGoDaddy.com, LLC9 May 200110 May 20259 May 2026
247renfrewcountyrealestate.comAmazon Registrar, Inc.7 Feb 20143 Jan 20257 Feb 2026
248renfrew724locksmith.comGoDaddy.com, LLC16 Mar 201122 Jun 201616 Mar 2017
249renfrewmillionaires.comRebel.com Corp.24 Mar 20128 Feb 202524 Mar 2026
250renfrewmotors.comMelbourne IT, Ltd23 May 20143 Jul 202423 May 2024
251renfrewgallery.comNetwork Solutions, LLC28 Jul 200929 May 201628 Jul 2017
252renfrewthisweek.comTucows Domains Inc.22 Aug 200724 Apr 201522 Aug 2016
253renfrew-criminal-lawyer.comGoDaddy.com, LLC1 Jun 20082 Feb 20252 Feb 2027
254renfrewshirecemeteries.com1&1 Internet AG14 Oct 200815 Oct 201614 Oct 2018
255renfrewchryslerpaymentmatch.comDomain.com, LLC11 Apr 201327 Mar 201611 Apr 2017
256renfrewtennis.comSibername Internet and Software Technologies Inc.3 Apr 201421 May 20253 Apr 2026
257renfrewmobilephonerepair.comGoDaddy.com, LLC21 Oct 201321 Oct 201521 Oct 2016
258renfrewsupport.comGoDaddy.com, LLC19 Nov 201219 Nov 201219 Nov 2022
259renfrewhomehardware.comNameCheap, Inc.2 May 20061 May 20252 May 2026
260renfrewshirephysio.comWebfusion Ltd.6 Nov 20087 Nov 20246 Nov 2025
261renfrewshiresound.comNameCheap, Inc.6 Oct 20035 Oct 20246 Oct 2025
262renfrewcentre.comGoDaddy.com, LLC25 Nov 201626 Nov 202425 Nov 2025
263renfrewchrysler.comGoDaddy.com, LLC1 Dec 199812 Jan 202530 Nov 2030
264renfrew-criminal-lawyers.comGoDaddy.com, LLC1 Jun 20082 Feb 20252 Feb 2027
265renfrewcollingwoodcommunitynews.comWild West Domains, LLC23 Nov 201223 Oct 202423 Nov 2025
266renfrewshirechamber.comeNom, Inc.7 Sep 20002 Sep 20247 Sep 2025
267renfrewpaymentmatch.comDomain.com, LLC25 Sep 201310 Sep 201625 Sep 2017
268renfrewlawyer.comRebel.com Corp.16 Sep 20132 Aug 202416 Sep 2025
269renfrewcentral.comregister.com, Inc.3 Apr 200130 Mar 20253 Apr 2026
270renfrewcountywelcomesyou.comRebel.com Corp.31 Oct 201315 Sep 202431 Oct 2025
271renfrewhosp.com1API GmbH5 Oct 19996 Oct 20245 Oct 2025
272renfrewtrucking.comGoDaddy.com, LLC14 Jun 200928 Jul 202514 Jun 2026
273renfrew-tape.comWebfusion Ltd.16 Apr 20149 Apr 201616 Apr 2018
274renfrewcountyconnections.comGoDaddy.com, LLC5 Jan 20245 Nov 20245 Jan 2026
275renfrewprojectservices.com1&1 Internet AG1 May 20122 May 20161 May 2018
276renfrewcounty.comGoDaddy.com, LLC28 Jun 20078 Jun 202528 Jun 2026
277renfrewvancouver.comGoDaddy.com, LLC1 Apr 20132 Apr 20161 Apr 2017
278renfrew-scotland.comDomain.com, LLC10 Nov 200426 Oct 201710 Nov 2018
279renfrewmortgage.comWild West Domains, LLC4 Apr 20135 Apr 20254 Apr 2026
280renfrewhomeprices.comGoDaddy.com, LLC16 Jan 201321 Nov 201416 Jan 2017
281renfrewcountyjobs.comGoDaddy.com, LLC18 Sep 201819 Sep 202318 Sep 2025
282renfrewchryslerinc.comWebnames.ca Inc.23 Jul 20099 Aug 201623 Jul 2017
283renfrewcountyplowmen.comGMO Internet Inc.9 Apr 20137 Feb 20178 Apr 2018
284renfrewstrength.comGoDaddy.com, LLC9 Apr 20149 Apr 20259 Apr 2026
285renfrewhighdrama.comregister.com, Inc.2 Oct 201217 Sep 20162 Oct 2018
286renfrewcricketclub.comEasyspace LTD15 Apr 200816 Mar 202515 Apr 2026
287renfrewmassagetherapy.comPromo People inc.30 Apr 201212 Sep 202430 Apr 2026
288renfrewfigureskatingclub.comGoDaddy.com, LLC11 Mar 201312 Mar 201611 Mar 2017
289renfrewandassociates.comeNom, Inc.4 Jan 20136 Dec 20164 Jan 2018
290renfrewalfaromeo.comTucows Domains Inc.17 Dec 201021 Dec 201617 Dec 2016
291renfrewlanarkcareers.comGoDaddy.com, LLC15 Mar 20128 Mar 201615 Mar 2017
292renfrewheights.comPromo People inc.15 Sep 20208 Sep 202415 Sep 2025
293renfrewshireastro.com1&1 Internet AG15 Aug 200718 Mar 201815 Aug 2026
294renfrewcarspares.comWebfusion Ltd.21 Feb 201422 Feb 202521 Feb 2026
295renfrewknights1916.comGoDaddy.com, LLC23 Oct 201217 Aug 201623 Oct 2018
296renfrewcountyinsulation.comGoDaddy.com, LLC14 Sep 201218 Sep 201614 Sep 2016
297renfrewattorney.comRebel.com Corp.16 Sep 20132 Aug 202516 Sep 2026
298renfrewsigfaults.com1&1 Internet AG8 Oct 20129 Feb 20178 Oct 2018
299renfrewshireleisure.com1&1 Internet AG12 Nov 200313 Nov 202412 Nov 2025
300renfrewgroup.comNetwork Solutions, LLC17 Mar 199819 Sep 202416 Mar 2029
301renfrewbusinessgroup.comWebnames.ca Inc.24 May 20138 May 202524 May 2026
302renfrewcollingwood.comGoDaddy.com, LLC2 Oct 201629 Oct 20242 Oct 2025
303renfrew-content.oneInterNetworX Ltd. & Co. KG7 Oct 201621 Nov 20177 Oct 2018
304renfrewshirehistory.infoNameCheap, Inc.18 May 202118 May 202118 May 2022
305renfrewbusinessvaluationandappraisal.infoGoDaddy.com, LLC19 Jun 201120 Jun 201719 Jun 2018
306renfrewshirelibraries.infoXin Net Technology Corporation12 Dec 201612 Dec 201712 Dec 2018
307renfrewtape.infoNetwork Solutions, LLC27 Mar 20067 Nov 202427 Mar 2029
308renfrewconversation.com-16 Oct 201616 Oct 201616 Oct 2017
309renfrewcarbreakers.netTucows Domains Inc.25 Mar 201429 Mar 201725 Mar 2017
310renfrewtape.netNetwork Solutions, LLC27 Mar 200627 Jan 202427 Mar 2029
311renfrewshirerefreshments.com-21 Oct 201621 Oct 201621 Oct 2017
312renfrewlegalclinic.org1API GmbH18 Feb 200517 Feb 202518 Feb 2026
313renfrewsupport.orgBeijing Lanhai Jiye Technology Co., Ltd30 Apr 202330 Apr 202430 Apr 2025
314renfrewsnp.orgeNom, Inc.6 Nov 200624 Oct 20176 Nov 2018
315renfrewsconline.orgGoDaddy.com, LLC7 Jan 20118 Jan 20167 Jan 2017
316renfrewcenter.orgApril Sea Information Technology Corporation3 Mar 200529 Apr 20253 Mar 2026
317renfrewtkmc.orgTucows Domains Inc.17 Apr 201427 Jun 202517 Apr 2025
318renfrewpresbytery.orgGo Australia Domains, LLC24 Nov 201323 Oct 201724 Nov 2018
319renfrewshire.orgeNom, Inc.4 Jul 200316 Jul 20174 Jul 2018
320renfrewshireswcpd.orgNetwork Solutions, LLC12 Oct 20072 Oct 202412 Oct 2025
321renfrewinstitute.orgTucows Domains Inc.21 Sep 200431 Aug 202421 Sep 2025
322renfrewconference.orgFastDomain Inc.27 Apr 201221 Apr 202527 Apr 2026
323renfrewcountymuseums.orgGoDaddy.com, LLC11 Apr 201226 May 202511 Apr 2026
324renfrewtape.orgNetwork Solutions, LLC27 Mar 20067 Nov 202427 Mar 2029
325renfrewcounty.info1&1 Internet AG22 Oct 201622 Oct 201922 Oct 2020
