With support for 
Keyword: PTD
Reverse Whois » KEYWORD [ptd ] { 6,636 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | ptd.com.cn | - | 17 Feb 2004 | - | 17 Feb 2013 |
| 2 | ptd.net | Tucows Domains Inc. | 4 Aug 1994 | 8 May 2023 | 3 Aug 2028 |
| 3 | ptd.info | - | 9 Jun 2025 | 4 Jul 2025 | 9 Jun 2026 |
| 4 | ptd.co | Porkbun, LLC | 21 Jul 2010 | 24 Jul 2025 | 20 Jul 2026 |
| 5 | ptd.name | - | - | - | - |
| 6 | ptd.wang | Xin Net Technology Corporation | 29 Jun 2014 | 31 May 2025 | 29 Jun 2026 |
| 7 | ptd.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 12 Jun 2015 | 14 Jun 2017 | 12 Jun 2018 |
| 8 | ptd.pics | Namesilo, LLC | 16 Mar 2023 | 17 Mar 2025 | 16 Mar 2026 |
| 9 | ptd.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Aug 2015 | - | 1 Aug 2016 |
| 10 | ptd.site | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Oct 2015 | 5 Mar 2018 | 14 Oct 2018 |
| 11 | ptd.org | GoDaddy.com, LLC | 5 Apr 2001 | 21 Mar 2025 | 5 Apr 2026 |
| 12 | ptd.com | Dynadot, LLC | 4 Mar 1996 | 31 Jul 2025 | 5 Mar 2026 |
| 13 | ptd.one | Porkbun, LLC | 11 Jul 2022 | 15 Jul 2025 | 11 Jul 2026 |
| 14 | ptd.link | Hangzhou AiMing Network Co., LTD | 30 Oct 2017 | - | 30 Oct 2018 |
| 15 | ptd.kim | West263 International Limited | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 16 | ptd.mobi | West263 International Limited | 16 Nov 2015 | - | 16 Nov 2016 |
| 17 | ptd.red | West263 International Limited | 28 Nov 2015 | 19 May 2017 | 28 Nov 2017 |
| 18 | ptd.online | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 16 Dec 2015 | 25 Apr 2017 | 16 Dec 2017 |
| 19 | ptd.club | EJEE Group Holdings Limited | 16 Dec 2015 | 20 Jan 2020 | 15 Dec 2020 |
| 20 | ptd.website | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Feb 2017 | 9 Jun 2017 | 20 Feb 2018 |
| 21 | ptd.space | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Feb 2017 | - | 20 Feb 2018 |
| 22 | ptd.lol | Porkbun, LLC | 25 Aug 2023 | 11 Jul 2025 | 25 Aug 2029 |
| 23 | ptd.tech | Chengdu West Dimension Digital Technology Co., Ltd… | 12 Jan 2016 | 18 Jan 2017 | 12 Jan 2018 |
| 24 | ptd.news | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 10 Jan 2016 | 14 Aug 2017 | 10 Jan 2018 |
| 25 | ptd.asia | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 26 May 2024 | 2 Aug 2025 | 26 May 2025 |
| 26 | ptd.help | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Jan 2016 | - | 17 Jan 2017 |
| 27 | ptd.black | West263 International Limited | 19 Feb 2016 | - | 19 Feb 2017 |
| 28 | ptd.pink | West263 International Limited | 29 Feb 2016 | - | 28 Feb 2017 |
| 29 | ptd.blue | Namesilo, LLC | 12 Sep 2021 | 12 Sep 2023 | 12 Sep 2024 |
| 30 | ptd.ink | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 11 Nov 2017 | 12 Nov 2017 | 11 Nov 2018 |
| 31 | ptd.gift | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Mar 2016 | 16 Mar 2017 | 2 Mar 2017 |
| 32 | ptd.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 Jun 2016 | 5 Nov 2017 | 16 Jun 2022 |
| 33 | ptd.science | Alpnames Limited | 25 Feb 2015 | 21 May 2016 | 24 Feb 2017 |
| 34 | ptd.in | NETIM SARL | 16 Jan 2007 | 17 Oct 2024 | 16 Jan 2026 |
| 35 | ptd.biz | Chengdu West Dimension Digital Technology Co., Ltd… | 15 Apr 2019 | 15 Apr 2020 | 15 Apr 2020 |
| 36 | ptd.design | Network Solutions, LLC | 25 Aug 2016 | 29 Sep 2017 | 25 Aug 2017 |
| 37 | ptd.store | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Oct 2016 | 3 Nov 2017 | 1 Oct 2017 |
| 38 | ptd.pet | Web Commerce Communications Limited dba WebNic.cc | 4 Oct 2016 | 14 Nov 2017 | 4 Oct 2018 |
| 39 | ptd.de | - | - | 23 May 2023 | - |
| 40 | ptd.eu | - | - | - | - |
| 41 | ptd.dk | - | 10 Jan 2001 | - | 31 Mar 2026 |
| 42 | ptd.fr | - | 26 Jun 2006 | 17 Apr 2025 | 25 May 2026 |
| 43 | ptd.me | Dynadot, LLC | 13 Sep 2017 | 14 Nov 2017 | 13 Sep 2018 |
| 44 | ptd.co.uk | - | 29 Dec 2003 | 16 Jan 2025 | 29 Dec 2025 |
| 45 | ptd.ch | - | - | - | - |
| 46 | ptd.cloud | Tucows Domains Inc. | 15 Nov 2016 | 19 Nov 2017 | 15 Nov 2017 |
| 47 | ptd.bet | Name.com, Inc. | 28 Aug 2023 | 28 Aug 2023 | 28 Aug 2024 |
| 48 | ptd.uk | - | 29 Sep 2017 | 15 Oct 2024 | 29 Sep 2025 |
| 49 | ptd.photos | Google, Inc. | 1 Mar 2018 | 3 Jun 2025 | 1 Mar 2026 |
| 50 | ptd.land | GoDaddy.com, LLC | 22 Jun 2018 | 22 Jun 2018 | 22 Jun 2019 |
| 51 | ptd.life | Namesilo, LLC | 16 Feb 2024 | 23 Mar 2025 | 16 Feb 2025 |
| 52 | ptd.services | GoDaddy.com, LLC | 14 May 2021 | 31 Aug 2024 | 14 May 2027 |
| 53 | ptd.photography | Namesilo, LLC | 18 Mar 2019 | 21 May 2025 | 18 Mar 2025 |
| 54 | ptd.solutions | GoDaddy.com, LLC | 19 May 2024 | 30 Jun 2025 | 19 May 2025 |
| 55 | ptd.vin | NameCheap, Inc. | 7 Nov 2019 | 7 Nov 2023 | 7 Nov 2024 |
| 56 | ptd.digital | Hostinger, UAB | 16 May 2024 | 24 Apr 2025 | 16 May 2026 |
| 57 | ptd.wiki | Porkbun, LLC | 11 Jul 2022 | 15 Jul 2025 | 11 Jul 2026 |
| 58 | ptd.center | GoDaddy.com, LLC | 29 Jul 2020 | 30 Jul 2025 | 29 Jul 2026 |
| 59 | ptd.media | GoDaddy.com, LLC | 28 Dec 2020 | 11 Feb 2022 | 28 Dec 2022 |
| 60 | ptd.zone | GoDaddy.com, LLC | 18 Oct 2021 | 18 Oct 2021 | 18 Oct 2022 |
| 61 | ptd.agency | GoDaddy.com, LLC | 14 Dec 2021 | 14 Dec 2021 | 14 Dec 2022 |
| 62 | ptd.global | GoDaddy.com, LLC | 14 Dec 2021 | 14 Dec 2021 | 14 Dec 2022 |
| 63 | ptd.contact | Name.com, Inc. | 14 Mar 2022 | 14 Mar 2022 | 14 Mar 2023 |
| 64 | ptd.net.au | - | - | 1 Jun 2025 | - |
| 65 | ptd.com.pl | Namware.com, Inc. | 27 Mar 2025 | 27 Mar 2025 | 27 Mar 2026 |
| 66 | ptd.edu.pl | home.pl S.A. | 17 Jul 2008 | 27 Jun 2024 | 17 Jul 2026 |
| 67 | ptd.app | NameKing.com Inc. | 8 May 2018 | 8 May 2025 | 8 May 2026 |
| 68 | ptd.org.pl | Namware.com, Inc. | 16 Jul 2010 | 26 May 2025 | 16 Jul 2026 |
| 69 | ptd.cc | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Nov 2014 | 7 Mar 2025 | 20 Mar 2026 |
| 70 | ptd.pl | home.pl S.A. | 6 Feb 2007 | 15 Jan 2025 | 6 Feb 2026 |
| 71 | ptd.studio | Crazy Domains FZ-LLC | 4 Feb 2023 | 27 Nov 2023 | 4 Feb 2026 |
| 72 | ptd.aero | Regional Network Information Center, JSC dba RU-CE… | 24 May 2018 | 26 Jun 2025 | 24 May 2025 |
| 73 | ptd.ngo | Porkbun, LLC | 27 Nov 2023 | 10 Jan 2025 | 27 Nov 2024 |
| 74 | ptd.pt | - | 9 Aug 2014 | - | 9 Jul 2026 |
| 75 | ptd.fyi | Namesilo, LLC | 16 Mar 2023 | 18 Apr 2024 | 16 Mar 2024 |
| 76 | ptd.pictures | Namesilo, LLC | 16 Mar 2023 | 18 Apr 2024 | 16 Mar 2024 |
| 77 | ptd.camera | Namesilo, LLC | 19 Mar 2023 | 25 May 2024 | 19 Mar 2024 |
| 78 | ptd.group | Regional Network Information Center, JSC dba RU-CE… | 31 Mar 2023 | 4 Apr 2025 | 31 Mar 2026 |
| 79 | ptd.io | NameKing.com Inc. | 14 Jan 2016 | 5 May 2025 | 14 Jan 2026 |
| 80 | ptd.jp | - | 1 Apr 2022 | 22 May 2025 | 30 Apr 2026 |
| 81 | ptd.law | eNom, Inc. | 16 Feb 2017 | 20 Feb 2025 | 16 Feb 2026 |
| 82 | ptd.com.hr | - | 11 Sep 2018 | 4 Dec 2018 | 11 Sep 2023 |
| 83 | ptd.icu | NameCheap, Inc. | 6 Aug 2023 | 7 Aug 2025 | 6 Aug 2026 |
| 84 | ptd.lat | Porkbun, LLC | 27 Aug 2023 | 10 Oct 2024 | 27 Aug 2024 |
| 85 | ptd.cat | Dinahosting s.l. | 4 Oct 2023 | 13 Nov 2024 | 4 Oct 2024 |
| 86 | ptd.foundation | NameCheap, Inc. | 17 Nov 2023 | 3 Dec 2024 | 17 Nov 2025 |
| 87 | ptd.directory | Amazon Registrar, Inc. | 3 Feb 2024 | 9 Sep 2024 | 3 Feb 2025 |
| 88 | ptd.ru | - | 13 Dec 2000 | - | 15 Dec 2025 |
| 89 | ptd.cz | - | 11 Sep 2003 | 19 Dec 2024 | 11 Sep 2025 |
| 90 | ptd.se | - | 17 Jul 2011 | 19 Jun 2025 | 17 Jul 2026 |
| 91 | ptd.us | TLD Registrar Solutions Ltd. | 5 Jun 2004 | 7 Jun 2025 | 4 Jun 2026 |
| 92 | ptd.com.au | - | - | 4 Jan 2025 | - |
| 93 | ptd.onl | Porkbun, LLC | 8 Sep 2024 | 28 Jun 2025 | 8 Sep 2029 |
| 94 | ptd.world | Marcaria.com International, Inc. | 3 Oct 2024 | 10 Apr 2025 | 3 Oct 2029 |
| 95 | ptd.taipei | Net-Chinese Co., Ltd. | 26 Dec 2024 | 31 Dec 2024 | 26 Dec 2025 |
| 96 | ptd.web.id | Reserved | 9 Jan 2025 | - | 9 Jan 2026 |
| 97 | ptd.nz | - | 8 Jun 2017 | 22 Jul 2025 | - |
| 98 | ptd.ooo | Porkbun, LLC | 6 Mar 2025 | 11 Jul 2025 | 6 Mar 2029 |
| 99 | ptd.co.in | Dynadot, LLC | 27 Apr 2018 | 29 Jun 2025 | 27 Apr 2026 |
| 100 | ptd.au | - | - | 21 Jun 2025 | - |
| 101 | ptd.guru | NameCheap, Inc. | 25 Jul 2025 | 25 Jul 2025 | 25 Jul 2026 |
| 102 | ptd.trading | Porkbun, LLC | 26 Jul 2025 | 26 Jul 2025 | 26 Jul 2026 |
| 103 | ptd.im | - | - | - | - |
| 104 | ptd.ro | - | 1 Dec 2018 | - | 29 Nov 2025 |
| 105 | ptd.dev | OVH sas | 15 Sep 2025 | 15 Sep 2025 | 15 Sep 2026 |
| 106 | ptd1.com | Eranet International Limited | 13 Apr 2025 | 13 Apr 2025 | 13 Apr 2026 |
| 107 | ptdfmy.com | GoDaddy.com, LLC | 30 Apr 2019 | 30 Apr 2019 | 30 Apr 2020 |
| 108 | ptdfinanse.pl | Namware.com, Inc. | 24 Nov 2017 | 24 Nov 2024 | 24 Nov 2025 |
| 109 | ptdgroupco.com | Dynadot, LLC | 10 Nov 2021 | 20 Jan 2022 | 10 Nov 2022 |
| 110 | ptdd.com | HiChina Zhicheng Technology Limited | 6 Nov 2003 | 23 Nov 2022 | 6 Nov 2027 |
| 111 | ptd1111.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Sep 2018 | 20 Aug 2025 | 29 Sep 2025 |
| 112 | ptdirect.com | Crazy Domains FZ-LLC | 30 Aug 2004 | 15 Aug 2023 | 30 Aug 2028 |
| 113 | ptdocz.com | Limited Liability Company "Registrar of domain nam… | 14 Jan 2015 | 16 Jan 2025 | 14 Jan 2026 |
| 114 | ptdtrading.com | GoDaddy.com, LLC | 23 Sep 2013 | 20 Sep 2024 | 23 Sep 2025 |
| 115 | ptdyxh.com | Xin Net Technology Corporation | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 116 | ptdtandg.com | Omnis Network, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 117 | ptdas.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jun 2018 | 5 Jun 2020 | 11 Jun 2026 |
| 118 | ptdrw.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Apr 2024 | 7 Sep 2025 | 17 Apr 2026 |
| 119 | ptdsjl.com | Xin Net Technology Corporation | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 120 | ptdrnl.com | Tucows Domains Inc. | 23 Oct 2014 | 27 Oct 2015 | 23 Oct 2016 |
| 121 | ptdatbeo.com | Domain.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 122 | ptdb.info | CommuniGal Communication Ltd. | - | - | 23 Jun 2026 |
| 123 | ptdunlimited.com | DropCatch.com 628 LLC | 11 Jan 2019 | 11 Jan 2019 | 11 Jan 2020 |
| 124 | ptdhxx.com | Whiteglove Domains, Incorporated | 24 Feb 2025 | 5 Mar 2025 | 24 Feb 2026 |
| 125 | ptdghd.com | Realtime Register B.V. | 13 Sep 2022 | 25 Oct 2023 | 13 Sep 2023 |
| 126 | ptdunlimited.info | GoDaddy.com, LLC | 25 Oct 2014 | 26 Oct 2016 | 25 Oct 2018 |
| 127 | ptdbmcybz.com | GoDaddy.com, LLC | 25 May 2014 | 26 May 2015 | 25 May 2016 |
| 128 | ptdesign.org | 1&1 Internet AG | 10 Nov 2020 | 25 Dec 2024 | 10 Nov 2025 |
| 129 | ptdunlimited.org | GoDaddy.com, LLC | 25 Oct 2014 | 26 Oct 2016 | 25 Oct 2018 |
| 130 | ptdunlimited.net | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2016 |
| 131 | ptdcz.com | Namesilo, LLC | 26 Aug 2022 | 11 Sep 2024 | 26 Aug 2024 |
| 132 | ptdataconsult.com | GoDaddy.com, LLC | 31 May 2008 | 1 Jun 2015 | 31 May 2016 |
| 133 | ptdht.com | Key-Systems GmbH | 21 Mar 2025 | 21 Mar 2025 | 21 Mar 2026 |
| 134 | ptdirectorio.com | Tucows Domains Inc. | 2 Nov 2017 | 6 Nov 2018 | 2 Nov 2018 |
| 135 | ptdagency.com | iNET CORPORATION | 13 Sep 2022 | 13 Sep 2022 | 13 Sep 2023 |
| 136 | ptdouglas.info | GMO Internet Inc. | 2 Sep 2015 | - | 2 Sep 2016 |
| 137 | ptdjob.com | Eranet International Limited | 4 Nov 2021 | 11 Dec 2023 | 4 Nov 2023 |
| 138 | ptdmkxh.com | register.com, Inc. | 29 Jul 2014 | 27 Oct 2014 | 29 Jul 2015 |
| 139 | ptdarkrifles.com | Tucows Domains Inc. | 24 Oct 2012 | 28 Oct 2014 | 24 Oct 2015 |
| 140 | ptdiy.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Nov 2021 | 19 Jan 2025 | 19 Nov 2025 |
| 141 | ptdf.org | - | 17 Mar 2024 | 1 May 2025 | 17 Mar 2026 |
| 142 | ptdw.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2002 | 27 Aug 2024 | 10 Sep 2025 |
| 143 | ptdomains08.ru | - | - | - | - |
| 144 | ptdszx.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 26 Jun 2025 | 27 Jun 2025 | 26 Jun 2026 |
| 145 | ptdoityourself.net | GoDaddy.com, LLC | 18 Dec 2000 | 27 Dec 2024 | 18 Dec 2025 |
| 146 | ptdiocese.org | Network Solutions, LLC | 18 May 2000 | 24 Mar 2025 | 18 May 2026 |
| 147 | ptdc.org | Network Solutions, LLC | 23 Feb 1996 | 20 Sep 2023 | 24 Feb 2030 |
| 148 | ptdutacahayaalam.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 149 | ptdcinfo.org | Network Solutions, LLC | 7 Dec 2009 | 20 Sep 2023 | 7 Dec 2026 |
| 150 | ptdockyard.com | Wild West Domains, LLC | 29 Sep 2009 | 30 Aug 2024 | 29 Sep 2025 |
| 151 | ptdriverjobs.com | GoDaddy.com, LLC | 13 Oct 2019 | 13 Oct 2019 | 13 Oct 2020 |
| 152 | ptdynai.com | Network Solutions, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 153 | ptdyellow.com | NameCheap, Inc. | 21 Sep 2005 | 22 Aug 2024 | 21 Sep 2025 |
| 154 | ptdq.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 Nov 2014 | 18 Jul 2025 | 3 Nov 2025 |
| 155 | ptdebuchaudhuri.com | GoDaddy.com, LLC | 5 Nov 2014 | 22 Dec 2024 | 5 Nov 2025 |
| 156 | ptdeto.com | GMO Internet Inc. | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 157 | ptdswlc.com | Hangzhou AiMing Network Co., LTD | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2017 |
| 158 | ptdsxy.com | Hangzhou AiMing Network Co., LTD | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2017 |
| 159 | ptduabelassuku.com | CV. Jogjacamp | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 160 | ptdps.com | Amazon Registrar, Inc. | 13 Jul 2025 | 13 Jul 2025 | 13 Jul 2026 |
| 161 | ptdinheiro.com | Beget LLC | 8 Apr 2024 | 15 May 2025 | 8 Apr 2025 |
| 162 | ptdcn.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 5 Feb 2025 | 4 Mar 2025 | 5 Feb 2026 |
| 163 | ptdit.com | Porkbun, LLC | 8 Feb 2023 | 20 Mar 2024 | 8 Feb 2024 |
| 164 | ptdddd.com | Mvpdomainnames.com LLC | 25 Jan 2019 | 26 Jan 2019 | 25 Jan 2020 |
| 165 | ptdreams.com | GoDaddy.com, LLC | 28 Feb 2018 | 27 Feb 2025 | 28 Feb 2030 |
| 166 | ptdllp.net | easyDNS Technologies, Inc. | 22 Aug 2014 | 7 Aug 2025 | 22 Aug 2026 |
| 167 | ptdllp.org | easyDNS Technologies, Inc. | 22 Aug 2014 | 12 Aug 2025 | 22 Aug 2026 |
| 168 | ptd-medical.com | Realtime Register B.V. | 22 Aug 2009 | 24 Aug 2014 | 22 Aug 2016 |
| 169 | ptdp110.com | Xin Net Technology Corporation | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 170 | ptdshoplnwshop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 171 | ptdjarot.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 172 | ptdogs.com | GoDaddy.com, LLC | 26 Aug 2014 | 27 Aug 2024 | 26 Aug 2025 |
| 173 | ptdybwe.com | Network Solutions, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 174 | ptdsx.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Oct 2021 | 21 Aug 2025 | 12 Oct 2025 |
| 175 | ptdmjx.com | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2025 |
| 176 | ptdjkt.com | - | 14 Sep 2023 | 15 Sep 2024 | 14 Sep 2025 |
| 177 | ptdecoranddesign.com | Network Solutions, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 178 | ptdo.org | Metaregistrar BV Applications | 15 Aug 2014 | 15 Aug 2025 | 15 Aug 2026 |
| 179 | ptdanieldaniela.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 180 | ptdsi.org | Name.com, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 181 | ptdhome.com | - | 31 Aug 2014 | 31 Aug 2014 | 1 Sep 2029 |
| 182 | ptdpfag.info | Wild West Domains, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 183 | ptdenglong.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Aug 2016 | 22 Sep 2017 | 11 Aug 2017 |
| 184 | ptdlgs.com | Namesilo, LLC | 24 May 2019 | 25 May 2019 | 24 May 2020 |
| 185 | ptdevin.com | GoDaddy.com, LLC | 9 Jan 2024 | 9 Jan 2024 | 9 Jan 2027 |
| 186 | ptd-mail.com | Cronon AG | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2018 |
| 187 | ptdance.com | TurnCommerce, Inc. DBA NameBright.com | 3 Sep 2014 | 13 Oct 2024 | 3 Sep 2024 |
| 188 | ptdpartners.com | GoDaddy.com, LLC | 3 Sep 2014 | 4 Sep 2025 | 3 Sep 2026 |
| 189 | ptdflooring.com | Crazy Domains FZ-LLC | 17 Sep 2014 | 28 Sep 2021 | 17 Sep 2021 |
| 190 | ptdlqj.com | Xin Net Technology Corporation | 4 Sep 2014 | 30 Sep 2020 | 4 Sep 2021 |
| 191 | ptdbms.com | Tucows Domains Inc. | 18 Nov 2014 | 22 Nov 2016 | 18 Nov 2016 |
| 192 | ptdlc.com | Web Commerce Communications Limited dba WebNic.cc | 9 May 2025 | 6 Aug 2025 | 9 May 2026 |
| 193 | ptdow.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Nov 2022 | 23 Jan 2024 | 11 Nov 2023 |
| 194 | ptdiscovery.com | GoDaddy.com, LLC | 1 Oct 2019 | 19 Feb 2025 | 1 Oct 2025 |
| 195 | ptdrrr.net | Namebay SAM | 10 Aug 2004 | 19 Sep 2014 | 10 Aug 2015 |
| 196 | ptdbxbt.us | - | 6 Sep 2014 | - | 5 Sep 2015 |
| 197 | ptdxski.com | Network Solutions, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2015 |
| 198 | ptdehael.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 199 | ptdelivery.com | DropCatch.com 975 LLC | 24 Jun 2025 | 25 Jun 2025 | 24 Jun 2026 |
| 200 | ptdr.info | GMO Internet Inc. | 30 Mar 2023 | 11 May 2024 | 30 Mar 2024 |
| 201 | ptdsclub.com | Hangzhou AiMing Network Co., LTD | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2016 |
| 202 | ptdivx.com | GMO Internet Inc. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 203 | ptdsj.com | HiChina Zhicheng Technology Limited | 21 Feb 2021 | 22 Feb 2025 | 21 Feb 2026 |
| 204 | ptdindustries.com | DNC Holdings, Inc. | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 205 | ptdindustries.net | DNC Holdings, Inc. | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 206 | ptddatm.com | Network Solutions, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 207 | ptdpromos.com | Tucows Domains Inc. | 10 Sep 2014 | 13 Aug 2024 | 10 Sep 2029 |
| 208 | ptdppsi.us | - | 10 Sep 2014 | - | 9 Sep 2015 |
| 209 | ptdxj.com | DOMAIN NAME NETWORK PTY LTD | 14 Oct 2024 | 14 Oct 2024 | 14 Oct 2025 |
| 210 | ptd2game.com | NameCheap, Inc. | 2 Oct 2014 | 11 Jan 2018 | 2 Oct 2018 |
| 211 | ptdportal.com | GoDaddy.com, LLC | 22 May 2023 | 22 May 2023 | 22 May 2024 |
| 212 | ptdi.com | NameCheap, Inc. | 29 Oct 1997 | 26 Jul 2021 | 28 Oct 2030 |
| 213 | ptdcw.com | eName Technology Co., Ltd. | 5 Oct 2014 | 4 Sep 2024 | 5 Oct 2025 |
| 214 | ptdsports.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 215 | ptdunn.com | eNom, Inc. | 19 Apr 2020 | 13 Apr 2025 | 19 Apr 2026 |
| 216 | ptduw.com | GoDaddy.com, LLC | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 217 | ptdrivingschool.us | Tucows Domains Inc. | 24 Sep 2013 | 27 Sep 2014 | 23 Sep 2014 |
| 218 | ptdnwx.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 6 May 2021 | 7 May 2023 | 6 May 2023 |
| 219 | ptdbutton.com | Key-Systems GmbH | 6 Apr 2023 | 20 May 2024 | 6 Apr 2024 |
| 220 | ptdemire.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Nov 2014 | 23 Nov 2017 | 22 Nov 2018 |
| 221 | ptdashboard.com | Name.com, Inc. | 29 Sep 2014 | 31 Aug 2024 | 29 Sep 2025 |
| 222 | ptdfhbj.com | - | 13 Sep 2023 | 14 Sep 2024 | 13 Sep 2025 |
| 223 | ptdled.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Oct 2018 | 5 Oct 2018 | 5 Oct 2019 |
| 224 | ptdcopier.com | OnlineNIC, Inc. | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 225 | ptdjkkqt.com | GoDaddy.com, LLC | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 226 | ptdyddy.com | eName Technology Co., Ltd. | 16 Jul 2025 | 17 Jul 2025 | 16 Jul 2026 |
| 227 | ptd-expo.com | Network Solutions, LLC | 23 Dec 2018 | 23 Dec 2024 | 23 Dec 2025 |
| 228 | ptdai.net | HiChina Zhicheng Technology Limited | 12 Oct 2014 | 3 Oct 2017 | 12 Oct 2018 |
| 229 | ptdbcways.us | - | 13 Oct 2014 | - | 12 Oct 2015 |
| 230 | ptdx.com | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2028 |
| 231 | ptdtran.us | - | 14 Oct 2014 | - | 13 Oct 2015 |
| 232 | ptdenise.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 233 | ptdeli.com | Beijing Lanhai Jiye Technology Co., Ltd | 1 Jan 2024 | 19 Aug 2025 | 1 Jan 2026 |
| 234 | ptdada.com | eName Technology Co., Ltd. | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 235 | ptdada.net | eName Technology Co., Ltd. | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 236 | ptdxyh.com | Wild West Domains, LLC | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 237 | ptdancv.com | CV. Rumahweb Indonesia | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 238 | ptdetebesccmfitoeyzsglvgq.org | - | 28 Nov 2014 | 12 Jan 2025 | 28 Nov 2025 |
| 239 | ptdirectaccess.com | GoDaddy.com, LLC | 1 Dec 2014 | 19 Dec 2024 | 1 Dec 2025 |
| 240 | ptdevendrasharma.com | GoDaddy.com, LLC | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 241 | ptdiun.com | Xin Net Technology Corporation | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 242 | ptdh-1oo86-jf.com | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 243 | ptdq-7k.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 244 | ptd2.net | Name.com, Inc. | 15 Jun 2023 | 16 Jun 2024 | 15 Jun 2025 |
| 245 | ptdzpf.com | Xin Net Technology Corporation | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 246 | ptdrone.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 16 Aug 2024 | 17 Aug 2025 | 16 Aug 2026 |
| 247 | ptdiamondbackers.org | GoDaddy.com, LLC | 4 Dec 2014 | 15 Jan 2025 | 4 Dec 2024 |
| 248 | ptdsy.com | HiChina Zhicheng Technology Limited | 5 Dec 2014 | 9 Dec 2016 | 5 Dec 2018 |
| 249 | ptdaigou.com | Network Solutions, LLC | 23 Dec 2018 | 23 Dec 2024 | 23 Dec 2025 |
| 250 | ptdaifa.com | HiChina Zhicheng Technology Limited | 23 Jul 2020 | 23 Jul 2020 | 23 Jul 2021 |
| 251 | ptdzg.com | Namesilo, LLC | 19 Jun 2018 | 6 Jun 2025 | 19 Jun 2026 |
| 252 | ptdpg.com | CV. Jogjacamp | 6 Jan 2022 | 6 Jan 2022 | 6 Jan 2023 |
| 253 | ptdhack.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 254 | ptdtest.com | Dynadot6 LLC | 25 Feb 2022 | 7 May 2023 | 25 Feb 2023 |
| 255 | ptdfnigeria.com | eName Technology Co., Ltd. | 28 Nov 2019 | 28 Nov 2019 | 28 Nov 2020 |
| 256 | ptdpobehphkig.info | Reserved for non-billable transactions where Regis… | 15 Dec 2014 | 15 Dec 2020 | 15 Dec 2021 |
| 257 | ptdtv.com | GoDaddy.com, LLC | 7 May 2019 | 7 May 2019 | 7 May 2020 |
| 258 | ptdc-consultants.com | GoDaddy.com, LLC | 17 Dec 2014 | 28 Jan 2025 | 17 Dec 2024 |