326renfrewminorhockey.ca-16 Oct 20033 Oct 202416 Oct 2025
327renfrewbaptist.ca-17 Feb 200514 Feb 201817 Feb 2019
328renfrewmuseum.ca-17 Aug 20011 Aug 202516 Aug 2026
329renfrewcounty.caInfoBack Corporation26 Nov 200225 Nov 201726 Nov 2018
330renfrewcommunity.ca-10 Jul 200126 Aug 201710 Jul 2021
331renfrewfurs.ca-29 Nov 202229 Nov 202329 Nov 2024
332renfrewareachamber.ca-31 Jul 200814 Jul 202531 Jul 2026
333renfrewcountyaddictiontreatment.ca-20 Jan 20066 Mar 202520 Jan 2026
334renfrewareahealthvillage.ca-28 Jan 20114 Aug 202528 Jan 2026
335renfrewcountycpan.ca-4 Nov 200620 Jan 20243 Nov 2025
336renfrewdentalstudio.co.uk-3 Sep 201226 Jul 20243 Sep 2032
337renfrewshirepubs.co.uk-12 Jan 201113 Dec 201612 Jan 2019
338renfrewshirecabco.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…18 Sep 20082 Apr 201718 Sep 2019
339renfrewfc.co.uk-31 Mar 20022 May 201831 Mar 2019
340renfrewshirechamber.co.uk-22 Feb 200721 Apr 201722 Feb 2019
341renfrewshirelibdems.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…6 Apr 200730 Mar 20166 Apr 2019
342renfrewshirefhs.co.uk-24 Jan 20069 Jan 201424 Jan 2019
343renfrewshirewomensaid.co.uk-11 Jul 200519 Jun 201711 Jul 2018
344renfrewshirelieutenancy.org.uk-6 Oct 20107 Sep 20166 Oct 2018
345renfrewshiregolfunion.co.uk-15 Apr 200427 Mar 201715 Apr 2019
346renfrewfuneralservice.comTucows Domains Inc.1 Nov 20162 Oct 20211 Nov 2026
347renfrewcoaching.comGoDaddy.com, LLC23 Nov 20164 Feb 202523 Nov 2024
348renfrewprotape.comNetwork Solutions, LLC2 Dec 20163 Oct 20242 Dec 2026
349renfrewhockey.comNetwork Solutions, LLC2 Dec 20163 Oct 20242 Dec 2026
350renfrewprowax.comNetwork Solutions, LLC2 Dec 20163 Oct 20242 Dec 2026
351renfrewfeelthegame.comNetwork Solutions, LLC2 Dec 20163 Oct 20242 Dec 2026
352renfrewradio.orgMesh Digital Limited6 Dec 20165 Feb 20176 Dec 2018
353renfrewbusinesstraining.comTucows Domains Inc.11 Jan 201715 Jan 202011 Jan 2020
354renfrewhotel.comDropCatch.com 723 LLC26 Mar 201812 Mar 202026 Mar 2026
355renfreweducation.comNameCheap, Inc.22 Jun 202323 Jun 202422 Jun 2025
356renfrewbrewing.comRebel.com Corp.17 Jan 20172 Dec 201717 Jan 2019
357renfrewshire.onlineTucows Domains Inc.25 Sep 202029 Sep 202125 Sep 2022
358renfrewbrewingcompany.comRebel.com Corp.15 Feb 201731 Dec 201715 Feb 2019
359renfrewconstruction.co.ukReserved31 Aug 201624 Jan 201731 Aug 2017
360renfrewtrinity.orgHosting Concepts B.V. dba Openprovider10 Mar 201725 Jul 202510 Mar 2027
361renfrewshiresportsawards.comXin Net Technology Corporation26 Jun 202326 Aug 202426 Jun 2024
362renfrewcountytourism.comCommuniGal Communication Ltd.3 May 20119 Mar 20173 May 2017
363renfrewshireleisure.co.uk-22 Jul 200617 Jul 201622 Jul 2018
364renfrewshire-england.winAlpnames Limited17 Mar 2017-16 Mar 2018
365renfrewchrysler.infoGoDaddy.com, LLC20 Mar 201719 May 201720 Mar 2018
366renfrewshiredyw.comGoDaddy.com, LLC22 Mar 201722 Mar 201722 Mar 2020
367renfrewshire-windows.co.uk-18 Dec 200031 Jan 201718 Dec 2017
368renfrewkchomes.comGoDaddy.com, LLC13 Apr 201713 Apr 201713 Apr 2018
369renfrewcentre.ca-8 Sep 20169 Aug 20258 Sep 2026
370renfrewcreative.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…14 Dec 20157 Dec 201714 Dec 2019
371renfrewgroup.coNetwork Solutions, LLC16 May 201217 Mar 201515 May 2018
372renfrewshire24.co.uk-6 Feb 201522 Jan 20256 Feb 2026
373renfrewrealestatebroker.ca-4 Nov 201530 Oct 20174 Nov 2018
374renfrewhomeinspection.comGoDaddy.com, LLC19 Apr 201719 Apr 201719 Apr 2019
375renfrewpropertybuyers.comGoDaddy.com, LLC23 Apr 20174 Jul 202423 Apr 2024
376renfrewmovers.comPromo People inc.29 Apr 201722 Apr 202529 Apr 2026
377renfrewshirecouncil.scotMesh Digital Limited10 May 2017-10 May 2022
378renfrewshire-council.scotMesh Digital Limited10 May 2017-10 May 2022
379renfrewshire.scotMesh Digital Limited10 May 2017-10 May 2022
380renfrewheatingandcooling.comGoDaddy.com, LLC13 Feb 202416 Jan 202513 Feb 2026
381renfrewprohockeytape.comNetwork Solutions, LLC16 May 201717 Mar 202316 May 2026
382renfrewhighenglish.comMesh Digital Limited18 May 201722 May 201718 May 2018
383renfrewshirebn.comWebfusion Ltd.7 Jun 20177 Jun 20177 Jun 2018
384renfrewelectriccanada.comGandi SAS8 Jun 20178 Jun 20178 Jun 2018
385renfrewcountycarseats.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Jun 201719 Aug 201719 Jun 2018
386renfrewmarine.ca-1 Mar 200615 Apr 20251 Mar 2026
387renfrewtilecleaning.comGoDaddy.com, LLC28 Jun 201728 Jun 201728 Jun 2018
388renfrewdelivery.comDomain.com, LLC21 Jul 201722 Jun 202521 Jul 2026
389renfrewshirehomebuyers.comWebfusion Ltd.26 Feb 202313 Mar 202326 Feb 2027
390renfrewpro.comNetwork Solutions, LLC3 Aug 20174 Jun 20253 Aug 2027
391renfrewshireaccountancy.com1&1 Internet AG9 Aug 20179 Aug 20179 Aug 2018
392renfrewshireaccountancy.tax1&1 Internet AG9 Aug 20179 Aug 20179 Aug 2018
393renfreweducation.netNetwork Solutions, LLC11 Aug 201711 Aug 201711 Aug 2018
394renfrewshireboxing.com1&1 Internet AG21 Aug 201727 Nov 201821 Aug 2026
395renfrewshire.cabMesh Digital Limited30 Sep 201614 Nov 202430 Sep 2026
396renfrewshire.digitalGoDaddy.com, LLC11 Sep 201711 Sep 201711 Sep 2018
397renfrewshirecoin.comMegazone Corp., dba HOSTING.KR8 Oct 201712 Nov 20188 Oct 2019
398renfrewphysiotherapy.comTucows Domains Inc.12 Oct 20176 Dec 202412 Oct 2025
399renfrewtandoori.co.uk-23 Oct 202423 Oct 202423 Oct 2025
400renfrewshirepropertybuyers.netMesh Digital Limited5 Nov 20175 Nov 20175 Nov 2018
401renfrewcountytherapy.comSibername Internet and Software Technologies Inc.5 Nov 20175 Nov 20175 Nov 2018
402renfrewshirepropertybuyers.comNameCheap, Inc.21 Feb 202227 Feb 202321 Feb 2025
403renfrewshirehousebuyers.comRegister.it SPA13 Nov 201713 Nov 201713 Nov 2018
404renfrewchessclub.com1&1 Internet AG24 Nov 201724 Nov 202424 Nov 2025
405renfrewshirechessclub.com1&1 Internet AG14 Dec 202315 Dec 202414 Dec 2025
406renfrewshirecemeteries.co.ukReserved14 Oct 200813 Oct 201614 Oct 2018
407renfrewsteam.comGoDaddy.com, LLC13 Jan 202114 Jan 202513 Jan 2027