| 259 | ptdinali.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 260 | ptdcheshire.com | GoDaddy.com, LLC | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2015 |
| 261 | ptdeerfarm.com | Xin Net Technology Corporation | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 262 | ptdxc.com | West263 International Limited | 12 May 2025 | 12 May 2025 | 12 May 2026 |
| 263 | ptdfhotel.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Dec 2021 | 20 Jan 2025 | 19 Dec 2024 |
| 264 | ptd2sc.com | GoDaddy.com, LLC | 23 Nov 2021 | 4 Feb 2024 | 23 Nov 2023 |
| 265 | ptdyutlar-crotzruse.info | GoDaddy.com, LLC | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 266 | ptduckpcp.com | GMO Internet Inc. | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 267 | ptdaz4cmh5-jt2.com | GMO Internet Inc. | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 268 | ptdtc.com | Eranet International Limited | 1 Apr 2022 | 11 May 2024 | 1 Apr 2024 |
| 269 | ptddir.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2016 |
| 270 | ptdfdc.com | eName Technology Co., Ltd. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 271 | ptdmp.com | Google, Inc. | 1 Jan 2015 | 17 Dec 2024 | 1 Jan 2026 |
| 272 | ptdzp.com | Chengdu West Dimension Digital Technology Co., Ltd… | 4 Dec 2017 | 4 Dec 2017 | 4 Dec 2018 |
| 273 | ptdjw.com | DropCatch.com 627 LLC | 24 May 2018 | 24 May 2018 | 24 May 2019 |
| 274 | ptdaijia.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 Aug 2023 | 18 Jul 2024 | 17 Aug 2027 |
| 275 | ptdyj.com | Eranet International Limited | 9 Aug 2025 | 9 Aug 2025 | 9 Aug 2026 |
| 276 | ptdwebcont.com | EvoPlus Ltd. | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 277 | ptdmu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jan 2015 | 3 Jan 2025 | 4 Jan 2026 |
| 278 | ptd2games.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 279 | ptdinc.xyz | Network Solutions, LLC | 25 Jul 2014 | 25 Jul 2014 | 25 Jul 2015 |
| 280 | ptdxdal.xyz | GMO Internet Inc. | 24 Jul 2014 | 25 Jul 2014 | 24 Jul 2015 |
| 281 | ptdap.xyz | Network Solutions, LLC | 25 Jul 2014 | 25 Jul 2014 | 25 Jul 2015 |
| 282 | ptdxh.xyz | Xin Net Technology Corporation | 6 Oct 2014 | - | 6 Oct 2015 |
| 283 | ptdpn.xyz | Xin Net Technology Corporation | 6 Oct 2014 | - | 6 Oct 2015 |
| 284 | ptdd.xyz | Dynadot, LLC | 13 Aug 2023 | 23 Sep 2024 | 13 Aug 2024 |
| 285 | ptdre.xyz | Xin Net Technology Corporation | 18 Oct 2014 | - | 18 Oct 2015 |
| 286 | ptdprcoal.com | CV. Rumahweb Indonesia | 11 Aug 2015 | 27 Aug 2015 | 11 Aug 2016 |
| 287 | ptdc97.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 288 | ptdesign.nyc | GoDaddy.com, LLC | 29 Oct 2014 | 3 Nov 2024 | 28 Oct 2025 |
| 289 | ptdtxo.xyz | Foshan YiDong Network Co., LTD | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 290 | ptdylc.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 291 | ptdgz.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 292 | ptdtfigxqn.blue | GMO Internet Inc. | 7 Feb 2015 | - | 7 Feb 2016 |
| 293 | ptdirectory.london | Mesh Digital Limited | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 294 | ptdk.wang | eName Technology Co., Ltd. | 18 Mar 2015 | 14 Jun 2017 | 18 Mar 2018 |
| 295 | ptdjrhh.science | Alpnames Limited | 10 Apr 2015 | 10 Apr 2015 | 9 Apr 2016 |
| 296 | ptdlooink.review | Alpnames Limited | 13 Aug 2015 | - | 12 Aug 2016 |
| 297 | ptdingfeng.com | GMO Internet Inc. | 24 Oct 2021 | 25 Oct 2021 | 24 Oct 2022 |
| 298 | ptdevts01.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 299 | ptdafa888.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 300 | ptdpntfd.science | Alpnames Limited | 14 Apr 2015 | 14 Apr 2015 | 13 Apr 2016 |
| 301 | ptdht.science | Alpnames Limited | 17 Apr 2015 | - | 16 Apr 2016 |
| 302 | ptdsth.science | Alpnames Limited | 23 Apr 2015 | - | 22 Apr 2016 |
| 303 | ptdnd7.science | Alpnames Limited | 22 Apr 2015 | 22 Apr 2015 | 21 Apr 2016 |
| 304 | ptd1pr.science | Alpnames Limited | 22 Apr 2015 | 23 Apr 2015 | 21 Apr 2016 |
| 305 | ptdokq.science | Alpnames Limited | 23 Apr 2015 | 23 Apr 2015 | 22 Apr 2016 |
| 306 | ptdvb1.science | Alpnames Limited | 28 Apr 2015 | 28 Apr 2015 | 27 Apr 2016 |
| 307 | ptdjkoneday84.science | GMO Internet Inc. | 29 Apr 2015 | 29 Apr 2015 | 28 Apr 2016 |
| 308 | ptdznh.science | Alpnames Limited | 28 Apr 2015 | 28 Apr 2015 | 27 Apr 2016 |
| 309 | ptdthh.science | Alpnames Limited | 30 Apr 2015 | 30 Apr 2015 | 29 Apr 2016 |
| 310 | ptdroac.science | Alpnames Limited | 5 May 2015 | 5 May 2015 | 4 May 2016 |
| 311 | ptdumevillage.com | Network Solutions, LLC | 7 Jan 2015 | 8 Nov 2024 | 7 Jan 2026 |
| 312 | ptdd.net | Google, Inc. | 27 Nov 2022 | 4 Dec 2024 | 27 Nov 2025 |
| 313 | ptdmc.com | eNom, Inc. | 14 Aug 2015 | 15 Jul 2025 | 14 Aug 2026 |
| 314 | ptdmpl.com | GoDaddy.com, LLC | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 315 | ptdkf.com | Hefei Juming Network Technology Co., Ltd | 11 Oct 2022 | 12 Oct 2023 | 11 Oct 2024 |
| 316 | ptdevcloud.com | MarkMonitor Inc. | 9 Jan 2015 | 8 Dec 2024 | 9 Jan 2026 |
| 317 | ptdtech.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Jan 2015 | 12 Apr 2025 | 11 Jan 2026 |
| 318 | ptdrillingproducts.com | Tucows Domains Inc. | 13 Jan 2015 | 26 Nov 2018 | 13 Jan 2019 |
| 319 | ptdiagnosis.com | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2018 |
| 320 | ptdiagnosis.org | GoDaddy.com, LLC | 15 Jan 2015 | 17 Mar 2015 | 15 Jan 2018 |
| 321 | ptdiagnosis.net | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2018 |
| 322 | ptdiagnosis.info | GoDaddy.com, LLC | 15 Jan 2015 | 17 Mar 2015 | 15 Jan 2018 |
| 323 | ptds.wang | eName Technology Co., Ltd. | 30 Nov 2016 | 16 Dec 2016 | 30 Nov 2017 |
| 324 | ptdh.party | Alpnames Limited | 15 May 2015 | - | 14 May 2016 |
| 325 | ptdlx.party | Alpnames Limited | 13 May 2015 | - | 12 May 2016 |
| 326 | ptdbkb.party | Alpnames Limited | 13 May 2015 | - | 12 May 2016 |
| 327 | ptd9u.party | Alpnames Limited | 17 May 2015 | 17 May 2015 | 16 May 2016 |
| 328 | ptdv.party | Alpnames Limited | 16 May 2015 | - | 15 May 2016 |
| 329 | ptdjj.party | Alpnames Limited | 16 May 2015 | - | 15 May 2016 |
| 330 | ptdhvq.webcam | Alpnames Limited | 18 May 2015 | - | 17 May 2016 |
| 331 | ptdy.webcam | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 May 2015 | 22 May 2015 | 20 May 2016 |
| 332 | ptdq.wang | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 22 May 2015 | 29 Jun 2017 | 29 Jun 2017 |
| 333 | ptdbt.party | Alpnames Limited | 26 May 2015 | - | 25 May 2016 |
| 334 | ptdttp.party | Alpnames Limited | 25 May 2015 | 25 May 2015 | 24 May 2016 |
| 335 | ptdbj.webcam | Alpnames Limited | 2 Jun 2015 | - | 1 Jun 2016 |
| 336 | ptdrg.xyz | GoDaddy.com, LLC | 5 Jun 2015 | 6 Jun 2025 | 5 Jun 2026 |
| 337 | ptdmu.pics | Uniregistrar Corp | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
| 338 | ptdtoz.date | Alpnames Limited | 17 Aug 2015 | - | 16 Aug 2016 |
| 339 | ptdilloway.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 3 Oct 2021 | 3 Oct 2021 | 3 Oct 2022 |
| 340 | ptdg.click | Uniregistrar Corp | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 341 | ptdfu.click | Uniregistrar Corp | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 342 | ptdlph.date | Alpnames Limited | 4 Aug 2015 | - | 3 Aug 2016 |
| 343 | ptdxp.space | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2016 |
| 344 | ptdfc.date | Alpnames Limited | 3 Aug 2015 | - | 2 Aug 2016 |
| 345 | ptdzvj.date | Alpnames Limited | 6 Aug 2015 | - | 5 Aug 2016 |
| 346 | ptdjd.date | Alpnames Limited | 7 Aug 2015 | - | 6 Aug 2016 |
| 347 | ptdnql.date | Alpnames Limited | 8 Aug 2015 | - | 7 Aug 2016 |
| 348 | ptdmsolutionscom.com | GoDaddy.com, LLC | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 349 | ptdyw.com | HiChina Zhicheng Technology Limited | 4 Jan 2012 | 17 Jul 2025 | 4 Jan 2027 |
| 350 | ptds123.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Mar 2021 | 19 May 2024 | 17 Mar 2024 |
| 351 | ptddw.com | HiChina Zhicheng Technology Limited | 26 Aug 2019 | 27 Aug 2019 | 26 Aug 2020 |
| 352 | ptdxkf.com | 35 Technology Co., Ltd. | 21 Jan 2015 | - | 21 Jan 2018 |
| 353 | ptdhw.cricket | Alpnames Limited | 17 Aug 2015 | - | 16 Aug 2016 |
| 354 | ptdckliy.net | GMO Internet Inc. | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 355 | ptdwetya.net | GMO Internet Inc. | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 356 | ptd123.com | Dynadot, LLC | 25 Jan 2015 | 6 Mar 2025 | 25 Jan 2026 |
| 357 | ptduit.com | HiChina Zhicheng Technology Limited | 9 Apr 2020 | 10 Apr 2020 | 9 Apr 2021 |
| 358 | ptduapilarmandiri.com | DROPCATCH.COM 762 LLC | 3 Nov 2020 | 3 Nov 2020 | 3 Nov 2021 |
| 359 | ptd07o.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 May 2015 | 6 May 2015 | 5 May 2016 |
| 360 | ptdzp.party | Alpnames Limited | 8 May 2015 | 8 May 2015 | 7 May 2016 |
| 361 | ptdtv.party | Alpnames Limited | 9 May 2015 | - | 8 May 2016 |
| 362 | ptdxf.party | Alpnames Limited | 10 May 2015 | - | 9 May 2016 |
| 363 | ptdrt.party | Alpnames Limited | 10 May 2015 | - | 9 May 2016 |
| 364 | ptdbh.party | Alpnames Limited | 10 May 2015 | 10 May 2015 | 9 May 2016 |
| 365 | ptdt.party | Alpnames Limited | 12 May 2015 | - | 11 May 2016 |
| 366 | ptdnl.party | Alpnames Limited | 11 May 2015 | - | 10 May 2016 |
| 367 | ptdd.party | Alpnames Limited | 12 May 2015 | - | 11 May 2016 |
| 368 | ptdestek.com | NameCheap, Inc. | 28 Oct 2018 | 10 Oct 2024 | 28 Oct 2025 |
| 369 | ptdamoonhwa.org | Gabia, Inc. | 17 Jan 2012 | 4 Feb 2016 | 17 Jan 2017 |
| 370 | ptdccw.com | Tucows Domains Inc. | 2 Feb 2015 | 1 Feb 2025 | 2 Feb 2026 |
| 371 | ptd99.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Mar 2024 | 22 Jul 2025 | 20 Mar 2026 |
| 372 | ptd0fl5r187c.click | GMO Internet Inc. | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 373 | ptdyzj.com | GoDaddy.com, LLC | 2 Feb 2015 | 3 Feb 2015 | 2 Feb 2016 |
| 374 | ptdccw.org | Tucows Domains Inc. | 2 Feb 2015 | 6 Feb 2025 | 2 Feb 2026 |
| 375 | ptdsg.com | Global Domain Name Trading Center Ltd | 19 Jan 2024 | 8 Feb 2025 | 19 Jan 2026 |
| 376 | ptd3bjdxztw.org | GMO Internet Inc. | 3 Feb 2015 | - | 3 Feb 2016 |
| 377 | ptdsu.com | Google, Inc. | 27 Sep 2021 | 12 Sep 2024 | 27 Sep 2025 |
| 378 | ptdti.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Nov 2020 | 9 Nov 2020 | 9 Nov 2022 |
| 379 | ptdhawaii.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2017 |
| 380 | ptdapparel.com | Tucows Domains Inc. | 21 Aug 2015 | 25 Aug 2019 | 21 Aug 2019 |
| 381 | ptdap.net | eNom, Inc. | 20 Aug 2015 | 22 Jul 2017 | 20 Aug 2017 |
| 382 | ptdrugtest.com | GoDaddy.com, LLC | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 383 | ptdgb.com | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2018 |
| 384 | ptddj.com | Alethia Domains, LLC | 19 Mar 2022 | 2 May 2023 | 19 Mar 2023 |
| 385 | ptdress.com | GMO Internet Inc. | 7 Jun 2020 | 9 May 2025 | 7 Jun 2026 |