408renfrewconversation.co.uk-17 Jul 201618 Jul 202517 Jul 2026
409renfreweyeclinic.comGoogle, Inc.6 Dec 201721 Nov 20246 Dec 2025
410renfrewbjj.comDomain.com, LLC5 Dec 201724 Jun 20255 Dec 2025
411renfrewhomesforsale.ca-28 Sep 20138 Sep 201528 Sep 2018
412renfrewcountyvcars.ca-2 Feb 201715 Mar 20172 Feb 2018
413renfrewshirecomputers.comLCN.COM Ltd.2 Jan 20182 Jan 20182 Jan 2019
414renfrewcricketclub.co.uk-28 Aug 202428 Aug 202428 Aug 2025
415renfrewshire.org.uk-28 Aug 202222 Nov 202428 Aug 2025
416renfrewimaging.co.uk-16 Apr 201521 Mar 201616 Apr 2019
417renfrewmotors.co.uk-26 Aug 201530 Aug 202326 Aug 2024
418renfrewshirecarebrokerage.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…19 Nov 200913 Nov 201719 Nov 2018
419renfrewshirebootcamp.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…18 Jan 201216 Jan 201618 Jan 2018
420renfrewshireskiphire.co.uk-1 Mar 201122 Feb 20171 Mar 2019
421renfrewphotography.co.ukReserved6 Jul 20146 Jul 20176 Jul 2018
422renfrewprojectservices.co.ukReserved1 May 201230 Apr 20161 May 2018
423renfrewpropertygazette.co.uk-5 Feb 20105 Apr 20175 Feb 2018
424renfrewcurryhouseonline.co.ukGandi SAS7 Mar 20177 Mar 20177 Mar 2018
425renfrewburghband.co.ukReserved15 Mar 200714 Mar 201715 Mar 2019
426renfrewshirelpg.co.uk-14 Oct 20093 Oct 201714 Oct 2019
427renfrewpropertybuyers.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 May 201615 Jun 201725 May 2018
428renfrewshireastro.co.ukReserved12 Dec 200511 Dec 201712 Dec 2019
429renfrewshireadp.co.uk-31 Oct 201313 Sep 201731 Oct 2019
430renfrewtrinity.uk-18 Aug 202215 May 202318 Aug 2023
431renfrewshirelive.co.uk-8 Aug 20169 Aug 20178 Aug 2019
432renfrewnews.co.uk-1 Dec 201719 Dec 20171 Dec 2018
433renfrewshire.co.uk-10 Jun 200326 Jun 202510 Jun 2026
434renfrewshirecab.org.uk-12 Jun 20134 Jun 202512 Jun 2027
435renfrewshirebookkeeping.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Sep 20113 Oct 201625 Sep 2018
436renfrewdigital.co.uk-27 Nov 201727 Nov 201727 Nov 2018
437renfrewshirescouts.org.uk-1 Sep 201512 Aug 20171 Sep 2018
438renfrewshire-elearning.co.uk-20 Mar 201210 Jun 202320 Mar 2024
439renfrewshirereferees.org.ukReserved8 Feb 20083 Jun 20178 Feb 2018
440renfrewshiredeliveries.co.uk-23 Sep 201716 Sep 202423 Sep 2025
441renfrewshirenurseries.org.uk-23 Sep 20222 Jul 202523 Sep 2025
442renfrewtransport.co.ukReserved25 May 201625 May 201625 May 2018
443renfrewnorth.org.uk-11 May 200311 Apr 202511 May 2026
444renfrewshiredecorators.co.ukReserved16 May 201727 Jul 201716 May 2018
445renfrewshireroofing.co.uk-3 Jan 20183 Jan 20183 Jan 2019
446renfrewshiremrc.co.ukregister.com, Inc.30 Nov 20156 Jun 201730 Nov 2018
447renfrew-airport.co.uk-28 Aug 201327 Aug 202328 Aug 2025
448renfrewconsulting.co.uk-22 Nov 200222 Nov 202422 Nov 2025
449renfrewshireggs.co.uk-25 Mar 201511 Mar 201725 Mar 2019
450renfrewshiretreesurgeons.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…23 Jun 200817 Jun 201623 Jun 2018
451renfrewshirebuilders.org.uk-15 Feb 201116 Jan 201715 Feb 2019
452renfrewhomebuyers.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 May 201615 Jun 201725 May 2018
453renfrewshireaccountants.co.uk-16 Aug 201012 Aug 202316 Aug 2024
454renfrewhealthcare.co.uk-8 Jul 202410 Nov 20248 Jul 2025
455renfrewonline.co.uk-6 Aug 20077 Jul 20176 Aug 2019
456renfrewshirecouncil.co.uk-13 Jun 202414 Jun 202513 Jun 2026
457renfrewshire-deliveries.co.uk-16 Mar 20231 Mar 202516 Mar 2026
458renfrewshireaccountancy.ukReserved9 Aug 20179 Aug 20179 Aug 2018
459renfrewshirefitnesshire.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…24 Feb 201117 Feb 201724 Feb 2019
460renfrewshireroadtrafficlaw.co.uk-24 Mar 201510 Mar 201724 Mar 2019
461renfrewshirecamra.org.uk-7 Sep 20098 Aug 20177 Sep 2019
462renfrewshirenews.co.uk-28 Nov 202323 Feb 202528 Nov 2025
463renfrewshire2023.co.uk-11 Feb 201411 Feb 201711 Feb 2019
464renfrewshirejobs.co.ukReserved21 Feb 201420 Feb 201621 Feb 2018
465renfrewtaxis.co.ukReserved21 Nov 201721 Nov 201721 Nov 2018
466renfrewshireadviceservice.co.uk-26 May 201721 Aug 202426 May 2024
467renfrewaccordionandfiddleclub.co.ukVautron Rechenzentrum AG4 Sep 20103 Sep 20164 Sep 2018
468renfrewdrycleaners.co.uk-3 Dec 20243 Dec 20243 Dec 2029
469renfrewtown.co.uk-30 Jan 201231 Jan 202530 Jan 2026
470renfrewshireresindrives.co.uk-5 May 20175 May 20175 May 2018
471renfrew-rotary.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…13 Dec 20056 Dec 201713 Dec 2018
472renfrewhomebuyers.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 May 201615 Jun 201725 May 2018
473renfrewtape.co.ukYour Domain LLC27 Mar 20067 Nov 202427 Mar 2026
474renfrewshirescouts.uk-1 Sep 201512 Aug 20171 Sep 2018
475renfrewfootcare.co.ukReserved17 Feb 201316 Feb 201717 Feb 2019
476renfrewhousebuyers.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 May 201615 Jun 201725 May 2018
477renfrewshirelibraries.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…30 Oct 201323 Oct 201730 Oct 2019
478renfrewshiretapestry.org.uk-16 Feb 201615 Feb 202516 Feb 2026
479renfrewcf.co.uk-2 Aug 200629 Jun 20162 Aug 2018
480renfrewshirecc.org.uk-25 Jun 201411 Jun 201625 Jun 2018
481renfrewshirepropertybuyers.co.uk-17 Feb 202217 Feb 202517 Feb 2025
482renfrewshireorthotics.co.uk-18 May 201419 May 202518 May 2026
483renfrewshireplumbing.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…1 Jun 201713 Jul 20171 Jun 2018
484renfrewshireruralwatch.co.uk-4 Dec 20144 Nov 20164 Dec 2018
485renfrewdefencelawyers.co.uk-24 Mar 201519 Jun 202324 Mar 2024
486renfrewshiresportsnetwork.co.uk-10 Oct 201318 Oct 202410 Oct 2025
487renfrewshirecarers.co.uk-23 Mar 200528 Mar 202523 Mar 2028
488renfrewshirepetservices.co.ukOne.com A/S11 Jun 201112 May 201711 Jun 2019
489renfrewshirecomputerrepairs.co.ukReserved30 Apr 201229 Apr 201630 Apr 2018
490renfrewshireaccesspanel.org.uk-17 Oct 201115 Sep 201717 Oct 2019
491renfrewglass.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…24 Oct 201717 Dec 201724 Oct 2019
492renfrewhighschool.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…22 Dec 20152 Oct 201722 Dec 2025
493renfrewplumbing.co.uk-3 Aug 201630 Jun 20173 Aug 2019
494renfrewcouncilonalcohol.org.uk-9 Jul 200210 Jun 20169 Jul 2018
495renfrewshiresound.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Jan 20149 Jan 201616 Jan 2018
496renfrewglassandglazing.co.uk-16 Nov 201117 Oct 201716 Nov 2018
497renfrewshiremusictuition.co.uk-25 Mar 201625 Mar 201625 Mar 2018
498renfrewshirebn.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…7 Jun 20177 Jun 20177 Jun 2018
499renfrewshirebusinessdirectory.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…13 Mar 200924 Feb 201613 Mar 2019
500renfrewgroup.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…14 Sep 201630 Sep 201714 Sep 2018
501renfrewfuneralservice.co.uk-1 Nov 20161 Nov 20161 Nov 2021
502renfrewtyres.co.uk-26 Apr 201327 Mar 202526 Apr 2027
503renfrewshiresportsawards.co.uk-8 Jul 20151 Jun 20178 Jul 2019
504renfrewproperty.co.uk-24 Aug 201724 Aug 201724 Aug 2018
505renfrewcarbreakers.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…26 May 201626 May 201626 May 2018
506renfrewcurryhouse.co.uk-10 Feb 20156 Feb 201710 Feb 2018
507renfrewponyclub.comNameCheap, Inc.8 Jan 20188 Jan 20188 Jan 2019
508renfrewenergy.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…27 Dec 20141 Jan 201827 Dec 2017
509renfrewshirerc.org.uk-26 May 200326 Apr 202526 May 2026
510renfrewpropertybuyers.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 May 201615 Jun 201725 May 2018
511renfrewshireunison.org.uk-20 Dec 200723 Jan 202420 Dec 2025
512renfrewshirewebdesign.co.uk-16 Dec 20142 Dec 201716 Dec 2018
513renfrewshirerenegades.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…27 Apr 201727 Apr 201727 Apr 2019
514renfrewshirepsychology.co.ukregister.com, Inc.12 Feb 201712 Feb 201712 Feb 2019
515renfrewshirefreeads.co.uk-12 Dec 200627 Dec 201712 Dec 2018
516renfrewmotorengineers.co.uk-16 Jun 201716 Jun 201716 Jun 2018
517renfrew-rotary.co.uk-1 Aug 20102 Jul 20171 Aug 2018
518renfrewshirelabour.org.uk-4 Sep 20065 Aug 20164 Sep 2020
519renfrewshirecatsitting.co.uk-16 May 201716 May 201716 May 2018
520renfrewshirejoiners.co.uk-15 Feb 201116 Jan 201715 Feb 2019
521renfrew-elec.co.uk--31 Jan 20167 Feb 2018
522renfrewshire-as.co.ukReserved10 Oct 20079 Oct 201710 Oct 2019
523renfrewshireastrotest.co.ukReserved20 Feb 200919 Feb 201720 Feb 2019
524renfrewshiregolfguide.co.ukReserved11 Jun 200911 Jun 201711 Jun 2019
525renfrewframing.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…22 Sep 201415 Sep 201722 Sep 2018
526renfrewshireservices.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…18 Jan 201718 Jan 201718 Jan 2018
527renfrewdt.co.uk-13 Apr 201511 May 201713 Apr 2018
528renfrewspeakersclub.org.uk-8 Sep 20074 Sep 20178 Sep 2018
529renfrew-victoria-youth-football-club.co.uk-1 Oct 201330 Sep 20241 Oct 2025
530renfrewdefence.co.ukGandi SAS16 Mar 20177 Aug 201716 Mar 2019
531renfrewemploymentlaw.co.uk-8 Feb 20138 May 20178 Feb 2019
532renfrewhousebuyers.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 May 201615 Jun 201725 May 2018
533renfrewapt.comSafeNames Ltd.29 Jan 201830 Jan 202529 Jan 2026
534renfrew-apt.comSafeNames Ltd.29 Jan 201830 Jan 202529 Jan 2026
535renfrew-apt.co.ukSafeNames Ltd.29 Jan 201829 Jan 201829 Jan 2020
536renfrewapt.co.ukSafeNames Ltd.29 Jan 201829 Jan 201829 Jan 2020
537renfrewshirepetcrematorium.co.uk-1 Feb 20181 Feb 20181 Feb 2020
538renfrewhouseclearance.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…4 Feb 20184 Feb 20184 Feb 2020
539renfrewnailsspa.comLaunchpad, Inc.22 Mar 20187 Mar 202522 Mar 2026
540renfrewliving.comDomain.com, LLC6 Apr 20186 Apr 20186 Apr 2019
541renfrewprinting.com1API GmbH19 Apr 201814 Apr 202519 Apr 2028
542renfrewshire-decorators.co.uk-24 Apr 201824 Apr 201824 Apr 2019
543renfrewshire.siteNameCheap, Inc.16 May 201816 May 201816 May 2019
544renfrewpostoffice.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 May 201816 May 201816 May 2019
545renfrewchryslerltd.netWebnames.ca Inc.17 May 201817 May 201817 May 2019
546renfrewdentist.ca-6 Aug 20129 Jul 20246 Aug 2026
547renfrewshirelandlords.comeNom, Inc.25 May 201825 May 201825 May 2019
548renfrewcatholicteachers.comTucows Domains Inc.5 Jun 201821 May 20255 Jun 2026
549renfrewbaptistchurch.ca-25 Jan 200811 Mar 202525 Jan 2026
550renfrewauto.ca-3 Jul 202513 Jul 20253 Jul 2026
551renfrew-realestate.netNetwork Solutions, LLC19 Jul 201820 Jul 201819 Jul 2019
552renfrewmc2.comGoDaddy.com, LLC3 Aug 20183 Aug 20183 Aug 2019
553renfrewsteam.netNetwork Solutions, LLC3 Aug 20184 Aug 20183 Aug 2019
554renfrewcapitalinc.comNamesilo, LLC10 Aug 201811 Aug 202510 Aug 2026
555renfrewtimberwolves.comGoDaddy.com, LLC16 Aug 201817 Aug 202516 Aug 2026
556renfrewectopia.proNameCheap, Inc.21 Aug 201821 Aug 201821 Aug 2019
557renfrewcountyhomes.comGoDaddy.com, LLC7 Sep 20188 Sep 20247 Sep 2026
558renfrewshirehandymanservices.comGoDaddy.com, LLC20 Sep 201821 Sep 202420 Sep 2025
559renfrewshirehandyman.comGoDaddy.com, LLC20 Sep 201820 Sep 201820 Sep 2019
560renfrewshirehandymanservice.comTurnCommerce, Inc. DBA NameBright.com18 Mar 202212 Mar 202318 Mar 2024
561renfrewworld.comGoDaddy.com, LLC14 Oct 201814 Oct 201814 Oct 2020
562renfrewshirenow.comRegister.it SPA18 Oct 201818 Oct 201818 Oct 2019
563renfrewautogroup.comWebnames.ca Inc.25 Oct 201814 Jul 202525 Oct 2028
564renfrewmover.comGoDaddy.com, LLC29 Oct 201816 May 202529 Oct 2025
565renfrewmoving.comGoDaddy.com, LLC29 Oct 201816 May 202529 Oct 2025
566renfrewcollective.comNetwork Solutions, LLC19 Nov 201820 Oct 202419 Nov 2025
567renfrewcentennialdoors.comGoDaddy.com, LLC21 Nov 201821 Nov 201821 Nov 2019
568renfrewdoors.comGoDaddy.com, LLC21 Nov 201821 Nov 202421 Nov 2025
569renfrewdoor.comGoDaddy.com, LLC21 Nov 201821 Nov 202421 Nov 2025
570renfrewwindows.comGoDaddy.com, LLC21 Nov 201821 Nov 202421 Nov 2025
571renfrewcentennialwindowsanddoors.comGoDaddy.com, LLC21 Nov 201821 Nov 201821 Nov 2019