| 386 | ptdajiangyulec.com | GoDaddy.com, LLC | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 387 | ptdeendayalsansthan.org | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 22 Aug 2015 | 8 Apr 2017 | 22 Aug 2021 |
| 388 | ptdsyria.org | Key-Systems GmbH | 22 Feb 2015 | 22 Feb 2015 | 22 Feb 2016 |
| 389 | ptdynasty.com | NameCheap, Inc. | 30 Jul 2024 | 7 Aug 2025 | 30 Jul 2026 |
| 390 | ptdistans.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 391 | ptdistance.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 25 Feb 2015 | 23 Jul 2025 | 25 Feb 2026 |
| 392 | ptduc.com | Network Solutions, LLC | 24 Feb 2014 | 26 Feb 2015 | 24 Feb 2016 |
| 393 | ptdjd.com | Dynadot, LLC | 11 Sep 2025 | 11 Sep 2025 | 11 Sep 2026 |
| 394 | ptdbilisim.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 28 Feb 2015 | 3 Mar 2025 | 28 Feb 2026 |
| 395 | ptdbank.com | CSC Corporate Domains, Inc. | 27 Feb 2015 | 23 Feb 2025 | 27 Feb 2027 |
| 396 | ptdyyy.com | Realtime Register B.V. | 17 Oct 2024 | 20 Jul 2025 | 17 Oct 2025 |
| 397 | ptdplease.com | GoDaddy.com, LLC | 12 Oct 2020 | 2 Nov 2022 | 12 Oct 2025 |
| 398 | ptdok.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 Jan 2023 | 8 Jan 2024 | 8 Jan 2025 |
| 399 | ptdue.com | 1&1 Internet AG | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 400 | ptdodikindo.com | CV. Rumahweb Indonesia | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 401 | ptdot.com | TurnCommerce, Inc. DBA NameBright.com | 24 May 2019 | 18 May 2021 | 24 May 2026 |
| 402 | ptdecoracion.com | Acens Technologies, S.L.U. | 6 Mar 2015 | 27 Feb 2025 | 6 Mar 2026 |
| 403 | ptdqp.com | HiChina Zhicheng Technology Limited | 26 May 2020 | 26 Apr 2024 | 26 May 2027 |
| 404 | ptdhl.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 405 | ptdev-construction.com | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 406 | ptdt.racing | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Aug 2015 | - | 23 Aug 2016 |
| 407 | ptdapparel.org | - | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2017 |
| 408 | ptdb.mobi | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Mar 2015 | 8 Mar 2017 | 8 Mar 2018 |
| 409 | ptdmyanmar.com | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2025 | 10 Mar 2027 |
| 410 | ptdmjks.com | Network Solutions, LLC | 7 Mar 2014 | 9 Mar 2015 | 7 Mar 2016 |
| 411 | ptdecorating.info | Tucows Domains Inc. | 5 Mar 2012 | 9 Mar 2015 | 5 Mar 2016 |
| 412 | ptdfj.com | Namesilo, LLC | 19 Jun 2018 | 6 Jun 2025 | 19 Jun 2026 |
| 413 | ptdph.com | HiChina Zhicheng Technology Limited | 8 Apr 2018 | 8 Apr 2018 | 8 Apr 2019 |
| 414 | ptdsparesort.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 18 Mar 2022 | 25 Apr 2024 | 18 Mar 2024 |
| 415 | ptdshinyfinder.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 416 | ptdianshua.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2020 | 28 Jan 2020 | 28 Jan 2021 |
| 417 | ptdian.net | DropCatch.com 1411 LLC | 8 Aug 2022 | 20 Sep 2023 | 8 Aug 2023 |
| 418 | ptdaguer.com | Domain.com, LLC | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2016 |
| 419 | ptdongpu94.com | HiChina Zhicheng Technology Limited | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2016 |
| 420 | ptdsw.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 26 Aug 2015 | - | 26 Aug 2016 |
| 421 | ptdc26.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 422 | ptdjjx.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Apr 2016 | 7 Sep 2025 | 27 Apr 2026 |
| 423 | ptduapuluhlima.com | Tucows Domains Inc. | 19 Mar 2014 | 23 Mar 2015 | 19 Mar 2016 |
| 424 | ptdajili.com | Xin Net Technology Corporation | 18 Aug 2017 | 18 Aug 2017 | 18 Aug 2018 |
| 425 | ptdoverspi.com | Tucows Domains Inc. | 20 Mar 2014 | 24 Mar 2015 | 20 Mar 2016 |
| 426 | ptditra.com | Tucows Domains Inc. | 20 Mar 2014 | 24 Mar 2015 | 20 Mar 2016 |
| 427 | ptd2hacked.com | GoDaddy.com, LLC | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 428 | ptdetailing.com | GoDaddy.com, LLC | 27 Dec 2022 | 28 Dec 2024 | 27 Dec 2025 |
| 429 | ptdumastravel.com | OnlineNIC, Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 430 | ptdnhsw.com | Hefei Juming Network Technology Co., Ltd | 28 Aug 2015 | 22 Aug 2025 | 28 Aug 2026 |
| 431 | ptdfuyin.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 16 Jul 2023 | 24 Jul 2024 | 16 Jul 2024 |
| 432 | ptdnsc.com | HiChina Zhicheng Technology Limited | 29 Mar 2015 | 29 Mar 2015 | 29 Mar 2016 |
| 433 | ptdwc.mobi | GMO Internet Inc. | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 434 | ptdz8.com | GoDaddy.com, LLC | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2017 |
| 435 | ptdsutx.com | GMO Internet Inc. | 30 Mar 2015 | 31 Mar 2015 | 30 Mar 2016 |
| 436 | ptdaishu.com | HiChina Zhicheng Technology Limited | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 437 | ptdasom.com | CV. Jogjacamp | 7 Nov 2016 | 7 Nov 2016 | 1 Apr 2018 |
| 438 | ptdiens.com | Network Solutions, LLC | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2018 |
| 439 | ptdecor.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 May 2023 | 19 May 2023 | 19 May 2028 |
| 440 | ptdboutique.com | GoDaddy.com, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2017 |
| 441 | ptdewataglobalindo.com | Web Commerce Communications Limited dba WebNic.cc | 4 Apr 2015 | 4 Apr 2015 | 4 Apr 2016 |
| 442 | ptdpzrt.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 443 | ptdestudio.com | GoDaddy.com, LLC | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 444 | ptd95sp-kr3.com | GMO Internet Inc. | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 445 | ptdpm.com | PT Biznet GIO Nusantara | 22 Feb 2024 | 25 Mar 2025 | 22 Feb 2026 |
| 446 | ptdc88.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 447 | ptdnykyy.com | HiChina Zhicheng Technology Limited | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 448 | ptdnkqyy.com | HiChina Zhicheng Technology Limited | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 449 | ptdf.net | Gandi SAS | 26 Oct 2023 | 25 Sep 2024 | 26 Oct 2025 |
| 450 | ptdapparel.net | 1&1 Internet AG | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2016 |
| 451 | ptd0.date | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Aug 2015 | - | 28 Aug 2016 |
| 452 | ptduad.us | - | 2 Sep 2015 | - | 1 Sep 2016 |
| 453 | ptddd869.com | GMO Internet Inc. | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 454 | ptd100.com | - | 16 Nov 2022 | 18 Jan 2024 | 16 Nov 2023 |
| 455 | ptdr.mobi | eNom, Inc. | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 456 | ptdprint.com | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 457 | ptdisk.com | eName Technology Co., Ltd. | 31 Aug 2019 | 31 Aug 2019 | 31 Aug 2020 |
| 458 | ptdeendayalupadhyaypublicschool.com | BigRock Solutions Ltd. | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 459 | ptdfm.com | - | - | - | - |
| 460 | ptdajiangylc.com | - | - | - | - |
| 461 | ptdoc.com | GoDaddy.com, LLC | 25 Nov 2016 | 30 Aug 2024 | 25 Nov 2025 |
| 462 | ptdoctors.com | TurnCommerce, Inc. DBA NameBright.com | 4 Dec 2022 | 6 Nov 2024 | 4 Dec 2025 |
| 463 | ptdso.com | Hosting Concepts B.V. dba Openprovider | 11 Dec 2020 | 11 Dec 2020 | 11 Dec 2021 |
| 464 | ptdfdz.com | Xin Net Technology Corporation | 30 Nov 2021 | 30 Nov 2021 | 30 Nov 2022 |
| 465 | ptdzd.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jul 2024 | 17 Jul 2025 | 17 Jul 2026 |
| 466 | ptdefelindomandiri.com | Tucows Domains Inc. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2017 |
| 467 | ptdxjfx.com | - | - | - | - |
| 468 | ptdumnnzkvairjcidihmlnrsl.com | - | - | - | - |
| 469 | ptdo.net | Annulet LLC | 6 Jul 2016 | 29 Apr 2017 | 6 Jul 2018 |
| 470 | ptd-v.com | Hefei Juming Network Technology Co., Ltd | 15 Feb 2023 | 18 Jul 2025 | 15 Feb 2026 |
| 471 | ptdln.com | Realtime Register B.V. | 22 Feb 2022 | 5 May 2023 | 22 Feb 2023 |
| 472 | ptdzyyzc.com | GoDaddy.com, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 473 | ptdspeaks.com | GMO Internet Inc. | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 474 | ptd5.com | Tucows Domains Inc. | 9 Jun 2022 | 20 Aug 2023 | 9 Jun 2023 |
| 475 | ptd3z.review | Xiamen Nawang Technology Co., Ltd | 7 Sep 2015 | 7 Sep 2015 | 6 Sep 2016 |
| 476 | ptditu.com | HiChina Zhicheng Technology Limited | 25 Apr 2015 | 25 Apr 2015 | 25 Apr 2016 |
| 477 | ptdiansaranamedica.com | eNom, Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 478 | ptdzyx.com | Chengdu West Dimension Digital Technology Co., Ltd… | 21 Jul 2017 | 21 Jul 2017 | 21 Jul 2018 |
| 479 | ptdcr.com | DropCatch.com 1378 LLC | 10 May 2022 | 21 Jul 2023 | 10 May 2023 |
| 480 | ptdzpt.com | Chengdu West Dimension Digital Technology Co., Ltd… | 26 May 2019 | 26 May 2019 | 26 May 2020 |
| 481 | ptdaohang.com | Chengdu West Dimension Digital Technology Co., Ltd… | 6 Dec 2023 | 6 Dec 2023 | 6 Dec 2025 |
| 482 | ptdigitaltest.com | FastDomain Inc. | 8 Sep 2015 | 8 Sep 2016 | 8 Sep 2017 |
| 483 | ptdanbo168.com | Bizcn.com, Inc. | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 484 | ptd973.com | Dynadot, LLC | 15 Sep 2023 | 15 Sep 2023 | 15 Sep 2024 |
| 485 | ptdujv.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 486 | ptdn.org | Name.com, Inc. | 9 Sep 2015 | 21 Nov 2024 | 9 Sep 2024 |
| 487 | ptdesiderdewi.com | Tucows Domains Inc. | 5 May 2015 | 5 May 2015 | 5 May 2017 |
| 488 | ptdth.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 21 Jul 2021 | 21 Jul 2021 | 21 Jul 2022 |
| 489 | ptddotnettraining.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 May 2015 | 9 May 2015 | 9 May 2016 |
| 490 | ptdzsw.com | eName Technology Co., Ltd. | 19 Jan 2025 | 18 May 2025 | 19 Jan 2026 |
| 491 | ptdsyndicate.com | GoDaddy.com, LLC | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2017 |
| 492 | ptdds.com | Web Commerce Communications Limited dba WebNic.cc | 6 May 2025 | 3 Oct 2024 | 26 Apr 2026 |
| 493 | ptdn3zz.com | - | - | - | - |
| 494 | ptdyf.com | HiChina Zhicheng Technology Limited | 14 May 2015 | 16 Apr 2017 | 14 May 2018 |
| 495 | ptdecorsolutions.com | Tucows Domains Inc. | 11 May 2009 | 15 May 2015 | 11 May 2016 |
| 496 | ptd3f5z.com | GoDaddy.com, LLC | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 497 | ptdchyd.com | BigRock Solutions Ltd. | 16 May 2015 | 16 Jul 2015 | 16 May 2018 |
| 498 | ptdami.com | - | 16 Oct 2016 | 16 Oct 2016 | 16 Oct 2017 |
| 499 | ptdz3.biz | GMO Internet Inc. | 17 May 2015 | - | 16 May 2016 |
| 500 | ptdtmssc.com | HiChina Zhicheng Technology Limited | 19 May 2015 | 31 Mar 2017 | 19 May 2018 |
| 501 | ptdrt1p.com | GoDaddy.com, LLC | 19 May 2015 | 19 May 2015 | 19 May 2016 |
| 502 | ptdalumni-conference.com | Tucows Domains Inc. | 15 May 2014 | 19 May 2015 | 15 May 2016 |
| 503 | ptdz888.com | eName Technology Co., Ltd. | 19 May 2015 | 18 Apr 2017 | 19 May 2018 |
| 504 | ptdasha.com | GoDaddy.com, LLC | 21 May 2015 | 21 May 2015 | 21 May 2016 |
| 505 | ptd2015asilomar.com | GoDaddy.com, LLC | 21 May 2015 | 21 May 2015 | 21 May 2016 |
| 506 | ptdystrybucja.com | Key-Systems GmbH | 21 May 2015 | 28 Apr 2025 | 21 May 2026 |
| 507 | ptdtmsgy.com | HiChina Zhicheng Technology Limited | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 508 | ptdtradin.com | GoDaddy.com, LLC | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 509 | ptdystrybucja.net | Key-Systems GmbH | 21 May 2015 | 28 Apr 2025 | 21 May 2026 |
| 510 | ptdq.net | Namesilo, LLC | 14 Apr 2023 | 16 Apr 2024 | 14 Apr 2025 |
| 511 | ptdljj.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 Mar 2022 | 14 Mar 2024 | 13 Mar 2025 |
| 512 | ptdtjlm.com | HiChina Zhicheng Technology Limited | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 513 | ptdk.net | Hangzhou AiMing Network Co., LTD | 26 May 2015 | 2 Aug 2016 | 26 May 2018 |
| 514 | ptdikmen.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 515 | ptdeztwhivwqfygezhptmb.biz | - | 29 May 2015 | 13 Jul 2017 | 28 May 2018 |
| 516 | ptd1997.net | P.A. Viet Nam Company Limited | 29 May 2015 | 13 Dec 2016 | 29 May 2017 |
| 517 | ptdq0594.com | - | 23 Feb 2022 | 23 Feb 2022 | 23 Feb 2023 |
| 518 | ptdly.com | Aconcagua Domains LLC | 15 Nov 2024 | 16 Nov 2024 | 15 Nov 2025 |
| 519 | ptdolan.org | GoDaddy.com, LLC | 31 May 2015 | 20 May 2016 | 31 May 2018 |
| 520 | ptdstreetart.com | 1&1 Internet AG | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 521 | ptdomaco.com | Domain.com, LLC | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 522 | ptdminder.com | GMO Internet Inc. | 21 Apr 2025 | 21 Apr 2025 | 21 Apr 2026 |
| 523 | ptdservice.com | GoDaddy.com, LLC | 10 Nov 2022 | 11 Nov 2024 | 10 Nov 2025 |
| 524 | ptdqcw.com | - | 2 Aug 2025 | 2 Aug 2025 | 2 Aug 2026 |
| 525 | ptdgroup.com | TurnCommerce, Inc. DBA NameBright.com | 18 Nov 2016 | 12 Nov 2020 | 18 Nov 2025 |
| 526 | ptder.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 16 Sep 2015 | 17 Sep 2015 | 16 Sep 2016 |
| 527 | ptdent.com | Tucows Domains Inc. | 13 Feb 2024 | 26 Mar 2025 | 13 Feb 2025 |
| 528 | ptdeploy.net | Hetzner Online AG | 5 Jun 2015 | 4 Jun 2025 | 5 Jun 2026 |
| 529 | ptdannyshaw.com | GoDaddy.com, LLC | 7 Jun 2015 | 7 Jun 2015 | 7 Jun 2016 |
| 530 | ptdtestsite.com | FastDomain Inc. | 17 Sep 2015 | 17 Sep 2016 | 17 Sep 2017 |
| 531 | ptdrc.com | Metaregistrar BV Applications | 13 Feb 2025 | 15 Apr 2025 | 13 Feb 2026 |
| 532 | ptde.net | DROPCATCH.COM 784 LLC | 7 Dec 2017 | 7 Dec 2017 | 7 Dec 2018 |
| 533 | ptdap.info | GoDaddy.com, LLC | 11 Jun 2015 | 23 Jun 2017 | 11 Jun 2018 |
| 534 | ptdzyy.com | eName Technology Co., Ltd. | 23 Dec 2016 | 24 Dec 2017 | 23 Dec 2018 |
| 535 | ptdedp.net | GMO Internet Inc. | 18 Sep 2015 | 18 Sep 2015 | 18 Sep 2016 |
| 536 | ptdgeryxucb.com | GMO Internet Inc. | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 537 | ptdy.net | NameCheap, Inc. | 3 Feb 2025 | 3 Feb 2025 | 3 Feb 2026 |
| 538 | ptdpsawah.us | - | 13 Jun 2015 | - | 12 Jun 2016 |
| 539 | ptdp.net | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Nov 2020 | 10 Nov 2020 | 10 Nov 2021 |
| 540 | ptdl.net | Wix.com Ltd. | 15 Feb 2024 | 15 Jun 2024 | 15 Feb 2027 |
| 541 | ptdg.net | Beijing Lanhai Jiye Technology Co., Ltd | 12 Nov 2022 | 13 Nov 2023 | 12 Nov 2024 |
| 542 | ptdfjc.com | HiChina Zhicheng Technology Limited | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 543 | ptdwisurya.com | CV. Rumahweb Indonesia | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 544 | ptdayu.com | Eranet International Limited | 8 Apr 2025 | 8 Apr 2025 | 8 Apr 2026 |
| 545 | ptdiabeteshelp.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 546 | ptdca.org | TLD Registrar Solutions Ltd. | 14 Jun 2015 | 18 Jul 2017 | 14 Jun 2018 |
| 547 | ptdianziyouyi.com | GoDaddy.com, LLC | 20 Sep 2015 | 20 Sep 2015 | 20 Sep 2017 |
| 548 | ptdc92.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2016 |
| 549 | ptdominate.com | 1&1 Internet AG | 21 Jun 2015 | 22 Jun 2016 | 21 Jun 2018 |
| 550 | ptdayofservice.com | Tucows Domains Inc. | 21 Jun 2015 | 12 Jun 2025 | 21 Jun 2026 |
| 551 | ptdayakharisma.com | Network Solutions, LLC | 21 Jun 2015 | 15 Jun 2024 | 21 Jun 2026 |
| 552 | ptdzjedhg.xyz | GMO Internet Inc. | 21 Sep 2015 | - | 21 Sep 2016 |
| 553 | ptdhkscjg.xyz | GMO Internet Inc. | 21 Sep 2015 | - | 21 Sep 2016 |
| 554 | ptdf59.com | OVH sas | 6 Oct 2023 | 7 Oct 2024 | 6 Oct 2025 |
| 555 | ptdzfz.com | Bizcn.com, Inc. | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 556 | ptdjyule.com | Network Solutions, LLC | 2 Dec 2017 | 7 Aug 2019 | 2 Dec 2020 |
| 557 | ptdjgw.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 558 | ptdajiang.com | DropCatch.com 1352 LLC | 11 Sep 2020 | 11 Sep 2020 | 11 Sep 2021 |
| 559 | ptddak.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 27 Nov 2021 | 30 Nov 2021 | 27 Nov 2022 |
| 560 | ptdogbeds.com | HiChina Zhicheng Technology Limited | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 561 | ptdbtzwz.com | Bizcn.com, Inc. | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2016 |
| 562 | ptdallas.com | GoDaddy.com, LLC | 22 Sep 2015 | 23 Sep 2024 | 22 Sep 2025 |
| 563 | ptddak.net | TLDs LLC dba SRSplus | 26 Jun 2015 | 28 Jun 2017 | 26 Jun 2018 |
| 564 | ptdwa.com | GoDaddy.com, LLC | 27 Jun 2015 | 28 Jun 2015 | 27 Jun 2016 |
| 565 | ptdrumlessons.com | GoDaddy.com, LLC | 27 Jun 2015 | 27 Jun 2015 | 27 Jun 2017 |
| 566 | ptdsxx.com | Hangzhou AiMing Network Co., LTD | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2017 |
| 567 | ptdfrcw.com | Dynadot12 LLC | 31 Aug 2021 | 1 Sep 2021 | 31 Aug 2022 |
| 568 | ptdiscoveryday.com | GoDaddy.com, LLC | 1 Jul 2015 | 1 Jul 2015 | 1 Jul 2017 |
| 569 | ptdyh.com | Global Domain Name Trading Center Ltd | 9 Aug 2021 | 9 Aug 2021 | 9 Aug 2022 |
| 570 | ptdvk.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 571 | ptdz.top | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Sep 2015 | 11 Jul 2016 | 24 Sep 2017 |
| 572 | ptdk.top | eName Technology Co., Ltd. | 25 Sep 2015 | 26 Jun 2016 | 25 Sep 2017 |
| 573 | ptdjt.com | EIMS (Shenzhen) Culture & Technology Co., Ltd | 15 Mar 2017 | 9 Aug 2017 | 15 Mar 2018 |
| 574 | ptdh.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Mar 2018 | 16 Apr 2025 | 9 Mar 2025 |
| 575 | ptdd.top | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Sep 2015 | 24 Dec 2015 | 25 Sep 2017 |
| 576 | ptdc.top | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Sep 2015 | 11 Oct 2016 | 24 Sep 2017 |
| 577 | ptdbtz.com | Bizcn.com, Inc. | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2016 |
| 578 | ptdtt.org | eNom, Inc. | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 579 | ptdeli.net | Beijing Lanhai Jiye Technology Co., Ltd | 7 Dec 2022 | 23 Aug 2025 | 7 Dec 2025 |
| 580 | ptd-tro.net | GoDaddy.com, LLC | 5 Jul 2015 | 5 Jul 2015 | 5 Jul 2016 |
| 581 | ptdobma.com | eNom, Inc. | 7 Jul 2015 | 7 Jul 2015 | 7 Jul 2016 |
| 582 | ptdjournal.com | GoDaddy.com, LLC | 1 Jun 2011 | 17 Jun 2025 | 1 Jun 2026 |
| 583 | ptd5wtyj7wl4.com | HiChina Zhicheng Technology Limited | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2016 |
| 584 | ptdongfa.com | HiChina Zhicheng Technology Limited | 24 Mar 2018 | 24 Mar 2018 | 24 Mar 2019 |
| 585 | ptdg.top | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Sep 2015 | 20 Jul 2017 | 25 Sep 2017 |
| 586 | ptdgs.com | CV. Rumahweb Indonesia | 3 Mar 2021 | 19 Feb 2025 | 3 Mar 2026 |
| 587 | ptd888.com | GoDaddy.com, LLC | 14 Dec 2016 | 14 Dec 2016 | 14 Dec 2017 |
| 588 | ptdyy.com | Enomfor, Inc. | 4 Apr 2022 | 12 Apr 2023 | 4 Apr 2024 |
| 589 | ptdajiangyule.com | GoDaddy.com, LLC | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 590 | ptdzjz.com | Bizcn.com, Inc. | 13 Jul 2015 | 13 Jul 2015 | 13 Jul 2016 |
| 591 | ptdy.top | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Sep 2015 | 10 May 2017 | 27 Sep 2017 |
| 592 | ptdx.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 5 Jun 2017 | 26 Sep 2017 |
| 593 | ptdw.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 21 Oct 2016 | 26 Sep 2017 |
| 594 | ptdt.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 3 Mar 2017 | 26 Sep 2017 |
| 595 | ptds.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 5 Jun 2017 | 26 Sep 2017 |
| 596 | ptdr.top | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Sep 2015 | 10 Oct 2016 | 27 Sep 2017 |
| 597 | ptdq.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 24 Dec 2015 | 26 Sep 2017 |
| 598 | ptdp.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 12 Nov 2016 | 26 Sep 2017 |
| 599 | ptdn.top | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Sep 2015 | 9 Dec 2016 | 27 Sep 2017 |
| 600 | ptdm.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 8 May 2017 | 26 Sep 2017 |
| 601 | ptdl.top | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Sep 2015 | 7 Dec 2016 | 27 Sep 2017 |
| 602 | ptdj.top | EIMS (Shenzhen) Culture & Technology Co., Ltd | 26 Sep 2015 | 15 Jul 2016 | 26 Sep 2017 |
| 603 | ptdf.top | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Sep 2015 | 21 Apr 2017 | 27 Sep 2017 |
| 604 | ptdb.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 17 Jul 2017 | 26 Sep 2017 |
| 605 | ptdzf.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 606 | ptdcs.com | One.com A/S | 10 Dec 2019 | 10 Nov 2024 | 10 Dec 2025 |
| 607 | ptd8888.com | HiChina Zhicheng Technology Limited | 26 Sep 2015 | 26 Sep 2015 | 26 Sep 2016 |
| 608 | ptduombfl.us | - | 11 Jul 2015 | - | 10 Jul 2016 |
| 609 | ptdjx.com | Namesilo, LLC | 8 May 2019 | 9 May 2019 | 8 May 2020 |
| 610 | ptdayagunatataduta.com | Hostinger, UAB | 13 Jul 2015 | 13 Jul 2015 | 13 Jul 2016 |
| 611 | ptdfvtz.com | - | - | - | - |
| 612 | ptdc9.com | West263 International Limited | 3 Oct 2016 | 3 Oct 2016 | 3 Oct 2018 |
| 613 | ptdc5.com | West263 International Limited | 3 Oct 2016 | 3 Oct 2016 | 3 Oct 2018 |
| 614 | ptdc2.com | West263 International Limited | 3 Oct 2016 | 3 Oct 2016 | 3 Oct 2018 |
| 615 | ptdc1.com | West263 International Limited | 3 Oct 2016 | 3 Oct 2016 | 3 Oct 2018 |
| 616 | ptdkb.us | - | 14 Jul 2015 | - | 13 Jul 2016 |
| 617 | ptdytj.com | HiChina Zhicheng Technology Limited | 16 Jul 2015 | 16 Jul 2015 | 16 Jul 2016 |
| 618 | ptd56.com | Bizcn.com, Inc. | 16 Jul 2015 | 16 Jul 2015 | 16 Jul 2016 |
| 619 | ptdq.win | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Sep 2015 | 11 Mar 2017 | 26 Sep 2017 |
| 620 | ptdyd.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 621 | ptdxd.com | Eranet International Limited | 3 May 2025 | 21 Jun 2025 | 3 May 2026 |
| 622 | ptdww.com | - | 17 May 2021 | 18 May 2023 | 17 May 2024 |
| 623 | ptdwd.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 624 | ptdtw.com | Beijing Lanhai Jiye Technology Co., Ltd | 6 Mar 2022 | 6 Apr 2023 | 6 Mar 2023 |
| 625 | ptdrd.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Aug 2023 | 14 Aug 2024 | 13 Aug 2024 |
| 626 | ptdqw.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Dec 2019 | 20 Jul 2025 | 2 Dec 2025 |