572renfrewwindow.comGoDaddy.com, LLC21 Nov 201821 Nov 202421 Nov 2025
573renfrewcentennialwindow.comGoDaddy.com, LLC21 Nov 201821 Nov 201821 Nov 2019
574renfrewcentennialdoor.comGoDaddy.com, LLC21 Nov 201821 Nov 201821 Nov 2019
575renfrewcentennialwindows.comGoDaddy.com, LLC21 Nov 201821 Nov 201821 Nov 2019
576renfrewwindowsdoors.comGoDaddy.com, LLC21 Nov 201821 Nov 201821 Nov 2019
577renfrewcentennialwindowsdoors.comGoDaddy.com, LLC21 Nov 201821 Nov 201821 Nov 2019
578renfrewwindowsanddoors.comGoDaddy.com, LLC21 Nov 201821 Nov 201821 Nov 2019
579renfrewcurryhouse.comCloudFlare, Inc.26 Nov 201826 Sep 202426 Nov 2025
580renfrewnovicetournament.comGoDaddy.com, LLC8 Dec 20188 Dec 20188 Dec 2019
581renfrew-tandoori.comCloudFlare, Inc.12 Dec 201826 Sep 202412 Dec 2025
582renfrewroad.comGoDaddy.com, LLC5 Jan 20196 Jan 20255 Jan 2027
583renfrewshireinvestor.comeNom, Inc.12 Jan 201912 Jan 201912 Jan 2020
584renfreworganics.comNameCheap, Inc.21 Jan 201921 Jan 201921 Jan 2020
585renfrewrealestate.infoGoDaddy.com, LLC23 Jan 201923 Jan 201923 Jan 2020
586renfrewpharmacy.comKey-Systems GmbH19 Sep 202331 Jan 202519 Sep 2025
587renfrewbrewingco.comGoDaddy.com, LLC28 Jan 201928 Jan 201928 Jan 2021
588renfrewleisure.comGoDaddy.com, LLC4 Feb 20194 Feb 20194 Feb 2020
589renfrewcountyrealtor.comNamespro Solutions Inc.8 Feb 20199 Jan 20258 Feb 2026
590renfrewcountycremationservices.comGoDaddy.com, LLC21 Feb 201921 Feb 201921 Feb 2021
591renfrewshireescaperooms.comTucows Domains Inc.22 Feb 20194 Apr 202322 Feb 2023
592renfrewcamping.comNetwork Solutions, LLC23 Feb 201924 Jan 202523 Feb 2027
593renfrewtoday.ca-22 Sep 201012 Dec 202222 Sep 2026
594renfrewshireboxoffice.comGoDaddy.com, LLC4 Mar 20194 Mar 20194 Mar 2020
595renfrewonlineschool.netGoDaddy.com, LLC22 Mar 201922 Mar 201922 Mar 2021
596renfrewonlineschool.comGoDaddy.com, LLC22 Mar 20192 May 202522 Mar 2025
597renfrewshirehomeservices.comGoDaddy.com, LLC3 Apr 20193 Apr 20193 Apr 2020
598renfrewshirepropertyservices.comGoDaddy.com, LLC7 Apr 20197 Apr 20197 Apr 2020
599renfrewauto.comWebnames.ca Inc.18 Apr 201910 Jul 202518 Apr 2029
600renfrewtaxi.comGoDaddy.com, LLC1 May 20192 May 20251 May 2026
601renfrewchryslerjeepram.comGoDaddy.com, LLC7 May 20198 May 20257 May 2026
602renfrewsolargarden.comGoDaddy.com, LLC24 May 201924 May 201924 May 2021
603renfrewshire.schoolMesh Digital Limited29 May 201918 Jun 202429 May 2029
604renfrewcountydoulas.ca-26 Nov 201320 Jul 202426 Nov 2025
605renfrewshiredoggydaycare.comNetwork Solutions, LLC13 Jun 201913 Jun 201913 Jun 2021
606renfrewcenterchallenge.comGoDaddy.com, LLC19 Jun 201919 Jun 201919 Jun 2021
607renfrewdesign.comDreamHost, LLC15 Jul 201913 Jun 202515 Jul 2026
608renfrewautoservice.comGoogle, Inc.16 Jul 20191 Jul 202516 Jul 2026
609renfrewamateurradiosociety.comGoDaddy.com, LLC5 Aug 20195 Aug 20195 Aug 2020
610renfrewshirehearingcentre.comGoogle, Inc.9 Aug 20199 Aug 20199 Aug 2020
611renfrewcountyatv.clubGoDaddy.com, LLC10 Sep 201910 Sep 201910 Sep 2020
612renfrewsolar.comGoDaddy.com, LLC30 Sep 201930 Sep 201930 Sep 2020
613renfrewcarwash.comGoogle, Inc.3 Nov 20193 Nov 20193 Nov 2020
614renfrewrealestateagents.comGoDaddy.com, LLC7 Nov 20197 Nov 20197 Nov 2020
615renfrewrealestateagent.comGoDaddy.com, LLC7 Nov 20197 Nov 20197 Nov 2020
616renfrewartisans.comGoDaddy.com, LLC12 Nov 201912 Nov 201912 Nov 2021
617renfrewtruckcentre.comGoDaddy.com, LLC24 Nov 20198 Jan 202524 Nov 2030
618renfrewshireheritage.netTucows Domains Inc.29 Nov 20199 Feb 202429 Nov 2023
619renfrewshireheritage.comTucows Domains Inc.29 Nov 20199 Feb 202429 Nov 2023
620renfrewdesigns.comTucows Domains Inc.21 Dec 201925 Dec 202221 Dec 2022
621renfrewbridgeclub.comAutomattic Inc.23 Dec 201923 Dec 201923 Dec 2020
622renfrewsurgery.comGoDaddy.com, LLC3 Jan 20203 Jan 20203 Jan 2022
623renfrewshbiureleisure.comGoDaddy.com, LLC24 Jan 202024 Jan 202024 Jan 2021
624renfrewhousebuyers.comNameCheap, Inc.28 Jan 2020-28 Jan 2021
625renfrewbaptist.comGoDaddy.com, LLC27 Feb 202028 Feb 202527 Feb 2026
626renfrewshiretreesurgeons.comGoogle, Inc.1 Mar 202014 Feb 20251 Mar 2026
627renfrewwolves.comGoDaddy.com, LLC2 Mar 202023 Jul 20242 Mar 2026
628renfrewcastle.ca-18 Apr 20192 Jun 202518 Apr 2026
629renfrewfcyouth.comTucows Domains Inc.6 Mar 202017 May 20246 Mar 2024
630renfrewexprealty.comDomain.com, LLC5 Mar 202018 Feb 20255 Mar 2026
631renfrewshirepropertyrepairs.comGoDaddy.com, LLC22 Apr 202022 Apr 202022 Apr 2021
632renfrewhighsocialsubjects.comregister.com, Inc.4 Jun 20204 Jun 20204 Jun 2021
633renfrewtesla.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jun 202023 Jul 202511 Jun 2025
634renfrewyyc.comGoDaddy.com, LLC29 Jun 202014 Jun 202329 Jun 2026
635renfrewshirewaste.com1&1 Internet AG12 Jul 202012 Jul 202012 Jul 2026
636renfrewcountydoulas.comDreamHost, LLC17 Aug 202029 Sep 202417 Aug 2024
637renfrewshirehottubs.comGoDaddy.com, LLC23 Aug 202023 Aug 202023 Aug 2021
638renfrewshirecleaning.comGoDaddy.com, LLC26 Aug 202026 Aug 202026 Aug 2021
639renfrewroasters.comGoDaddy.com, LLC26 Aug 20206 Oct 202426 Aug 2024
640renfrewshirecleaningservice.comGoDaddy.com, LLC26 Aug 202026 Aug 202026 Aug 2021
641renfrewshirecleaningservices.comGoDaddy.com, LLC26 Aug 20207 Oct 202326 Aug 2023
642renfrewshirecleaningcompany.comGoDaddy.com, LLC26 Aug 202026 Aug 202026 Aug 2021
643renfrewcapitalmgmt.comTucows Domains Inc.10 Sep 202014 Sep 202210 Sep 2023
644renfrewmedicalesthetics.comTucows Domains Inc.13 Sep 202024 Nov 202313 Sep 2023
645renfrewhomesupport.ca-2 Mar 201616 Apr 20252 Mar 2026
646renfrewlodge.comGoDaddy.com, LLC28 Sep 202029 Sep 202428 Sep 2026
647renfrewweedery.comGoDaddy.com, LLC7 Oct 20207 Oct 20207 Oct 2021
648renfrewcountymediationservices.comTucows Domains Inc.28 Oct 202020 Mar 202528 Oct 2025
649renfrewshirepremier.comGoogle, Inc.10 Nov 202011 Nov 202310 Nov 2024
650renfrewshiremanandvan.com1&1 Internet AG11 Nov 202011 Nov 202011 Nov 2025