| 627 | ptdqd.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 628 | ptdq.download | Alpnames Limited | 27 Sep 2015 | 27 Sep 2015 | 26 Sep 2016 |
| 629 | ptdpd.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 630 | ptdnd.com | NameCheap, Inc. | 19 Sep 2020 | 9 Sep 2024 | 19 Sep 2025 |
| 631 | ptdmw.com | - | 2 Apr 2025 | 2 Apr 2025 | 2 Apr 2026 |
| 632 | ptdmd.com | Google, Inc. | 21 Feb 2025 | 21 Feb 2025 | 21 Feb 2026 |
| 633 | ptdlw.com | - | 10 Aug 2021 | 25 Sep 2023 | 10 Aug 2023 |
| 634 | ptdlt.com | HazelDomains, Inc. | 15 Dec 2019 | 17 Dec 2019 | 15 Dec 2020 |
| 635 | ptdld.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 636 | ptdkw.net | eName Technology Co., Ltd. | 27 Sep 2015 | 7 Sep 2016 | 27 Sep 2017 |
| 637 | ptdkd.com | GoDaddy.com, LLC | 6 Aug 2024 | 20 Aug 2025 | 6 Aug 2026 |
| 638 | ptdhd.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 639 | ptdgd.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 640 | ptdfd.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 641 | ptdcd.com | Xin Net Technology Corporation | 23 Aug 2024 | 22 Aug 2025 | 23 Aug 2026 |
| 642 | ptdbw.com | NameJolt.com LLC | 8 Dec 2017 | 8 Dec 2017 | 8 Dec 2018 |
| 643 | ptdbd.com | HiChina Zhicheng Technology Limited | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 644 | ptdz9.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 645 | ptdz7.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 646 | ptdz6.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 647 | ptdz5.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 648 | ptdz3.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 649 | ptdz2.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 650 | ptdz1.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 651 | ptdunrite.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Aug 2023 | 22 Aug 2025 | 21 Aug 2026 |
| 652 | ptdbs.com | eNom, Inc. | 22 Jan 2019 | 15 Jan 2025 | 22 Jan 2026 |
| 653 | ptdc.wang | eName Technology Co., Ltd. | 28 Sep 2015 | 11 Jul 2017 | 28 Sep 2017 |
| 654 | ptdunrite.org | GoDaddy.com, LLC | 20 Jul 2015 | 14 Jul 2017 | 20 Jul 2018 |
| 655 | ptdunrite.net | GoDaddy.com, LLC | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2016 |
| 656 | ptdunrite.info | GoDaddy.com, LLC | 20 Jul 2015 | 14 Jul 2017 | 20 Jul 2018 |
| 657 | ptdafajayam.com | CV. Jogjacamp | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2016 |
| 658 | ptdgear.com | GoDaddy.com, LLC | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 659 | ptdawang.com | - | - | - | - |
| 660 | ptdp.wang | eName Technology Co., Ltd. | 29 Sep 2015 | 12 May 2017 | 29 Sep 2017 |
| 661 | ptdistribution.com | TurnCommerce, Inc. DBA NameBright.com | 29 Sep 2015 | 23 Sep 2020 | 29 Sep 2025 |
| 662 | ptd88.com | - | 4 Jun 2025 | 4 Jun 2025 | 4 Jun 2026 |
| 663 | ptdyw.net | HiChina Zhicheng Technology Limited | 23 Jul 2015 | 17 Jul 2017 | 23 Jul 2018 |
| 664 | ptdfw.com | GoDaddy.com, LLC | 16 Jun 2019 | 17 Jun 2025 | 16 Jun 2026 |
| 665 | ptdfa.com | Dynadot12 LLC | 12 May 2022 | 23 Jul 2023 | 12 May 2023 |
| 666 | ptdian.com | TurnCommerce, Inc. DBA NameBright.com | 28 Jul 2015 | 7 Sep 2025 | 28 Jul 2025 |
| 667 | ptdc8.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 668 | ptdc7.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 669 | ptdc6.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 670 | ptdc3.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 671 | ptdy.wang | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 1 Oct 2015 | 7 Sep 2016 | 1 Oct 2017 |
| 672 | ptdoudou.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 May 2023 | 7 Sep 2025 | 2 May 2026 |
| 673 | ptdducollege.org | Crazy Domains FZ-LLC | 28 Jul 2015 | 8 Aug 2017 | 28 Jul 2018 |
| 674 | ptdatabase.com | TurnCommerce, Inc. DBA NameBright.com | 17 Oct 2017 | 11 Oct 2020 | 17 Oct 2025 |
| 675 | ptdiaoke.com | DropCatch.com 997 LLC | 5 Oct 2017 | 5 Oct 2017 | 5 Oct 2018 |
| 676 | ptdutagrahasekawan.com | CV. Rumahweb Indonesia | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 677 | ptdowns.com | GoDaddy.com, LLC | 30 Jul 2025 | 30 Jul 2025 | 30 Jul 2026 |
| 678 | ptdddx.com | 1API GmbH | 20 Sep 2020 | 21 Sep 2020 | 20 Sep 2021 |
| 679 | ptdstudios.com | Network Solutions, LLC | 3 Aug 2015 | 4 Jun 2024 | 3 Aug 2026 |
| 680 | ptdizhi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2016 |
| 681 | ptd8.com | CV. Jogjacamp | 15 Feb 2023 | 23 Mar 2024 | 15 Feb 2024 |
| 682 | ptdxt.com | Domain.com, LLC | 10 Feb 2017 | 10 Feb 2017 | 10 Feb 2018 |
| 683 | ptdwf.com | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 684 | ptdeltaexpress.com | Web Commerce Communications Limited dba WebNic.cc | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 685 | ptdbpxb61.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 686 | ptdc93.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2016 |
| 687 | ptdtnttinh-binhdinh.com | Domain Central Australia Pty Ltd. | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2016 |
| 688 | ptddxt.com | DropCatch.com 864 LLC | 20 Mar 2022 | 30 Apr 2023 | 20 Mar 2023 |
| 689 | ptdpp.com | NameCheap, Inc. | 8 Jun 2021 | 19 Aug 2023 | 8 Jun 2023 |
| 690 | ptdbi.com | HiChina Zhicheng Technology Limited | 31 Aug 2020 | 31 Aug 2020 | 31 Aug 2021 |
| 691 | ptdlcw.com | Dynadot15 LLC | 15 Oct 2024 | 15 Oct 2024 | 15 Oct 2025 |
| 692 | ptdecolo.com | Hosting Concepts B.V. dba Openprovider | 8 Aug 2015 | 8 Aug 2015 | 8 Aug 2016 |
| 693 | ptdistribuidora.com | Wild West Domains, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 694 | ptdiaw.com | - | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2017 |
| 695 | ptdaobbs.com | - | - | - | - |
| 696 | ptdkw.com | eName Technology Co., Ltd. | 4 Oct 2015 | 4 Oct 2015 | 4 Oct 2017 |
| 697 | ptdzx.com | Domain.com, LLC | 10 Feb 2017 | 10 Feb 2017 | 10 Feb 2018 |
| 698 | ptdutarantaimas.com | NameCheap, Inc. | 5 Oct 2015 | 5 Sep 2024 | 5 Oct 2025 |
| 699 | ptdormitor.com | GoDaddy.com, LLC | 5 Oct 2015 | 5 Oct 2015 | 5 Oct 2016 |
| 700 | ptdjr.com | EIMS (Shenzhen) Culture & Technology Co., Ltd | 15 Mar 2017 | 8 Aug 2017 | 15 Mar 2018 |
| 701 | ptdy.win | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Dec 2016 | 30 Oct 2017 | 9 Dec 2018 |
| 702 | ptdfz.win | Xiamen Nawang Technology Co., Ltd | 8 Oct 2015 | - | 7 Oct 2016 |
| 703 | ptdvj.win | Xiamen Nawang Technology Co., Ltd | 10 Oct 2015 | - | 9 Oct 2016 |
| 704 | ptdentalmilling.com | GoDaddy.com, LLC | 10 Oct 2015 | 11 Oct 2023 | 10 Oct 2025 |
| 705 | ptdf.win | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Oct 2015 | 14 Nov 2016 | 10 Oct 2017 |
| 706 | ptdradio.club | NameCheap, Inc. | 22 Apr 2017 | 27 Apr 2017 | 22 Apr 2018 |
| 707 | ptdtccdt.com | HiChina Zhicheng Technology Limited | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 708 | ptdswedct2.xyz | GMO Internet Inc. | 20 Oct 2015 | - | 20 Oct 2016 |
| 709 | ptdng.win | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Oct 2015 | - | 18 Oct 2016 |
| 710 | ptdz.com | Dynadot, LLC | 1 Jan 2008 | 31 Dec 2024 | 1 Jan 2026 |
| 711 | ptdy.com | Tucows Domains Inc. | 14 Mar 2003 | 10 Feb 2023 | 13 Mar 2028 |
| 712 | ptdt.com | GoDaddy.com, LLC | 30 Dec 2001 | 17 May 2025 | 30 Dec 2025 |
| 713 | ptds.com | Tucows Domains Inc. | 23 Apr 2001 | 11 Mar 2024 | 23 Apr 2032 |
| 714 | ptdr.com | Internet Domain Services BS Corp | 9 May 2003 | 24 Feb 2025 | 9 May 2026 |
| 715 | ptdq.com | GoDaddy.com, LLC | 4 Aug 2004 | 5 Jul 2025 | 4 Aug 2026 |
| 716 | ptdp.com | GoDaddy.com, LLC | 18 Oct 2003 | 7 Apr 2025 | 18 Oct 2034 |
| 717 | ptdn.com | GoDaddy.com, LLC | 28 Dec 2002 | 14 Sep 2022 | 28 Dec 2026 |
| 718 | ptdm.com | - | 29 Jul 2005 | 30 Jul 2024 | 29 Jul 2026 |
| 719 | ptdl.com | Tucows Domains Inc. | 4 Mar 2000 | 31 Jul 2025 | 4 Mar 2033 |
| 720 | ptdk.com | Dynadot, LLC | 20 Nov 2005 | 6 Jul 2025 | 20 Nov 2027 |
| 721 | ptdj.com | NameKing.com Inc. | 14 Dec 2008 | 26 Jun 2025 | 14 Dec 2025 |
| 722 | ptdh.com | Dynadot, LLC | 11 Mar 2006 | 6 Jul 2025 | 11 Mar 2027 |
| 723 | ptdg.com | Tucows Domains Inc. | 7 Dec 2002 | 21 Jul 2025 | 7 Dec 2032 |
| 724 | ptdf.com | HiChina Zhicheng Technology Limited | 21 Aug 2013 | 24 Aug 2024 | 21 Aug 2026 |
| 725 | ptdc.com | Squarespace Domains LLC | 11 Oct 1998 | 20 Jan 2025 | 10 Oct 2026 |
| 726 | ptdb.com | Namesilo, LLC | 11 Feb 2000 | 13 Mar 2024 | 11 Feb 2026 |
| 727 | ptdworld.com | HiChina Zhicheng Technology Limited | 19 Oct 2015 | 22 Sep 2021 | 19 Oct 2026 |
| 728 | ptd85fwdnr.click | GMO Internet Inc. | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 729 | ptdu.com | GoDaddy.com, LLC | 22 Apr 2005 | 21 Apr 2025 | 22 Apr 2026 |
| 730 | ptdv.com | Web Commerce Communications Limited dba WebNic.cc | 9 Jun 2006 | 11 Jul 2022 | 10 Jun 2026 |
| 731 | ptdba.com | Shanghai Meicheng Technology Information Co., Ltd | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 732 | ptdrruq.us | - | 22 Oct 2015 | - | 21 Oct 2016 |
| 733 | ptdt.org | GoDaddy.com, LLC | 23 Oct 2015 | 3 Apr 2017 | 23 Oct 2017 |
| 734 | ptdradio.com | GoDaddy.com, LLC | 25 Nov 2021 | 25 Nov 2021 | 25 Nov 2022 |
| 735 | ptdaenshoes.com | Tucows Domains Inc. | 25 Oct 2015 | 20 Jul 2017 | 25 Oct 2017 |
| 736 | ptdevelopments.com | TurnCommerce, Inc. DBA NameBright.com | 15 Jan 2022 | 24 Feb 2025 | 15 Jan 2025 |
| 737 | ptdb.tech | Gandi SAS | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 738 | ptdv.net | Hangzhou AiMing Network Co., LTD | 16 Mar 2022 | 22 May 2023 | 16 Mar 2023 |
| 739 | ptdjd11.com | Chengdu West Dimension Digital Technology Co., Ltd… | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 740 | ptdhlo.info | West263 International Limited | 29 Oct 2015 | - | 29 Oct 2016 |
| 741 | ptdepositphotos.com | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 742 | ptdc.xyz | GoDaddy.com, LLC | 25 Oct 2021 | 25 Oct 2021 | 25 Oct 2022 |
| 743 | ptdc-crc.com | Network Solutions, LLC | 28 Oct 2015 | 3 Jul 2017 | 28 Oct 2017 |
| 744 | ptd8.net | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 745 | ptdrcl.us | - | 29 Oct 2015 | - | 28 Oct 2016 |
| 746 | ptdjuqng.us | - | 29 Oct 2015 | - | 28 Oct 2016 |
| 747 | ptdjd01.com | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 748 | ptdoo.win | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Oct 2015 | - | 29 Oct 2016 |
| 749 | ptdjd02.com | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 750 | ptdz.xyz | NameCheap, Inc. | 1 Mar 2020 | 10 Apr 2020 | 1 Mar 2021 |
| 751 | ptdy.xyz | Namesilo, LLC | 18 Jun 2021 | 18 Jun 2021 | 18 Jun 2022 |
| 752 | ptdx.xyz | Realtime Register B.V. | 31 Mar 2022 | 1 Apr 2023 | 31 Mar 2024 |
| 753 | ptdw.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Nov 2015 | 24 Feb 2016 | 1 Nov 2017 |
| 754 | ptdk.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 31 Oct 2015 | 16 Jan 2017 | 31 Oct 2017 |
| 755 | ptdjd3.com | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Nov 2015 | 1 Nov 2015 | 1 Nov 2016 |
| 756 | ptdg.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 31 Oct 2015 | 5 Dec 2017 | 31 Oct 2017 |
| 757 | ptdt.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Apr 2022 | 6 Jul 2022 | 13 Apr 2024 |
| 758 | ptds.xyz | GoDaddy.com, LLC | 27 Aug 2024 | 28 Aug 2025 | 27 Aug 2026 |
| 759 | ptdr.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Nov 2015 | 20 Jan 2017 | 1 Nov 2017 |
| 760 | ptdq.xyz | NameCheap, Inc. | 3 Oct 2023 | 14 Nov 2024 | 3 Oct 2024 |
| 761 | ptdp.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Apr 2022 | 6 Jul 2022 | 13 Apr 2024 |
| 762 | ptdn.xyz | eNom, Inc. | 12 Jan 2021 | 12 Jan 2021 | 12 Jan 2022 |
| 763 | ptdm.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Apr 2022 | 6 Jul 2022 | 13 Apr 2024 |
| 764 | ptdl.xyz | - | 2 Apr 2022 | 20 Apr 2022 | 2 Apr 2024 |
| 765 | ptdjd5.com | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Nov 2015 | 1 Nov 2015 | 1 Nov 2016 |
| 766 | ptdj.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 22 Sep 2024 | 1 Oct 2024 | 22 Sep 2025 |
| 767 | ptdh.xyz | GMO Internet Inc. | 4 Mar 2025 | 9 Mar 2025 | 4 Mar 2026 |
| 768 | ptdgef.us | - | 1 Nov 2015 | - | 31 Oct 2016 |
| 769 | ptdf.xyz | Hosting Concepts B.V. dba Openprovider | 28 Aug 2024 | 13 Jul 2025 | 28 Aug 2025 |
| 770 | ptdb.xyz | Hostinger, UAB | 9 Nov 2024 | 14 Nov 2024 | 9 Nov 2025 |
| 771 | ptdso.bid | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Nov 2015 | - | 1 Nov 2016 |
| 772 | ptdmygpxmr.com | HiChina Zhicheng Technology Limited | 2 Nov 2015 | 3 Nov 2015 | 2 Nov 2016 |
| 773 | ptdltd.com | 1&1 Internet AG | 2 Nov 2015 | 13 May 2019 | 2 Nov 2025 |
| 774 | ptdtniai.us | - | 3 Nov 2015 | - | 2 Nov 2016 |
| 775 | ptdz.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 2 Aug 2016 | 18 Oct 2017 |
| 776 | ptdx.wang | eName Technology Co., Ltd. | 19 Oct 2015 | 26 Nov 2016 | 19 Oct 2017 |
| 777 | ptdw.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 9 Nov 2016 | 18 Oct 2017 |
| 778 | ptdr.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 2 Jun 2017 | 18 Oct 2017 |
| 779 | ptdn.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 2 Jun 2017 | 18 Oct 2017 |
| 780 | ptdm.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 2 Jun 2017 | 18 Oct 2017 |
| 781 | ptdl.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 15 Dec 2016 | 18 Oct 2017 |
| 782 | ptdj.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 10 Mar 2017 | 18 Oct 2017 |
| 783 | ptdh.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 2 Jun 2017 | 18 Oct 2017 |
| 784 | ptdg.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 11 Mar 2017 | 18 Oct 2017 |
| 785 | ptdf.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 2 Jun 2017 | 18 Oct 2017 |
| 786 | ptdd.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 2 Sep 2016 | 18 Oct 2017 |
| 787 | ptdb.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 2 Jun 2017 | 18 Oct 2017 |
| 788 | ptdk.org | Hangzhou AiMing Network Co., LTD | 22 Apr 2017 | 22 Jun 2017 | 22 Apr 2018 |
| 789 | ptdpk.com | Cosmotown, Inc. | 10 Jan 2025 | 3 Feb 2025 | 10 Jan 2026 |
| 790 | ptdayacipta.com | eNom, Inc. | 4 Nov 2015 | 9 Oct 2016 | 4 Nov 2017 |
| 791 | ptdahe.com | GoDaddy.com, LLC | 16 Oct 2021 | 28 Dec 2023 | 16 Oct 2023 |
| 792 | ptdtz.com | DropCatch.com 870 LLC | 27 Jul 2019 | 27 Jul 2019 | 27 Jul 2020 |
| 793 | ptdjxx.com | DNSPod, Inc. | 6 Nov 2015 | 4 Sep 2021 | 6 Nov 2026 |
| 794 | ptdoc.info | GoDaddy.com, LLC | 6 Nov 2015 | 7 Nov 2016 | 6 Nov 2017 |
| 795 | ptdjxx.net | HiChina Zhicheng Technology Limited | 6 Nov 2015 | 4 Nov 2016 | 6 Nov 2017 |
| 796 | ptddc.net | 1API GmbH | 7 Jul 2021 | 7 Jul 2021 | 7 Jul 2022 |
| 797 | ptdd.org | Name.com, Inc. | 20 Apr 2017 | 21 Sep 2017 | 20 Apr 2018 |
| 798 | ptdk.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Nov 2015 | - | 5 Nov 2016 |
| 799 | ptdoc.org | GoDaddy.com, LLC | 13 Jan 2020 | 27 Feb 2025 | 13 Jan 2026 |
| 800 | ptdoc.net | GoDaddy.com, LLC | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 801 | ptdangao.com | HiChina Zhicheng Technology Limited | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 802 | ptdwl.com | HiChina Zhicheng Technology Limited | 27 Dec 2017 | 27 Dec 2017 | 27 Dec 2018 |
| 803 | ptdzj.com | eName Technology Co., Ltd. | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 804 | ptdyl.com | Web Commerce Communications Limited dba WebNic.cc | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2016 |
| 805 | ptdega.com | 1&1 Internet AG | 7 Nov 2015 | 8 Nov 2016 | 7 Nov 2017 |
| 806 | ptddk.com | GMO Internet Inc. | 12 Jun 2022 | 23 Aug 2023 | 12 Jun 2023 |
| 807 | ptddh.com | eName Technology Co., Ltd. | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2016 |
| 808 | ptdcf.com | eName Technology Co., Ltd. | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 809 | ptdbj.com | eName Technology Co., Ltd. | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 810 | ptdbh.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 14 Feb 2025 | 2 May 2025 | 14 Feb 2026 |
| 811 | ptdptd.com | Google, Inc. | 9 Apr 2024 | 25 Mar 2025 | 9 Apr 2026 |
| 812 | ptdbb.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 2 Nov 2022 | 2 Nov 2022 | 2 Nov 2023 |
| 813 | ptdzz.com | Domain.com, LLC | 6 Mar 2017 | 6 Mar 2017 | 6 Mar 2018 |
| 814 | ptdzs.com | Google, Inc. | 8 Jul 2023 | 7 Aug 2024 | 8 Jul 2024 |
| 815 | ptdzb.com | OnlineNIC, Inc. | 9 Apr 2018 | 9 Apr 2018 | 9 Apr 2019 |
| 816 | ptdyg.com | OnlineNIC, Inc. | 9 Apr 2018 | 9 Apr 2018 | 9 Apr 2019 |
| 817 | ptdyb.com | OnlineNIC, Inc. | 9 Apr 2018 | 9 Apr 2018 | 9 Apr 2019 |
| 818 | ptdxz.com | Xiamen Domains, Inc. | 12 Mar 2018 | 12 Mar 2018 | 12 Mar 2019 |
| 819 | ptdxx.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 820 | ptdxh.com | Hangzhou AiMing Network Co., LTD | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 821 | ptdxb.com | TurnCommerce, Inc. DBA NameBright.com | 21 May 2019 | 22 Jun 2024 | 21 May 2024 |
| 822 | ptdwz.com | Namesilo, LLC | 12 Feb 2022 | 18 Mar 2023 | 12 Feb 2023 |
| 823 | ptdwy.com | eName Technology Co., Ltd. | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 824 | ptdwh.com | CV. Rumahweb Indonesia | 29 Nov 2023 | 9 Feb 2025 | 29 Nov 2024 |
| 825 | ptdwg.com | OnlineNIC, Inc. | 9 Apr 2018 | 9 Apr 2018 | 9 Apr 2019 |
| 826 | ptdwb.com | DNSPod, Inc. | 6 Mar 2019 | 13 Aug 2021 | 6 Mar 2030 |
| 827 | ptdtt.com | DNSPod, Inc. | 15 Sep 2022 | 15 Oct 2023 | 15 Sep 2023 |
| 828 | ptdtb.com | Hostinger, UAB | 6 Jan 2025 | 7 Mar 2025 | 6 Jan 2026 |
| 829 | ptdqq.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 830 | ptdpt.com | Google, Inc. | 17 Jun 2022 | 2 Jun 2025 | 17 Jun 2026 |
| 831 | ptdmy.com | DropCatch.com 970 LLC | 21 May 2023 | 1 Aug 2024 | 21 May 2024 |
| 832 | ptdll.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 833 | ptdkk.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 834 | ptdjm.com | CV. Jogjacamp | 8 Jul 2017 | 15 Aug 2018 | 8 Jul 2019 |
| 835 | ptdirectnow.com | GoDaddy.com, LLC | 25 Aug 2020 | 26 Aug 2025 | 25 Aug 2027 |
| 836 | ptdhh.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 837 | ptdgy.com | eName Technology Co., Ltd. | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 838 | ptdgp.com | eName Technology Co., Ltd. | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 839 | ptdgj.com | eName Technology Co., Ltd. | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 840 | ptdgg.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 841 | ptdfz.com | eName Technology Co., Ltd. | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 842 | ptddz.com | Hangzhou AiMing Network Co., LTD | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 843 | ptddb.com | Uniregistrar Corp | - | - | - |
| 844 | ptdbz.com | Domain.com, LLC | 10 Feb 2017 | 10 Feb 2017 | 10 Feb 2018 |
| 845 | ptdbt.com | Hosting Concepts B.V. dba Openprovider | 8 Sep 2025 | 8 Sep 2025 | 8 Sep 2026 |
| 846 | ptdcb.com | HiChina Zhicheng Technology Limited | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 847 | ptdk.biz | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Nov 2015 | - | 8 Nov 2016 |
| 848 | ptdyc.com | GMO Internet Inc. | 30 Mar 2025 | 31 Mar 2025 | 30 Mar 2026 |
| 849 | ptdunedin.com | GoDaddy.com, LLC | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2017 |
| 850 | ptdst.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 3 Sep 2022 | 19 May 2024 | 3 Sep 2026 |
| 851 | ptdrr.com | Register.it SPA | 27 Feb 2024 | 1 May 2025 | 27 Feb 2025 |
| 852 | ptdmm.com | DropCatch.com 637 LLC | 24 Jan 2017 | 26 Jan 2017 | 24 Jan 2018 |
| 853 | ptdjk.com | HiChina Zhicheng Technology Limited | 5 Oct 2020 | 5 Oct 2020 | 5 Oct 2021 |
| 854 | ptdgf.com | Hangzhou AiMing Network Co., LTD | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 855 | ptdff.com | eName Technology Co., Ltd. | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 856 | ptdzq.com | eName Technology Co., Ltd. | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 857 | ptdz.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 11 Nov 2015 | 15 May 2017 | 10 Nov 2018 |
| 858 | ptdyx.com | HiChina Zhicheng Technology Limited | 7 Aug 2018 | 14 Sep 2024 | 7 Aug 2024 |
| 859 | ptdsz.com | Beijing Lanhai Jiye Technology Co., Ltd | 22 Mar 2024 | 12 Sep 2025 | 22 Mar 2026 |
| 860 | ptdk.win | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Nov 2015 | 14 Dec 2016 | 9 Nov 2017 |
| 861 | ptdtp.com | Dynadot, LLC | 11 Nov 2015 | 7 Dec 2016 | 11 Nov 2017 |
| 862 | ptdmj.com | Web Commerce Communications Limited dba WebNic.cc | 10 Sep 2020 | 10 Sep 2020 | 10 Sep 2026 |
| 863 | ptd365.com | HiChina Zhicheng Technology Limited | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 864 | ptdm.org | Network Solutions, LLC | 18 Feb 2022 | 24 Jan 2025 | 18 Feb 2028 |
| 865 | ptdw.win | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Nov 2015 | 10 Dec 2016 | 10 Nov 2017 |
| 866 | ptds.win | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 26 Jun 2018 | - | 26 Jun 2019 |
| 867 | ptdrz.com | eName Technology Co., Ltd. | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 868 | ptdhb.com | eName Technology Co., Ltd. | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2016 |
| 869 | ptddy.com | GoDaddy.com, LLC | 27 Mar 2020 | 27 Mar 2020 | 27 Mar 2021 |
| 870 | ptdd.xin | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 11 Nov 2015 | - | 11 Nov 2016 |
| 871 | ptdd.win | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Nov 2015 | 11 Mar 2017 | 10 Nov 2017 |
| 872 | ptdz.net | Hefei Juming Network Technology Co., Ltd | 27 Jul 2006 | 21 Aug 2025 | 27 Jul 2026 |
| 873 | ptdx.net | - | 1 Mar 2025 | 5 Mar 2025 | 1 Mar 2026 |
| 874 | ptdw.net | DreamHost, LLC | 2 May 2000 | 25 Apr 2025 | 3 May 2026 |
| 875 | ptdt.net | NameCheap, Inc. | 30 Dec 2001 | 1 Dec 2024 | 30 Dec 2025 |
| 876 | ptds.net | 1&1 Internet AG | 24 Jun 2010 | 13 Dec 2017 | 24 Jun 2026 |
| 877 | ptdr.net | OVH sas | 26 Aug 2019 | 27 Aug 2024 | 26 Aug 2026 |
| 878 | ptdn.net | GoDaddy.com, LLC | 30 Dec 2022 | 10 Feb 2025 | 30 Dec 2024 |
| 879 | ptdm.net | Dynadot, LLC | 4 Sep 2021 | 6 Sep 2021 | 4 Sep 2022 |