651renfrewshirelesuire.comMedia Elite Holdings Limited23 Nov 202023 Nov 202023 Nov 2021
652renfrewshiresyoungpersonsguarantee.com1&1 Internet AG15 Dec 202027 Feb 202415 Dec 2023
653renfrewrealtors.siteregister.com, Inc.20 Dec 202020 Dec 202020 Dec 2021
654renfrewcountyhandyman.comTucows Domains Inc.23 Dec 20205 Mar 202523 Dec 2024
655renfrewshiretots.co.uk-15 Apr 202220 Apr 202315 Apr 2023
656renfrewcannabis.ca-16 Mar 20187 Jul 201916 Mar 2021
657renfrewshirehandymancompany.comGoDaddy.com, LLC14 Jan 202114 Jan 202114 Jan 2022
658renfrewedibles.comTucows Domains Inc.14 Jan 201918 Jan 202114 Jan 2021
659renfrewcounty2022.comGoDaddy.com, LLC21 Jan 20213 Apr 202421 Jan 2024
660renfrewshire.church1&1 Internet AG26 Jan 202112 Mar 202526 Jan 2026
661renfrewrentals.comNameCheap, Inc.17 Feb 202118 Jan 202517 Feb 2026
662renfrewprep.comGoogle, Inc.23 Feb 20218 Feb 202523 Feb 2026
663renfrewfishing.comGoDaddy.com, LLC2 Mar 202113 Apr 20232 Mar 2023
664renfrewretreats.comNameCheap, Inc.16 Mar 202114 Feb 202516 Mar 2026
665renfrewshireproperties.comGoDaddy.com, LLC14 Apr 202114 Apr 202114 Apr 2022
666renfrewagvocates.comGoogle, Inc.20 Apr 20215 Apr 202520 Apr 2026
667renfrewdollarplusstore.comGoogle, Inc.24 Apr 20219 Apr 202524 Apr 2026
668renfrewcountycatholicdsb.clubNameCheap, Inc.26 Apr 2021-26 Apr 2022
669renfrewcarsales.comCloudFlare, Inc.28 Apr 202114 May 202528 Apr 2026
670renfrewmonuments.comregister.com, Inc.7 May 20217 May 20217 May 2026
671renfrewcommunity.comGoDaddy.com, LLC25 May 202116 Oct 202225 May 2031
672renfrewbrighton.comCosmotown, Inc.22 Sep 202122 Sep 202122 Sep 2022
673renfrewperiperi.comGoDaddy.com, LLC7 Jul 202118 Sep 20247 Jul 2024
674renfrewshiretransport.comAutomattic Inc.10 Jul 202110 Jul 202110 Jul 2022
675renfrewshiremarketing.comNameCheap, Inc.25 Aug 2021-25 Aug 2022
676renfrewperiperionline.comMesh Digital Limited23 Sep 202118 Sep 202423 Sep 2025
677renfrewmotorengineers.comNameCheap, Inc.15 Oct 202115 Sep 202415 Oct 2025
678renfrewlibrary.ca-30 Mar 202114 May 202530 Mar 2026
679renfrewshireradio.comNameCheap, Inc.27 Dec 20213 May 202527 Dec 2025
680renfrewshirepropertysolutions.comGoDaddy.com, LLC14 Jan 202228 Mar 202514 Jan 2025
681renfrewcannabis.comTucows Domains Inc.14 Jan 201918 Jan 202214 Jan 2022
682renfrewrogers.comNameCheap, Inc.5 Feb 20225 Feb 20225 Feb 2032
683renfrewshirerainbowbuddies.comGoogle, Inc.15 Feb 202215 Feb 202215 Feb 2023
684renfrewcountykingshighperformancehockey.comGoDaddy.com, LLC22 Feb 20229 Mar 202522 Feb 2027
685renfrewin.xyzNameKing.com Inc.13 Mar 202224 May 202313 Mar 2023
686renfrewscience.comGoogle, Inc.20 Mar 20225 Mar 202520 Mar 2026
687renfrewmd.comDreamHost, LLC28 Mar 202224 Feb 202528 Mar 2026
688renfrewpainting.comGoDaddy.com, LLC30 Mar 202223 Mar 202530 Mar 2026
689renfrewsciencelife.comGoogle, Inc.1 Apr 202218 Mar 20251 Apr 2026
690renfrewhomefromhome.comRegister.it SPA29 Apr 20221 Jul 202329 Apr 2023
691renfrewunitedresidential.comGoDaddy.com, LLC4 May 20214 May 20214 May 2022
692renfrewhosp.netNameCheap, Inc.4 May 20225 May 20234 May 2024
693renfrewshire.townNameCheap, Inc.8 May 202219 Jul 20248 May 2024
694renfrewautoglass.ca-24 Sep 20148 Nov 202424 Sep 2025
695renfrewcente.comeName Technology Co., Ltd.17 May 202228 Jun 202317 May 2023
696renfrewcountyunitedway.ca-3 Aug 20224 Jul 20253 Aug 2026
697renfrewshirewindowsanddoors.com1&1 Internet AG19 Jun 202219 Jun 202219 Jun 2026
698renfrewheights.ca-15 Sep 20208 Sep 202415 Sep 2025
699renfrewcountyatv.ca-24 Jan 200817 Jan 202524 Jan 2026
700renfrewcounty2023.ca-22 Mar 202221 May 202222 Mar 2023
701renfrewedibles.co.uk-8 Apr 202222 Apr 20238 Apr 2024
702renfrewremapping.comTucows Domains Inc.16 Aug 202216 Aug 202516 Aug 2026
703renfrewshirefirst.org.uk-17 Aug 202218 May 202317 Aug 2023
704renfrewshiretransport.co.uk-20 Aug 202229 Aug 202420 Aug 2024
705renfrewshiregardenscos.co.uk-21 Aug 20223 Sep 202421 Aug 2024
706renfrewkicking.comAutomattic Inc.25 Sep 20228 Dec 202325 Sep 2023
707renfrewshiremedia.comNameCheap, Inc.30 Sep 202212 Dec 202330 Sep 2023
708renfrewtrading.comGoDaddy.com, LLC30 Sep 20221 Oct 202430 Sep 2026
709renfrewplayers.co.uk-6 Oct 20222 Jan 20236 Oct 2023
710renfrewradiology.comGoDaddy.com, LLC6 Oct 202217 Nov 20236 Oct 2023
711renfrewtheatre.co.uk-8 Oct 20222 Jan 20238 Oct 2023
712renfrewshireinpics.co.uk-12 Oct 202224 Jul 202312 Oct 2023
713renfrewcapitalmgmt.coNamesilo, LLC4 Apr 20229 Apr 20254 Apr 2026
714renfrewgala2023.comGoDaddy.com, LLC31 Oct 202211 Dec 202331 Oct 2023
715renfrewgspaq.topNamesilo, LLC20 Oct 202220 Oct 202220 Oct 2023
716renfrewcountydumpster.comGoDaddy.com, LLC2 Nov 20222 Nov 20222 Nov 2025
717renfrewshireproperty.comGoDaddy.com, LLC3 Nov 202215 Dec 20243 Nov 2024
718renfrewshireproperty.co.uk-3 Nov 202216 Aug 20243 Nov 2024
719renfrewshirecab.co.uk-8 Nov 202215 May 20238 Nov 2023
720renfrewcountyinvestigations.comWix.com Ltd.21 Nov 202025 Nov 202221 Nov 2022
721renfrewshirecleaningcompany.co.uk-3 Dec 20223 Dec 20233 Dec 2023
722renfrewshirekitchensbathrooms.com1&1 Internet AG6 Dec 20227 Dec 20246 Dec 2025
723renfrewcountycommunityriskwatch.comWix.com Ltd.16 Dec 202226 Jan 202516 Dec 2024
724renfrewbia.orgSibername Internet and Software Technologies Inc.30 Dec 202210 Feb 202530 Dec 2024
725renfrewbia.netSibername Internet and Software Technologies Inc.30 Dec 202231 Dec 202430 Dec 2025
726renfrewbia.com1API GmbH30 Dec 20223 Apr 202430 Dec 2025
727renfrewceter.comKey-Systems GmbH30 Dec 202213 Mar 202430 Dec 2023
728renfrewminorbaseball.comGoDaddy.com, LLC23 Feb 201828 Jan 202523 Feb 2026
729renfrewradiologyllc.comGoogle, Inc.26 Jan 202325 Feb 202426 Jan 2024
730renfrewcenter.netNameCheap, Inc.26 Jan 20238 Apr 202426 Jan 2024
731renfrewltd.co.uk-21 Dec 202131 Jan 202421 Dec 2024
732renfrewanimal.ca-8 Mar 20065 Aug 20248 Mar 2028
733renfrewpg.ca-17 Nov 200127 May 202517 Nov 2025
734renfrewbia.ca-11 Mar 20244 May 202511 Mar 2026
735renfrewlegionbr148.ca-15 Dec 201129 Jan 202515 Dec 2025
736renfrewteachers.ca-24 Feb 200916 Feb 202524 Feb 2026
737renfrewyyc.ca-27 Mar 201727 Feb 202527 Mar 2027
738renfrewcountyrealestate.caGandi SAS30 Apr 201126 Mar 202530 Apr 2026
739renfrewontario.ca-21 Dec 201821 Nov 202421 Dec 2025
740renfrewotl.ca-2 Dec 20139 Nov 20222 Dec 2026
741renfrewchryslerdealer.ca-29 Mar 200927 Jan 202529 Mar 2026
742renfrewgoldenage.ca-17 Jun 20151 Aug 202517 Jun 2026
743renfrewcountyhomeinspections.ca-26 Jan 20107 Mar 202426 Jan 2024
744renfrewcurling.ca-19 Jul 201625 Jul 202419 Jul 2026
745renfrewprinting.ca-19 Apr 201814 Apr 202519 Apr 2028
746renfrewlandowners.ca-21 Sep 201626 Sep 202321 Sep 2024
747renfrewchiropractors.ca-6 Sep 201418 Oct 20246 Sep 2025
748renfrewskatingclub.ca-28 Aug 201720 Aug 202428 Aug 2025
749renfrewparamedics.ca-19 May 201720 May 202519 May 2027
750renfrewcrane.ca-1 May 201916 Apr 20251 May 2026
751renfrewpsychotherapy.ca-16 Aug 20199 Aug 202516 Aug 2026
752renfrewcountyfoodbanks.ca-6 Sep 202021 Oct 20246 Sep 2025
753renfrewfoodbank.ca-5 May 202027 Jun 20255 May 2026
754renfrewcounty2022.ca-21 Jan 20213 Mar 202421 Jan 2024
755renfrewshirepestcontrol.uk-3 Feb 202322 Jan 20243 Feb 2024
756renfrewgroup.cn-23 Feb 2017-23 Feb 2026
757renfrewshirecounsellingservices.comWix.com Ltd.8 Feb 20239 Jan 20258 Feb 2026
758renfrewshouseofgainz.comGoDaddy.com, LLC17 Feb 202326 Feb 202417 Feb 2029
759renfrewcreamerykings.comRebel.com Corp.4 Mar 202314 May 20244 Mar 2024
760renfrewshiredeliveries.com1&1 Internet AG18 Feb 201818 Feb 201818 Feb 2026
761renfrewlittleleague.comGoDaddy.com, LLC23 Feb 201828 Jan 202523 Feb 2026
762renfrewdentalcentre.co.uk-8 Mar 202311 Feb 20258 Mar 2026
763renfrewstationdental.comNameCheap, Inc.30 Apr 201831 Mar 202530 Apr 2026
764renfrewshirecbtservices.co.uk-16 Mar 202317 Mar 202516 Mar 2026
765renfrewbagpiper.comWix.com Ltd.16 May 202026 Jun 202316 May 2023
766renfrewshireadultprotectioncommittee.co.uk-20 Mar 202311 Aug 202320 Mar 2024
767renfrewvacationrentals.comNameCheap, Inc.17 Feb 202118 Jan 202517 Feb 2026
768renfrewshirepropertypurchase.comNameCheap, Inc.6 Jul 202117 Sep 20246 Jul 2024
769renfrewmuaythai.comWix.com Ltd.12 Jul 202116 Jul 202512 Jul 2027
770renfrewcountycandles.comWix.com Ltd.8 Nov 20219 Oct 20248 Nov 2025
771renfrewshirewindowcleaning.comWix.com Ltd.11 Nov 202112 Oct 202311 Nov 2025
772renfrewshawarma.comSteamline Domains, LLC2 Mar 20238 Mar 20252 Mar 2026
773renfrewcounty2023.comGoDaddy.com, LLC22 Mar 20223 May 202422 Mar 2024
774renfrewrealtor.comGoDaddy.com, LLC25 Mar 20225 May 202425 Mar 2024
775renfrewcountycremation.comGoDaddy.com, LLC20 Jun 202226 Aug 202520 Jun 2026
776renfrewtreesurgeon.co.uk-16 Apr 20235 Mar 202416 Apr 2024
777renfrewexprealty.netDomain.com, LLC5 Mar 202018 Feb 20255 Mar 2026
778renfrewmercury.ca-21 Aug 20072 Jul 202521 Aug 2030
779renfrewspeakersclub.orgNetwork Solutions, LLC30 Oct 20175 Oct 202430 Oct 2027
780renfrewshiretapestry.org1&1 Internet AG5 Feb 202120 Mar 20255 Feb 2025
781renfrewshireescaperooms.co.uk-22 Feb 201923 Jan 202322 Feb 2025
782renfrewshireepc.co.uk-2 Feb 20221 Feb 20252 Feb 2026
783renfrewshirehomebuyers.co.uk-1 May 20202 May 20251 May 2025
784renfrewshirebusinessawards.co.uk-3 Aug 201817 Aug 20243 Aug 2025
785renfrewshirewaste.co.uk-12 Jul 202011 Jul 202512 Jul 2026
786renfrewperiperionline.co.uk-23 Sep 202123 Sep 202423 Sep 2025
787renfrewpodiatry.co.uk-11 Oct 202112 Oct 202411 Oct 2025
788renfrewshireheritage.org.uk-29 Nov 201929 Nov 202229 Nov 2023
789renfrewrecovery.co.uk-26 Nov 202126 Nov 202326 Nov 2024
790renfrewshireproperties.co.uk-21 May 20236 Jun 202421 May 2024
791renfrewtandoori.uk-22 May 202317 Apr 202522 May 2026
792renfrewshirehandyman.co.uk-20 Sep 201814 Jul 202320 Sep 2023
793renfrewshirecoronaresponse.co.uk-17 Mar 202014 Sep 202217 Mar 2023
794renfrewwoodworking.comNetwork Solutions, LLC9 Jun 202322 Aug 20249 Jun 2024
795renfrewcountyscanner.comCloudFlare, Inc.10 Jun 20235 Jun 202510 Jun 2026
796renfrewplumbing.comNameCheap, Inc.10 Jun 202311 May 202510 Jun 2026
797renfrewcountyscanner.wikiCloudFlare, Inc.10 Jun 202315 Jun 202310 Jun 2024
798renfreweducationalservices.comNameCheap, Inc.22 Jun 20233 Sep 202422 Jun 2024
799renfrewshire.uk-1 Oct 202017 Oct 20241 Oct 2025
800renfrew-windows.co.uk-12 May 202212 May 202212 May 2023
801renfreweats.co.uk-2 May 20222 May 20222 May 2023
802renfrewshirepodiatry.co.uk-11 Oct 202112 Oct 202411 Oct 2025
803renfrewcc.org.uk-31 Aug 20201 Sep 202431 Aug 2024
804renfrewcountyvoices.comDomain.com, LLC10 Jul 202325 Jun 202510 Jul 2026
805renfrew-plumbing.comCloudFlare, Inc.13 Jul 202322 Aug 202413 Jul 2024
806renfrewhandyman.comGoDaddy.com, LLC16 Jul 202330 Jul 202516 Jul 2026
807renfrewcurryhouse.uk-21 Jul 202316 Jun 202521 Jul 2026
808renfrewshirearts.co.uk-25 Jul 20235 Aug 202325 Jul 2024
809renfrewshire-vjb.co.uk-31 Jul 202317 Aug 202331 Jul 2024
810renfrewbuilders.comGoogle, Inc.7 Aug 202323 Jul 20257 Aug 2026
811renfrewdefence.comMesh Digital Limited10 Aug 20235 Aug 202510 Aug 2026
812renfrewladiesandgirls.comGoDaddy.com, LLC23 Aug 202324 Aug 202523 Aug 2026
813renfrew-ca.comInternet Works Online International (HK) Co., Limi…5 Sep 20235 Sep 20235 Sep 2024
814renfrewshireplumbingservices.comGoDaddy.com, LLC10 Sep 202315 Aug 202410 Sep 2025
815renfrewshiredental.co.uk-10 Sep 202311 Aug 202410 Sep 2025
816renfrewshirecatman.comGoDaddy.com, LLC15 Sep 202315 Sep 202315 Sep 2026
817renfrewrepair.comGoogle, Inc.19 Sep 20235 Sep 202419 Sep 2025
818renfrewpharmacy.uk-19 Sep 202317 Oct 202419 Sep 2025
819renfrewshirecommercialtrucksales.co.uk-2 Oct 20232 Oct 20242 Oct 2024
820renfrewhighlandpipesanddrums.com1API GmbH11 Oct 20233 Oct 202411 Oct 2025
821renfrewanimal.comGoogle, Inc.16 Oct 20231 Oct 202416 Oct 2025
822renfrewandareaconnectioncentre.ca-21 Sep 202222 Aug 202421 Sep 2026
823renfrewshireautodrivingschool.co.uk-23 Oct 202323 Oct 202323 Oct 2025
824renfrewquarters.comWix.com Ltd.28 Oct 202328 Oct 202328 Oct 2026
825renfrewgala2024.comGoDaddy.com, LLC2 Nov 202314 Dec 20242 Nov 2024
826renfrewcountycontractors.comGoDaddy.com, LLC13 Nov 202325 Dec 202413 Nov 2024
827renfrewshireholidaylets.co.uk-12 Nov 20233 Sep 202412 Nov 2024
828renfrewtowing.topNamesilo, LLC12 Feb 202513 Feb 202512 Feb 2026
829renfrewpub.comGoDaddy.com, LLC21 Nov 202325 Nov 202421 Nov 2025
830renfrewshirerainbowbuddies.uk-25 Nov 202310 Nov 202425 Nov 2025
831renfrewshireheritage.infoTucows Domains Inc.29 Nov 20198 Feb 202429 Nov 2023
832renfrewshireheritage.orgTucows Domains Inc.29 Nov 20198 Feb 202429 Nov 2023
833renfrewshirecabco.uk-19 Oct 201720 Oct 202419 Oct 2026
834renfrewbusinesscentre.comGandi SAS29 Dec 202312 Dec 202429 Dec 2025
835renfrewbusinesscentre.co.uk-29 Dec 202312 Dec 202429 Dec 2025
836renfrewliving.ca-4 Nov 20214 Aug 20244 Nov 2025
837renfrewshirerentals.co.uk-19 Jan 202419 Jan 202419 Jan 2027
838renfrewshire-council.orgGoogle, Inc.3 Feb 202417 Jul 20253 Feb 2026
839renfrewshiregryffecab.co.uk-6 Feb 20246 Feb 20246 Feb 2025
840renfrewsc.co.uk-7 Feb 20247 Feb 20247 Feb 2025
841renfrewshireancestors.uk-7 Feb 20246 Feb 20257 Feb 2026
842renfrewproperties.comRebel.com Corp.15 Feb 202415 Feb 202515 Feb 2026
843renfrewmanagement.comRebel.com Corp.15 Feb 202415 Feb 202515 Feb 2026
844renfrewwindows.ca-21 Nov 20185 Jan 202521 Nov 2025
845renfrewshirecarpetcleaners.co.uk-15 Feb 202414 Feb 202515 Feb 2026
846renfrewvillage.comTucows Domains Inc.20 Feb 202422 Jan 202520 Feb 2026
847renfrewrocksbasketball.comNameCheap, Inc.6 Mar 202418 May 20256 Mar 2025
848renfrewshireroots.comWebfusion Ltd.11 Mar 202412 Mar 202511 Mar 2026
849renfrewfcyouth.co.uk-10 Mar 20248 Sep 202410 Mar 2027
850renfrew-painting.comGoDaddy.com, LLC15 Mar 202420 Mar 202515 Mar 2026
851renfrewshirelandscapesandgeneralbuilders.co.uk-20 Mar 202421 Mar 202420 Mar 2025
852renfrewshirelandscapesandgeneralbuilders.uk-20 Mar 202421 Mar 202420 Mar 2025
853renfrewshirenowinnofeesolicitors.co.uk-3 Apr 20243 Apr 20243 Apr 2025
854renfrewvet.comHostinger, UAB10 Apr 202429 Nov 202410 Apr 2026
855renfrewpharmacy.co.uk-19 Sep 202317 Oct 202419 Sep 2025
856renfrewshireindustrial.co.uk-20 Oct 202020 Oct 202420 Oct 2025
857renfrewshireorthotics.uk-24 Oct 201725 Oct 202424 Oct 2026
858renfrewdaytoday.comGoDaddy.com, LLC17 Apr 202429 May 202517 Apr 2025
859renfrewpro.ru-16 Feb 2023-16 Feb 2026
860renfrewtile.comAmazon Registrar, Inc.6 Jun 202420 Jul 20256 Jun 2025
861renfrewhomevalue.comGoDaddy.com, LLC21 Jun 202421 Jun 202421 Jun 2027
862renfrewcountynewbuilds.comGoDaddy.com, LLC22 Jun 202429 Jun 202522 Jun 2026
863renfrewtesla.co.uk-11 Jun 202012 Apr 202411 Jun 2025
864renfrewshiretvguy.co.uk-8 Jul 20248 Jul 20248 Jul 2025
865renfrew3d.comAmazon Registrar, Inc.14 Jul 202427 Aug 202514 Jul 2025
866renfrewvillage.ca-20 Feb 202422 Jan 202520 Feb 2026
867renfrewshirewitchhunt1697.co.uk-18 Jul 202418 Jul 202418 Jul 2026
868renfrewshireelectrician.one-23 Jul 202430 Jul 202523 Jul 2025
869renfrewshirealltrades.co.uk-4 Aug 20244 Aug 20244 Aug 2026
870renfrewcenterr.comNameCheap, Inc.20 Aug 202421 Aug 202520 Aug 2025
871renfrewcountyribfest.comNameCheap, Inc.24 Aug 202424 Aug 202524 Aug 2025
872renfrewshiremrc.comGoDaddy.com, LLC26 Aug 202426 Aug 202426 Aug 2027
873renfrewshiremrc.org.uk-26 Aug 202426 Aug 202426 Aug 2027
874renfrewshireheritage.uk-29 Aug 202429 Aug 202429 Aug 2025
875renfrewadventures.comGoDaddy.com, LLC10 Sep 202410 Sep 202410 Sep 2025
876renfrewshireclimate.scotMesh Digital Limited18 Sep 202423 Sep 202418 Sep 2025
877renfrewmnzh.shopPDR Ltd. d/b/a PublicDomainRegistry.com10 Oct 202421 Nov 202410 Oct 2025
878renfrewrimiestrissole.funNameCheap, Inc.17 Oct 202428 Oct 202417 Oct 2025
879renfrewgala2025-buildingourfuture.comGoDaddy.com, LLC17 Oct 202417 Oct 202417 Oct 2025
880renfrewshireschools2.comWild West Domains, LLC27 Oct 202427 Oct 202427 Oct 2025
881renfrewcarbreakers.siteGMO Internet Inc.9 Dec 202418 Dec 20249 Dec 2025
882renfrewcountycleaners.comWix.com Ltd.14 Dec 202414 Dec 202414 Dec 2026
883renfrewcdjr.comGoDaddy.com, LLC30 Dec 202430 Dec 202430 Dec 2025
884renfrewmauldinwedding.comGoDaddy.com, LLC2 Jan 20252 Jan 20252 Jan 2026
885renfrewshirerenegades.org1&1 Internet AG27 Jan 202511 Feb 202527 Jan 2026
886renfrewgaragesale.comGoDaddy.com, LLC11 Feb 202511 Feb 202511 Feb 2027
887renfrewgrazing.comCloudFlare, Inc.12 Feb 202517 Feb 202512 Feb 2035
888renfrewmedicalgroup.ca-22 Mar 202222 Mar 202522 Mar 2026
889renfrewwellness.orgGoDaddy.com, LLC21 Feb 202526 Feb 202521 Feb 2026
890renfrewwellness.comGoDaddy.com, LLC21 Feb 202521 Feb 202521 Feb 2026
891renfrewwellness.co.uk-21 Feb 202521 Feb 202521 Feb 2026
892renfrewshireba.co.uk-5 Mar 20255 Mar 20255 Mar 2026
893renfrewshireroadsurfacing.co.uk-11 Mar 202511 Mar 202511 Mar 2026
894renfrew-transport-solutions.co.uk-10 Apr 202510 Apr 202510 Apr 2026
895renfrewserver.clickNameCheap, Inc.12 May 202517 May 202512 May 2026
896renfrewnext.comGoogle, Inc.21 May 202521 May 202521 May 2026
897renfrewvicsyfc.co.uk-28 May 202528 May 202528 May 2026
898renfrewshirevolleyball.org1&1 Internet AG31 May 20255 Jun 202531 May 2026
899renfrew-river.orgDreamHost, LLC22 Jun 202527 Jun 202522 Jun 2026
900renfrewriver.orgDreamHost, LLC22 Jun 202527 Jun 202522 Jun 2026
901renfrew-river.comDreamHost, LLC22 Jun 202522 Jun 202522 Jun 2026
902renfrewriver.comDreamHost, LLC22 Jun 202522 Jun 202522 Jun 2026
903renfrewbridge.infoCloudFlare, Inc.29 Jun 20256 Jul 202529 Jun 2027
904renfrewcountypublicsafety.comCloudFlare, Inc.30 Jun 20256 Jul 202530 Jun 2026
905renfrewshiretrailers.co.uk-18 Jul 202518 Jul 202518 Jul 2028
906renfrewparalegalservices.comGoDaddy.com, LLC6 Aug 20256 Aug 20256 Aug 2026
907renfrewbridge.co.uk-10 Aug 202510 Aug 202510 Aug 2026
908renfrewshiregutterservices.comRegister.it SPA12 Aug 202512 Aug 202512 Aug 2026
909renfrewbasketball.comGoDaddy.com, LLC16 Aug 202516 Aug 202516 Aug 2028
910renfrewcrane.work-2 Sep 20252 Sep 20252 Sep 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=renfrew

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now