| 880 | ptdj.net | Beijing Lanhai Jiye Technology Co., Ltd | 29 Jun 2024 | 22 Aug 2025 | 29 Jun 2026 |
| 881 | ptdh.net | DOMAIN NAME NETWORK PTY LTD | 10 Sep 2024 | 10 Sep 2024 | 10 Sep 2025 |
| 882 | ptdc.net | DNC Holdings, Inc. | 9 Oct 2002 | 25 Aug 2025 | 9 Oct 2026 |
| 883 | ptdb.net | Beijing Lanhai Jiye Technology Co., Ltd | 24 Sep 2022 | 25 Sep 2023 | 24 Sep 2024 |
| 884 | ptdsp.com | Web Commerce Communications Limited dba WebNic.cc | 19 Sep 2017 | 7 Sep 2022 | 20 Sep 2025 |
| 885 | ptdkb.com | Google, Inc. | 14 Dec 2022 | 14 Dec 2023 | 14 Dec 2024 |
| 886 | ptdjz.com | eName Technology Co., Ltd. | 14 Nov 2015 | 14 Nov 2015 | 14 Nov 2016 |
| 887 | ptdz.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 888 | ptdx.org | EIMS (Shenzhen) Culture & Technology Co., Ltd | 16 Nov 2015 | 11 Apr 2017 | 16 Nov 2017 |
| 889 | ptdtx.com | eName Technology Co., Ltd. | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 890 | ptdsolutions.org | Network Solutions, LLC | 19 Oct 2024 | 6 Dec 2024 | 19 Oct 2025 |
| 891 | ptdsolutions.net | GoDaddy.com, LLC | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 892 | ptdsolutions.info | GoDaddy.com, LLC | 16 Nov 2015 | - | 16 Nov 2016 |
| 893 | ptdseo.com | GoDaddy.com, LLC | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 894 | ptdpx.com | 35 Technology Co., Ltd. | 2 Mar 2023 | 3 Mar 2024 | 2 Mar 2025 |
| 895 | ptdoptgs.mobi | GMO Internet Pte. Ltd | 16 Nov 2015 | - | 16 Nov 2016 |
| 896 | ptdmarketing.org | GoDaddy.com, LLC | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 897 | ptdmarketing.net | GoDaddy.com, LLC | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 898 | ptdmarketing.info | GoDaddy.com, LLC | 16 Nov 2015 | - | 16 Nov 2016 |
| 899 | ptdj.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 900 | ptddd.net | Hangzhou AiMing Network Co., LTD | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 901 | ptdzkj.com | eName Technology Co., Ltd. | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 902 | ptdweb.com | Wild West Domains, LLC | 6 Mar 2019 | 6 Mar 2019 | 6 Mar 2020 |
| 903 | ptdsolutions.com | TurnCommerce, Inc. DBA NameBright.com | 3 Feb 2017 | 28 Jan 2021 | 3 Feb 2026 |
| 904 | ptdsoftware.com | Amazon Registrar, Inc. | 16 Jun 2021 | 12 May 2025 | 16 Jun 2026 |
| 905 | ptdqb.com | Hangzhou AiMing Network Co., LTD | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 906 | ptdmarketing.com | GoDaddy.com, LLC | 10 Jan 2023 | 23 Mar 2025 | 10 Jan 2025 |
| 907 | ptdlp.com | eName Technology Co., Ltd. | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 908 | ptdcy.com | EIMS (Shenzhen) Culture & Technology Co., Ltd | 16 Mar 2017 | 8 Aug 2017 | 16 Mar 2018 |
| 909 | ptdcm.com | Chengdu West Dimension Digital Technology Co., Ltd… | 31 Dec 2019 | 31 Dec 2019 | 31 Dec 2020 |
| 910 | ptdzy.com | Hangzhou AiMing Network Co., LTD | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 911 | ptdjb.com | Xin Net Technology Corporation | 30 Sep 2018 | 30 Sep 2018 | 30 Sep 2019 |
| 912 | ptddf.com | CV. Jogjacamp | 12 Dec 2022 | 21 Mar 2025 | 12 Dec 2025 |
| 913 | ptdr.pro | OVH sas | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 914 | ptdp.win | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 26 Jun 2018 | - | 26 Jun 2019 |
| 915 | ptdz.biz | HiChina Zhicheng Technology Limited | 4 Apr 2018 | 9 Apr 2018 | 4 Apr 2019 |
| 916 | ptdy.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 917 | ptdx.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 918 | ptdw.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 919 | ptdt.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 920 | ptdr.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 921 | ptdq.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 922 | ptdp.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 923 | ptdn.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 924 | ptdm.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 925 | ptdl.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 926 | ptdj.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 927 | ptdh.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 928 | ptdg.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 929 | ptdf.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 930 | ptdd.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 931 | ptdb.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Jun 2017 | 30 Jun 2017 | 28 Jun 2018 |
| 932 | ptdx.win | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Nov 2015 | 11 Mar 2017 | 17 Nov 2017 |
| 933 | ptdt.win | West263 International Limited | 22 Feb 2017 | 16 Jan 2018 | 21 Feb 2018 |
| 934 | ptdn.win | West263 International Limited | 1 Mar 2017 | 19 Aug 2017 | 28 Feb 2018 |
| 935 | ptdm.win | West263 International Limited | 1 Mar 2017 | - | 28 Feb 2018 |
| 936 | ptdl.win | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Nov 2015 | 30 Apr 2017 | 18 Nov 2017 |
| 937 | ptdjf.com | eName Technology Co., Ltd. | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2016 |
| 938 | ptdj.win | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Nov 2015 | 18 Apr 2017 | 17 Nov 2017 |
| 939 | ptdistributingllc.com | GoDaddy.com, LLC | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2016 |
| 940 | ptdistributinginc.com | GoDaddy.com, LLC | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2017 |
| 941 | ptdh.win | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Nov 2015 | 29 Mar 2017 | 17 Nov 2017 |
| 942 | ptdg.win | NameCheap, Inc. | 14 Dec 2020 | 15 Dec 2020 | 14 Dec 2021 |
| 943 | ptdc.win | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Nov 2015 | 23 Oct 2016 | 17 Nov 2017 |
| 944 | ptdb.win | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 26 Jun 2018 | - | 26 Jun 2019 |
| 945 | ptdms.biz | NameCheap, Inc. | 20 Nov 2015 | 20 Nov 2015 | 19 Nov 2016 |
| 946 | ptdy.club | EJEE Group Holdings Limited | 19 Nov 2015 | 23 Nov 2016 | 18 Nov 2017 |
| 947 | ptdcases.com | Network Solutions, LLC | 20 Nov 2015 | 22 Nov 2022 | 20 Nov 2025 |
| 948 | ptdafa888.net | GoDaddy.com, LLC | 20 Nov 2015 | 20 Nov 2015 | 20 Nov 2016 |
| 949 | ptds.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 4 Feb 2017 | 8 Feb 2017 | 3 Feb 2018 |
| 950 | ptdnv.org | OnlineNIC, Inc. | 23 Nov 2015 | - | 23 Nov 2016 |
| 951 | ptdj.club | EJEE Group Holdings Limited | 21 Nov 2015 | 23 Nov 2016 | 20 Nov 2017 |
| 952 | ptda.loan | Alpnames Limited | 22 Nov 2015 | - | 21 Nov 2016 |
| 953 | ptdbswcwmfb.biz | - | 24 Nov 2015 | 8 Jan 2017 | 23 Nov 2017 |
| 954 | ptdynamics.com | NameKing.com Inc. | 13 Feb 2024 | 13 Feb 2025 | 13 Feb 2026 |
| 955 | ptdefianceclock.net | Tucows Domains Inc. | 24 Nov 2015 | 28 Nov 2018 | 24 Nov 2018 |
| 956 | ptdl.loan | Alpnames Limited | 23 Nov 2015 | - | 22 Nov 2016 |
| 957 | ptdeendayalviklangkalyansamiti.org | GoDaddy.com, LLC | 24 Nov 2015 | 24 Nov 2015 | 24 Nov 2016 |
| 958 | ptdnupeng.com | Domain.com, LLC | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2016 |
| 959 | ptdct.com | Web Commerce Communications Limited dba WebNic.cc | 3 Aug 2022 | 3 Aug 2022 | 3 Aug 2026 |
| 960 | ptdi.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 Nov 2015 | 26 Apr 2016 | 29 Nov 2017 |
| 961 | ptdumepta.org | GMO Internet Inc. | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2016 |
| 962 | ptdtg.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 May 2023 | 5 May 2025 | 4 May 2026 |
| 963 | ptdcj.loan | Alpnames Limited | 29 Nov 2015 | - | 28 Nov 2016 |
| 964 | ptddm.com | Google, Inc. | 19 Jan 2023 | 4 Jan 2025 | 19 Jan 2026 |
| 965 | ptdch.com | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Jul 2019 | 1 Jul 2019 | 1 Jul 2020 |
| 966 | ptdojxfmovpvfidylzrbutt.biz | - | 30 Nov 2015 | 14 Jan 2018 | 29 Nov 2018 |
| 967 | ptdilpukizlfhxcofnrbwklf.biz | - | 30 Nov 2015 | 14 Jan 2017 | 29 Nov 2017 |
| 968 | ptdhhwaahmmqrqf.net | GMO Internet Inc. | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 969 | ptdaueueuuomfpnbskbujfzxzx.biz | - | 30 Nov 2015 | 14 Jan 2018 | 29 Nov 2018 |
| 970 | ptd03qot.biz | GMO Internet Inc. | 30 Nov 2015 | - | 29 Nov 2016 |
| 971 | ptdgm.com | CV. Jogjacamp | 30 Nov 2015 | 5 Nov 2024 | 30 Nov 2025 |
| 972 | ptdyp.com | eName Technology Co., Ltd. | 27 Nov 2015 | 27 Nov 2015 | 27 Nov 2016 |
| 973 | ptdjce.com | Tucows Domains Inc. | 27 Nov 2015 | 1 Dec 2017 | 27 Nov 2017 |
| 974 | ptdzyys11.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 3 Dec 2015 | 3 Dec 2015 | 3 Dec 2016 |
| 975 | ptdzzx.com | New Order Domains, LLC | 24 Apr 2022 | 8 Jul 2023 | 24 Apr 2023 |
| 976 | ptdpp.win | Alpnames Limited | 3 Dec 2015 | - | 2 Dec 2016 |
| 977 | ptdxg.loan | Alpnames Limited | 4 Dec 2015 | - | 3 Dec 2016 |
| 978 | ptdangiangsalamagrolestari.com | CV. Jogjacamp | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2016 |
| 979 | ptdistrima.com | eNom, Inc. | 7 Dec 2015 | 2 Dec 2016 | 7 Dec 2017 |
| 980 | ptdwj.com | eName Technology Co., Ltd. | 8 Dec 2015 | 8 Dec 2015 | 8 Dec 2016 |
| 981 | ptdau.com | Network Solutions, LLC | 25 Oct 2023 | 7 Dec 2024 | 25 Oct 2024 |
| 982 | ptdstellar.com | BigRock Solutions Ltd. | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 983 | ptdea.org | Web Commerce Communications Limited dba WebNic.cc | 9 Dec 2015 | 10 Nov 2016 | 9 Dec 2017 |
| 984 | ptdc.biz | Hangzhou AiMing Network Co., LTD | 10 Dec 2015 | - | 9 Dec 2016 |
| 985 | ptdw.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Dec 2015 | - | 10 Dec 2016 |
| 986 | ptds.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Dec 2015 | - | 10 Dec 2016 |
| 987 | ptdl.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Dec 2015 | - | 10 Dec 2016 |
| 988 | ptdj.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Dec 2015 | - | 10 Dec 2016 |
| 989 | ptdd.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Dec 2015 | - | 10 Dec 2016 |
| 990 | ptdc.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Dec 2015 | - | 10 Dec 2016 |
| 991 | ptdlgroup.org | GoDaddy.com, LLC | 11 Dec 2015 | 14 Jul 2024 | 11 Dec 2025 |
| 992 | ptdz.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Dec 2015 | - | 11 Dec 2016 |
| 993 | ptdx.club | GoDaddy.com, LLC | 30 Jan 2021 | 13 Mar 2025 | 30 Jan 2025 |
| 994 | ptdw.club | eName Technology Co., Ltd. | 21 Feb 2017 | 27 Feb 2017 | 20 Feb 2018 |
| 995 | ptdryneedling.com | GoDaddy.com, LLC | 1 Dec 2022 | 2 Dec 2024 | 1 Dec 2026 |
| 996 | ptdm.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Dec 2015 | - | 11 Dec 2016 |
| 997 | ptdlgroup.com | Webfusion Ltd. | 11 Dec 2015 | 4 Dec 2016 | 11 Dec 2017 |
| 998 | ptdmrw.win | Alpnames Limited | 13 Dec 2015 | - | 12 Dec 2016 |
| 999 | ptdx.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Dec 2015 | - | 13 Dec 2016 |
| 1000 | ptdt.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Dec 2015 | - | 13 Dec 2016 |
Displaying 1,000 out of 6,636 domains starting with the keyword "PTD". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=ptd
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |