With support for 
Keyword: PETEM
Reverse Whois » KEYWORD [petem ] { 2,212 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | petem.rocks | eNom, Inc. | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 2 | petem.top | Alpnames Limited | 28 Apr 2016 | 28 Apr 2016 | 28 Apr 2017 |
| 3 | petem.org | Google, Inc. | 21 Sep 2019 | 11 Sep 2025 | 21 Sep 2026 |
| 4 | petem.xyz | GoDaddy.com, LLC | 24 Nov 2016 | 24 Nov 2016 | 24 Nov 2017 |
| 5 | petem.co | GoDaddy.com, LLC | 17 Aug 2016 | 17 Aug 2017 | 16 Aug 2018 |
| 6 | petem.co.uk | - | 23 Oct 2002 | 3 Aug 2021 | 23 Oct 2026 |
| 7 | petem.net | Key-Systems GmbH | 10 Oct 2023 | 30 Nov 2025 | 10 Oct 2026 |
| 8 | petem.art | NameCheap, Inc. | 10 Nov 2019 | 15 Nov 2019 | 10 Nov 2020 |
| 9 | petem.store | DOTSERVE INC. | 11 Jul 2025 | 1 Aug 2025 | 11 Jul 2026 |
| 10 | petem.ru.com | NameKing.com Inc. | 22 May 2022 | 27 May 2022 | 22 May 2023 |
| 11 | petem.online | Ä°simtescil BiliÅŸim A.Åž. | 25 Nov 2022 | 26 Nov 2023 | 25 Nov 2024 |
| 12 | petem.com.cn | - | 26 Apr 2019 | - | 26 Apr 2027 |
| 13 | petem.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 17 Jun 2003 | 18 Jul 2025 | 17 Jun 2030 |
| 14 | petem.dev | NameCheap, Inc. | 26 Feb 2025 | - | - |
| 15 | petem.space | Limited Liability Company "Registrar of domain nam… | 21 Jun 2023 | 30 Jul 2025 | 21 Jun 2025 |
| 16 | petem.in | Epik Inc. | 12 Sep 2024 | 12 Sep 2024 | 12 Sep 2025 |
| 17 | petem.ng | - | 8 Apr 2024 | 6 Jul 2025 | 8 Apr 2025 |
| 18 | petem.ru | - | 17 Dec 2023 | - | 17 Dec 2026 |
| 19 | petem.cn | ???????????? | 21 Jul 2025 | - | 21 Jul 2026 |
| 20 | petem.app | GoDaddy.com, LLC | 8 Oct 2025 | 8 Oct 2025 | 8 Oct 2026 |
| 21 | petememphis.com.au | - | - | 25 Oct 2025 | - |
| 22 | petemorganrealestate.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 23 | petemorganrealestate.info | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 24 | petemorganrealestate.org | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 25 | petemorganrealestate.net | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 26 | petemarziano.com | NameCheap, Inc. | 24 Oct 2014 | 24 Sep 2025 | 24 Oct 2026 |
| 27 | petemccloskey.com | NameCheap, Inc. | 6 Jan 2025 | 6 Jan 2025 | 6 Jan 2026 |
| 28 | petemarziano.net | NameCheap, Inc. | 24 Oct 2014 | 24 Sep 2025 | 24 Oct 2026 |
| 29 | petemaddock.com | Xin Net Technology Corporation | 27 Aug 2021 | 10 Dec 2021 | 27 Aug 2022 |
| 30 | petemckeonbuildingco.info | GoDaddy.com, LLC | 20 Mar 2016 | 15 Mar 2017 | 20 Mar 2019 |
| 31 | petemueller.com | eNom, Inc. | 8 Feb 2011 | 19 Aug 2025 | 8 Feb 2026 |
| 32 | petemullenconstruction.com | Tucows Domains Inc. | 25 Oct 2013 | 29 Oct 2014 | 25 Oct 2015 |
| 33 | petemanktelow.com | Launchpad, Inc. | 25 Jul 2017 | 10 Jul 2023 | 25 Jul 2026 |
| 34 | petemergencyhospital.com | GoDaddy.com, LLC | 20 Feb 2014 | 21 Feb 2025 | 20 Feb 2026 |
| 35 | petemporium.com | eNom, Inc. | 29 Mar 2002 | 20 Mar 2025 | 29 Mar 2026 |
| 36 | petemuseum.org | GoDaddy.com, LLC | 26 Sep 2002 | 27 Sep 2025 | 26 Sep 2026 |
| 37 | petemoorechevrolet.com | GoDaddy.com, LLC | 1 Mar 2002 | 31 Oct 2022 | 1 Mar 2029 |
| 38 | petemccormack.com | eNom, Inc. | 26 Oct 2004 | 25 Oct 2025 | 26 Oct 2026 |
| 39 | petemeas.com | GoDaddy.com, LLC | 16 Nov 2018 | 16 Nov 2018 | 16 Nov 2019 |
| 40 | peteman.com | GoDaddy.com, LLC | 27 Jan 2004 | 28 Oct 2024 | 27 Jan 2026 |
| 41 | petemitchellceramics.com | eNom, Inc. | 11 Jun 2009 | 12 Jun 2015 | 11 Jun 2016 |
| 42 | petemorris.co | eNom, Inc. | 13 Jun 2013 | 18 Jun 2015 | 12 Jun 2015 |
| 43 | petemoorevolkswagen.com | GoDaddy.com, LLC | 12 Oct 1999 | 28 Feb 2025 | 1 Apr 2026 |
| 44 | petematters.com | GoDaddy.com, LLC | 7 Jun 2014 | 8 Jun 2015 | 7 Jun 2016 |
| 45 | petemillers.net | Wild West Domains, LLC | 7 Jun 2014 | 8 Jun 2015 | 7 Jun 2016 |
| 46 | petemaravich.com | Wild West Domains, LLC | 12 Apr 2003 | 30 Apr 2024 | 12 Apr 2027 |
| 47 | petemorrell.com | OnlineNIC, Inc. | 5 Aug 2005 | 18 Aug 2025 | 5 Aug 2026 |
| 48 | petematanich.net | Tucows Domains Inc. | 9 Jan 2014 | 13 Jan 2015 | 9 Jan 2016 |
| 49 | petemasson.com | DropCatch.com 384 LLC | 21 Aug 2014 | 22 Aug 2017 | 21 Aug 2018 |
| 50 | petemalmberg.com | Hostinger, UAB | 6 Feb 2015 | 10 Jan 2025 | 6 Feb 2026 |
| 51 | petemergencyclinics.com | GoDaddy.com, LLC | 28 Feb 2015 | 31 Dec 2024 | 28 Feb 2027 |
| 52 | petemergencyhospitals.com | GoDaddy.com, LLC | 28 Feb 2015 | 31 Dec 2024 | 28 Feb 2027 |
| 53 | petemitchellconstruction.com | GoDaddy.com, LLC | 1 Mar 2015 | 1 Mar 2025 | 1 Mar 2027 |
| 54 | petemcasa.com | Hostinger, UAB | 10 Apr 2025 | 10 Jun 2025 | 10 Apr 2026 |
| 55 | petemurr.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Sep 2022 | 12 Sep 2024 | 11 Sep 2025 |
| 56 | petemergencymanagement.org | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 57 | petemaravich.net | Network Solutions, LLC | 8 Nov 2014 | 13 Feb 2018 | 8 Nov 2018 |
| 58 | petemazzeo.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2017 |
| 59 | petemcconnell.com | eNom, Inc. | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 60 | petems.com | Tucows Domains Inc. | 11 Nov 2014 | 13 Oct 2025 | 11 Nov 2026 |
| 61 | petemayconsulting.com | GoDaddy.com, LLC | 11 Nov 2014 | 14 Nov 2016 | 11 Nov 2018 |
| 62 | petemergencyapp.com | GoDaddy.com, LLC | 12 Sep 2014 | 19 Aug 2024 | 12 Sep 2029 |
| 63 | petemergencyapp.info | GoDaddy.com, LLC | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 64 | petemergencyapp.net | GoDaddy.com, LLC | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 65 | petemergencyapp.org | GoDaddy.com, LLC | 12 Sep 2014 | 20 Oct 2016 | 12 Sep 2018 |
| 66 | petemoney.com | TurnCommerce, Inc. DBA NameBright.com | 14 Sep 2014 | 24 Oct 2024 | 14 Sep 2024 |
| 67 | petemata.com | GoDaddy.com, LLC | 14 Aug 2023 | 12 Aug 2025 | 14 Aug 2027 |
| 68 | petemergency.net | Google, Inc. | 30 Dec 2019 | 15 Dec 2024 | 30 Dec 2025 |
| 69 | petemcd.com | Google, Inc. | 16 Aug 2023 | 1 Aug 2025 | 16 Aug 2026 |
| 70 | petemorgan.org | eNom, Inc. | 17 Sep 2014 | 19 Aug 2016 | 17 Sep 2017 |
| 71 | petemarshallphotography.com | eNom, Inc. | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 72 | petemercier.com | Domain.com, LLC | 3 Dec 2018 | 24 Jun 2025 | 3 Dec 2027 |
| 73 | petemmitchell.com | 1API GmbH | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 74 | petemurkett.com | Beijing Lanhai Jiye Technology Co., Ltd | 28 Apr 2021 | 30 Jun 2025 | 28 Apr 2025 |
| 75 | petempetek.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Mar 2020 | 11 Mar 2020 | 11 Mar 2021 |
| 76 | petemace.com | DropCatch.com 419 LLC | 19 Nov 2014 | 20 Nov 2016 | 19 Nov 2017 |
| 77 | petemorelledrums.com | eNom, Inc. | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 78 | petemcnally.com | Wild West Domains, LLC | 29 Sep 2014 | 29 Aug 2025 | 29 Sep 2026 |
| 79 | petemcclainjr.com | Realtime Register B.V. | 4 Dec 2022 | 17 Jan 2024 | 4 Dec 2023 |
| 80 | petemaynard.com | NameKing.com Inc. | 16 May 2025 | 24 Oct 2025 | 16 May 2026 |
| 81 | petemurphys.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 82 | petemtl.com | FastDomain Inc. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 83 | petemail.org | CloudFlare, Inc. | 30 Aug 2025 | 4 Sep 2025 | 30 Aug 2026 |
| 84 | petemillspainting.com | GoDaddy.com, LLC | 24 Sep 2024 | 1 Oct 2024 | 24 Sep 2027 |
| 85 | petememories.com | NameCheap, Inc. | 2 Dec 2014 | 24 Dec 2024 | 2 Dec 2025 |
| 86 | petemurgatroyd.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 9 Oct 2021 | 10 Oct 2021 | 9 Oct 2022 |
| 87 | petemont.info | NameCheap, Inc. | 1 Mar 2017 | 30 Apr 2017 | 1 Mar 2018 |
| 88 | petemont.org | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 89 | petemont.net | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 90 | petemrola.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 91 | petemakesstuff.com | Tucows Domains Inc. | 17 Dec 2014 | 2 Sep 2025 | 17 Dec 2025 |
| 92 | petemania.com | GoDaddy.com, LLC | 27 Feb 2020 | 10 May 2024 | 27 Feb 2024 |
| 93 | petemartinmusic.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 94 | petemagine.com | Tucows Domains Inc. | 26 Dec 2014 | 24 Apr 2025 | 26 Dec 2025 |
| 95 | petemeetslily.com | GoDaddy.com, LLC | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 96 | petemulvihill.com | Sibername Internet and Software Technologies Inc. | 30 Dec 2014 | 12 Jan 2017 | 30 Dec 2017 |
| 97 | petemilnes.com | Tucows Domains Inc. | 25 Dec 2023 | 25 Dec 2023 | 25 Dec 2024 |
| 98 | petemacaluso.com | Tucows Domains Inc. | 4 Oct 2017 | 8 Oct 2019 | 4 Oct 2019 |
| 99 | petemanderson.com | register.com, Inc. | 3 Jan 2015 | 8 Nov 2023 | 3 Jan 2026 |
| 100 | petemitchell.photography | GoDaddy.com, LLC | 10 Dec 2019 | 15 Dec 2019 | 10 Dec 2020 |
| 101 | petembroidery.xyz | Network Solutions, LLC | 12 Jul 2014 | 12 Jul 2014 | 12 Jul 2015 |
| 102 | petemcguire.email | eNom, Inc. | 27 Aug 2014 | 11 Oct 2017 | 27 Aug 2018 |
| 103 | petemorgan.rocks | eNom, Inc. | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 104 | petemarriott.rocks | DNC Holdings, Inc. | 28 Nov 2014 | 1 Dec 2025 | 28 Nov 2026 |
| 105 | petemergency.vet | GoDaddy.com, LLC | 3 Apr 2018 | 3 Apr 2025 | 3 Apr 2026 |
| 106 | petemergencyhospital.vet | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 107 | petemergencyclinic.vet | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 108 | petemilican.xyz | Crazy Domains FZ-LLC | 16 Feb 2015 | - | 16 Feb 2016 |
| 109 | petemitchell.sexy | GoDaddy.com, LLC | 28 Mar 2015 | 12 May 2017 | 28 Mar 2018 |
| 110 | petemitchell.website | eNom, Inc. | 3 May 2015 | 3 May 2015 | 3 May 2016 |
| 111 | petemorrislcsw.com | Tucows Domains Inc. | 7 Jan 2015 | 24 Apr 2025 | 7 Jan 2026 |
| 112 | petemcchrystal.com | Network Solutions, LLC | 7 Jan 2015 | 8 Nov 2025 | 7 Jan 2027 |
| 113 | petemannpainting.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 114 | petemostly.com | GoDaddy.com, LLC | 3 Nov 2023 | 15 Dec 2024 | 3 Nov 2024 |
| 115 | petemergencybook.com | DropCatch.com 1135 LLC | 20 Jun 2017 | 20 Jun 2017 | 20 Jun 2018 |
| 116 | petemichaelstraffic.com | GoDaddy.com, LLC | 16 Jan 2015 | 25 Jan 2025 | 16 Jan 2026 |
| 117 | petemills.rocks | GoDaddy.com, LLC | 21 Jun 2015 | 21 Jun 2015 | 21 Jun 2016 |
| 118 | petemoody.website | Global Domains International, Inc. DBA DomainCostC… | 22 Apr 2015 | 12 Jul 2015 | 22 Apr 2016 |
| 119 | petemoulding.com | Namesilo, LLC | 17 Jan 2015 | 1 Oct 2025 | 17 Jan 2026 |
| 120 | petemadness.com | NameCheap, Inc. | 24 Jan 2015 | 25 Dec 2024 | 24 Jan 2026 |
| 121 | petemaraldo.com | Domain.com, LLC | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2017 |
| 122 | petemasseyphotography.com | 1&1 Internet AG | 28 Jan 2015 | 29 Jan 2023 | 28 Jan 2026 |
| 123 | petemac3d.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 29 Jan 2015 | 31 Aug 2017 | 29 Jan 2018 |
| 124 | petemitchell.design | GoDaddy.com, LLC | 12 May 2015 | 23 Jun 2017 | 12 May 2017 |
| 125 | petemanentertainment.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Nov 2021 | 27 Dec 2023 | 15 Nov 2023 |
| 126 | petemullineauxwriter.com | 1&1 Internet AG | 3 Feb 2015 | 10 Oct 2025 | 3 Feb 2026 |
| 127 | petemullineaux.com | 1&1 Internet AG | 3 Feb 2015 | 10 Oct 2025 | 3 Feb 2026 |
| 128 | petemple.org | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 129 | petemorganphotos.com | GoDaddy.com, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2020 |
| 130 | petemary.com | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 131 | petemearsdesign.com | DropCatch.com 525 LLC | 18 Sep 2025 | 18 Sep 2025 | 18 Sep 2026 |
| 132 | petemergency365.com | Acens Technologies, S.L.U. | 21 Aug 2015 | 10 Oct 2015 | 21 Aug 2016 |
| 133 | petemergency24.com | Acens Technologies, S.L.U. | 21 Aug 2015 | 10 Oct 2015 | 21 Aug 2016 |
| 134 | petemporiumcare.com | GoDaddy.com, LLC | 18 Feb 2015 | 27 Feb 2023 | 18 Feb 2033 |
| 135 | petemolinero.com | - | 7 Sep 2016 | 7 Sep 2016 | 7 Sep 2017 |
| 136 | petemartinezpresentssocialsecurity.com | GoDaddy.com, LLC | 19 Feb 2015 | 20 Feb 2025 | 19 Feb 2026 |
| 137 | petemails.com | Rebel.com Corp. | 11 Oct 2017 | 20 Nov 2025 | 11 Oct 2025 |
| 138 | petemcphillips.com | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2017 |
| 139 | petemantis.com | ComfyDomains LLC | 10 May 2015 | 11 May 2017 | 10 May 2018 |
| 140 | petemosin.com | Tucows Domains Inc. | 24 May 2016 | 9 May 2025 | 24 May 2026 |
| 141 | petemosin.net | Tucows Domains Inc. | 24 May 2016 | 9 May 2025 | 24 May 2026 |
| 142 | petemosin.org | Tucows Domains Inc. | 24 May 2016 | 14 May 2025 | 24 May 2026 |
| 143 | petemorth.com | Fabulous.com Pty Ltd. | 19 Feb 2005 | 26 Mar 2019 | 19 Feb 2020 |
| 144 | petembraced.com | GoDaddy.com, LLC | 8 Mar 2015 | 8 Mar 2015 | 8 Mar 2016 |
| 145 | petembrace.com | GoDaddy.com, LLC | 8 Mar 2015 | 9 Mar 2025 | 8 Mar 2026 |
| 146 | peteman.org | NameCheap, Inc. | 7 Mar 2015 | 10 Feb 2025 | 7 Mar 2026 |
| 147 | petemmccarthy.com | Webfusion Ltd. | 14 Mar 2015 | 26 May 2025 | 14 Mar 2025 |
| 148 | petemugartegui.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Dec 2022 | 20 Nov 2024 | 21 Dec 2025 |
| 149 | petemart.com | TurnCommerce, Inc. DBA NameBright.com | 17 Nov 2016 | 20 May 2025 | 17 Nov 2025 |
| 150 | petemcpa.net | GoDaddy.com, LLC | 16 Mar 2015 | 1 Jan 2025 | 31 Dec 2026 |
| 151 | petemyfam.com | GoDaddy.com, LLC | 20 Mar 2015 | 21 Mar 2025 | 20 Mar 2026 |
| 152 | petemoronesphd.com | eNom1014, Inc. | 14 Nov 2023 | 28 Dec 2024 | 14 Nov 2024 |
| 153 | petemeyermassage.com | - | - | - | - |
| 154 | petemediaproduction.com | Key-Systems GmbH | 6 Sep 2021 | 6 Sep 2021 | 6 Sep 2022 |
| 155 | petemooreimports.com | GoDaddy.com, LLC | 23 May 2018 | 24 May 2023 | 23 May 2028 |
| 156 | petemfboyd.com | GoDaddy.com, LLC | 28 Aug 2015 | 29 Aug 2024 | 28 Aug 2026 |
| 157 | petemcdill.com | NameCheap, Inc. | 6 Apr 2015 | 7 Mar 2025 | 6 Apr 2026 |
| 158 | petemcdill.net | eNom, Inc. | 6 Apr 2015 | 5 Mar 2016 | 6 Apr 2018 |
| 159 | petemonroe.org | - | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2017 |
| 160 | petemcavoy.com | Launchpad, Inc. | 3 Feb 2017 | 5 Apr 2017 | 3 Feb 2018 |
| 161 | petemergencycards.com | Amazon Registrar, Inc. | 14 Feb 2021 | 10 Jan 2025 | 14 Feb 2026 |
| 162 | petemccune.com | Tucows Domains Inc. | 31 Aug 2011 | 4 Sep 2015 | 31 Aug 2016 |
| 163 | petemesling.com | Network Solutions, LLC | 12 Apr 2015 | 13 Mar 2025 | 12 Apr 2026 |
| 164 | petemurano.com | Tucows Domains Inc. | 15 Apr 2015 | 18 Mar 2025 | 2 Apr 2026 |
| 165 | petemergencyvets.com | Network Solutions, LLC | 12 Aug 2022 | 12 May 2025 | 12 Aug 2026 |
| 166 | petemergencyvet.com | Network Solutions, LLC | 12 Aug 2022 | 12 May 2025 | 12 Aug 2026 |
| 167 | petemichels.com | register.com, Inc. | 9 Sep 2022 | 9 Sep 2022 | 9 Sep 2032 |
| 168 | petemward.com | GoDaddy.com, LLC | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2016 |
| 169 | petemessina.org | DomainPeople, Inc. | 8 Sep 2015 | 24 Aug 2016 | 8 Sep 2017 |
| 170 | petemessina.com | DomainPeople, Inc. | 8 Sep 2015 | 18 Sep 2025 | 8 Sep 2026 |
| 171 | petemcallisterfbi.com | GoDaddy.com, LLC | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2020 |
| 172 | petemorey.com | Tucows Domains Inc. | 28 Apr 2001 | 27 Apr 2025 | 28 Apr 2026 |
| 173 | petemergencytag.biz | GoDaddy.com, LLC | 30 Apr 2015 | 23 Oct 2025 | 29 Apr 2026 |
| 174 | petemergencytag.info | GoDaddy.com, LLC | 30 Apr 2015 | 14 Jun 2025 | 30 Apr 2026 |
| 175 | petemarcompany.com | Porkbun, LLC | 29 Apr 2015 | 30 Apr 2025 | 1 May 2026 |
| 176 | petemergencytag.org | GoDaddy.com, LLC | 30 Apr 2015 | 14 Jun 2025 | 30 Apr 2026 |
| 177 | petemergencytag.us | GoDaddy.com, LLC | 30 Apr 2015 | 30 Apr 2017 | 29 Apr 2018 |
| 178 | petemergencytag.net | GoDaddy.com, LLC | 30 Apr 2015 | 30 Apr 2025 | 30 Apr 2026 |
| 179 | petemantlegardens.com | GMO Internet Inc. | 28 Aug 2023 | 8 Nov 2024 | 28 Aug 2024 |
| 180 | petemergencycare911.com | GoDaddy.com, LLC | 6 May 2015 | 6 May 2015 | 6 May 2016 |
| 181 | petembalming.com | GoDaddy.com, LLC | 5 May 2015 | 6 May 2025 | 5 May 2026 |
| 182 | petemiguelward.com | Tucows Domains Inc. | 5 Oct 2020 | 15 Nov 2023 | 5 Oct 2023 |
| 183 | petemiguelward.org | GoDaddy.com, LLC | 6 May 2015 | 7 May 2015 | 6 May 2016 |
| 184 | petemiguelward.net | GoDaddy.com, LLC | 6 May 2015 | 6 May 2015 | 6 May 2016 |
| 185 | petemiguelward.info | GoDaddy.com, LLC | 6 May 2015 | 7 May 2015 | 6 May 2016 |
| 186 | petemup.com | Namesilo, LLC | 25 Apr 2023 | 26 Apr 2024 | 25 Apr 2025 |
| 187 | petemeltzerjr.com | Network Solutions, LLC | 26 Dec 2015 | 5 Mar 2017 | 26 Dec 2017 |
| 188 | petemoji.com | Google, Inc. | 17 May 2021 | 2 May 2025 | 17 May 2026 |
| 189 | petemason.net | Tucows Domains Inc. | 27 Feb 2019 | 29 Jan 2025 | 27 Feb 2026 |
| 190 | petemcdart.com | Tucows Domains Inc. | 17 May 2012 | 15 Jul 2025 | 17 May 2026 |
| 191 | petemale.com | 1&1 Internet AG | 12 Sep 2015 | 13 Sep 2019 | 12 Sep 2026 |
| 192 | petemacleod.com | Google, Inc. | 31 Aug 2021 | 16 Aug 2025 | 31 Aug 2026 |
| 193 | petemecozziphotography.com | Google, Inc. | 15 Jul 2021 | 30 Jun 2025 | 15 Jul 2026 |
| 194 | petemariani.com | eNom, Inc. | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 195 | petemolly.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 196 | petemountford.com | Tucows Domains Inc. | 29 Jun 2022 | 9 Aug 2024 | 29 Jun 2024 |
| 197 | petemergencylending.com | GoDaddy.com, LLC | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 198 | petemartinezsf.com | register.com, Inc. | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 199 | petemitchellphotography.com | GoDaddy.com, LLC | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 200 | petemccloskeymovie.com | Dynadot, LLC | 26 Feb 2024 | 26 Jul 2025 | 26 Feb 2026 |
| 201 | petemaverick.com | eNom, Inc. | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 202 | petemiller3.com | 1API GmbH | 10 Jun 2015 | 16 Jul 2017 | 10 Jun 2017 |
| 203 | petemichele-canada09.com | Tucows Domains Inc. | 7 Jun 2009 | 11 Jun 2015 | 7 Jun 2016 |
| 204 | petemartinezrealtor.org | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 205 | petemartinezrealtor.net | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 206 | petemartinezrealtor.info | GoDaddy.com, LLC | 12 Jun 2015 | - | 12 Jun 2016 |
| 207 | petemcgann.com | CloudFlare, Inc. | 28 Apr 2025 | 5 May 2025 | 28 Apr 2026 |
| 208 | petematthiessen.com | eNom, Inc. | 18 Jun 2015 | 18 Jun 2025 | 18 Jun 2026 |
| 209 | petemergencypacks.com | Brandsight, Inc. | 20 Sep 2015 | 11 Mar 2025 | 20 Sep 2026 |
| 210 | petemantra.com | register.com, Inc. | 22 Jun 2015 | 24 Jun 2017 | 22 Jun 2018 |
| 211 | petemporiums.com | GoDaddy.com, LLC | 15 Aug 2024 | 20 Aug 2025 | 15 Aug 2026 |
| 212 | petemoorepresents.com | Network Solutions, LLC | 25 Jun 2015 | 26 Apr 2017 | 25 Jun 2018 |
| 213 | petemiler.com | Tucows Domains Inc. | 26 Jun 2015 | 30 Jun 2017 | 26 Jun 2017 |
| 214 | petemacias.com | Tucows Domains Inc. | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2017 |
| 215 | petemtz.com | Tucows Domains Inc. | 3 Jul 2015 | 4 Jun 2025 | 3 Jul 2026 |
| 216 | petemossphotography.com | register.com, Inc. | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 217 | petemergency.care | GoDaddy.com, LLC | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2016 |
| 218 | petemon.net | Dynamic Network Services, Inc. | 25 Sep 2015 | 3 Sep 2025 | 25 Sep 2026 |
| 219 | petemustafaraj.com | Google, Inc. | 11 May 2023 | 22 Jun 2025 | 11 May 2025 |
| 220 | petemercer.com | Squarespace Domains LLC | 2 Oct 2025 | 2 Oct 2025 | 2 Oct 2026 |
| 221 | petemorleyknows.com | Tucows Domains Inc. | 26 Sep 2015 | 30 Sep 2018 | 26 Sep 2018 |
| 222 | petemergencykits.com | TurnCommerce, Inc. DBA NameBright.com | 22 Dec 2018 | 11 Feb 2025 | 22 Dec 2025 |
| 223 | petemahoney.com | West263 International Limited | 14 Dec 2022 | 26 Feb 2024 | 14 Dec 2023 |
| 224 | peteminich.com | GoDaddy.com, LLC | 17 Jul 2015 | 18 Jul 2025 | 17 Jul 2026 |
| 225 | petemarsden.com | NameCheap, Inc. | 20 Jul 2015 | 14 Jul 2025 | 20 Jul 2026 |
| 226 | petemergencyspecialists.com | GoDaddy.com, LLC | 28 Sep 2015 | 15 Sep 2025 | 28 Sep 2026 |
| 227 | petemergencyspecialist.com | GoDaddy.com, LLC | 28 Sep 2015 | 15 Sep 2025 | 28 Sep 2026 |
| 228 | petemarinorealestate.com | eNom, Inc. | 21 Jul 2015 | 21 Jul 2015 | 21 Jul 2016 |
| 229 | petemirate-ae.com | OnlineNIC, Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 230 | petemcpartlandjr.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2025 | 30 Sep 2030 |
| 231 | petemcpartland.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2025 | 30 Sep 2030 |
| 232 | petemckee.com | Webfusion Ltd. | 7 Jan 2005 | 1 Mar 2023 | 7 Jan 2029 |
| 233 | petemanre.com | Wild West Domains, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 234 | petemanchester.com | Tucows Domains Inc. | 27 Jul 2015 | 13 Jul 2025 | 27 Jul 2026 |
| 235 | petemaass.info | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 236 | petemellits.com | Domain.com, LLC | 23 Jan 2018 | 23 Jan 2018 | 23 Jan 2019 |
| 237 | petemorrowdesign.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2016 |
| 238 | petemaass.org | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 239 | petemaass.net | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 240 | petemounce.com | GoDaddy.com, LLC | 2 Aug 2015 | 3 Aug 2025 | 2 Aug 2027 |
| 241 | petemelcherchemistry.com | GoDaddy.com, LLC | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2017 |
| 242 | petemahendra.info | GoDaddy.com, LLC | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2016 |
| 243 | petemuniz.com | NameCheap, Inc. | 3 Jul 2024 | 3 Jun 2025 | 3 Jul 2026 |
| 244 | petemoreira.com | DreamHost, LLC | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 245 | petemergency.org | GoDaddy.com, LLC | 29 Dec 2016 | 12 Feb 2025 | 29 Dec 2026 |
| 246 | petempati.com | CloudFlare, Inc. | 21 Mar 2023 | 6 May 2025 | 21 Mar 2026 |
| 247 | petemailmarketing.com | GoDaddy.com, LLC | 21 Oct 2015 | 3 Nov 2025 | 21 Oct 2026 |
| 248 | petemaher.net | GoDaddy.com, LLC | 11 Nov 2025 | 11 Nov 2025 | 11 Nov 2030 |
| 249 | petemergencycard.com | GoDaddy.com, LLC | 24 Oct 2015 | 25 Oct 2025 | 24 Oct 2026 |
| 250 | petemcdonnell.com | - | 24 Oct 2015 | 24 Oct 2015 | 24 Oct 2017 |
| 251 | petemccartney.net | EPAG Domainservices GmbH | 25 Oct 2015 | 26 Oct 2016 | 25 Oct 2017 |
| 252 | petemcartney.net | EPAG Domainservices GmbH | 25 Oct 2015 | 26 Oct 2016 | 25 Oct 2017 |
| 253 | petemcfarlane.com | NameCheap, Inc. | 26 Oct 2015 | 27 Oct 2025 | 26 Oct 2026 |
| 254 | petemergencytags.info | Network Solutions, LLC | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 255 | petemarkus.com | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2017 |
| 256 | petemorrison.net | FastDomain Inc. | 31 Oct 2015 | 31 Oct 2015 | 31 Oct 2016 |
| 257 | petemergencykits.org | 1&1 Internet AG | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 258 | petemadsen.com | DropCatch.com 712 LLC | 30 Oct 2015 | 31 Oct 2016 | 30 Oct 2017 |
| 259 | petemaddocks.com | GoDaddy.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 260 | petemccallfitness.net | 1&1 Internet AG | 7 Nov 2015 | 7 Nov 2016 | 7 Nov 2017 |
| 261 | petemccallfitness.com | GoDaddy.com, LLC | 7 Nov 2015 | 29 Oct 2025 | 7 Nov 2026 |
| 262 | petemccall.fitness | 1&1 Internet AG | 7 Nov 2015 | 9 Apr 2019 | 7 Nov 2020 |
| 263 | petemorscheck.xyz | GoDaddy.com, LLC | 8 Nov 2015 | 23 Nov 2024 | 8 Nov 2025 |
| 264 | petemillermotors-hub.com | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 265 | petemason.org | register.com, Inc. | 18 Nov 2015 | 17 Jan 2016 | 18 Nov 2017 |
| 266 | petemoses.com | Tucows Domains Inc. | 19 Nov 2015 | 4 Nov 2025 | 19 Nov 2026 |
| 267 | petemitchellmusic.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Apr 2017 | 6 Jun 2017 | 6 Apr 2018 |
| 268 | petemo.com | GoDaddy.com, LLC | 22 Mar 2017 | 30 Aug 2025 | 22 Mar 2026 |
| 269 | petemenjares.com | FastDomain Inc. | 10 Dec 2015 | 10 Dec 2016 | 10 Dec 2017 |
| 270 | petemarcoux.com | Google, Inc. | 10 Dec 2015 | 25 Nov 2024 | 10 Dec 2025 |
| 271 | petemankins.info | Network Solutions, LLC | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 272 | petemaniscalco.com | Tucows Domains Inc. | 17 Dec 2015 | 2 Dec 2024 | 17 Dec 2025 |
| 273 | petemeltzer.com | enom451, Incorporated | 25 May 2021 | 28 May 2021 | 25 May 2022 |
| 274 | petempath.com | GoDaddy.com, LLC | 26 Aug 2019 | 1 Aug 2025 | 26 Aug 2026 |
| 275 | petemiakoda.com | Wild West Domains, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 276 | petemyrealtor.com | GoDaddy.com, LLC | 12 Jan 2020 | 12 Jan 2020 | 12 Jan 2021 |
| 277 | petemoak.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2019 |
| 278 | petemcdermott.com | eNom, Inc. | 8 Jan 2016 | 8 Jan 2017 | 8 Jan 2018 |
| 279 | petememphis.com | DROPCATCH.COM 795 LLC | 11 Jan 2016 | 12 Jan 2017 | 11 Jan 2018 |
| 280 | petemusic.net | Tucows Domains Inc. | 6 Jan 2016 | 8 Dec 2016 | 6 Jan 2018 |
| 281 | petemcknight.com | Automattic Inc. | 19 Jan 2016 | 23 Nov 2025 | 19 Jan 2026 |
| 282 | petemergencyspokane.com | Wild West Domains, LLC | 8 Nov 2010 | 14 Nov 2022 | 8 Nov 2028 |
| 283 | petemergencycarecard.net | Google, Inc. | 21 Jan 2016 | 21 Jan 2016 | 21 Jan 2017 |
| 284 | petemergencycarecard.com | Google, Inc. | 21 Jan 2016 | 21 Jan 2016 | 21 Jan 2017 |
| 285 | petempower.org | GoDaddy.com, LLC | 23 Jan 2016 | 23 Jan 2016 | 23 Jan 2017 |
| 286 | petempower.com | DropCatch.com 854 LLC | 28 Jun 2025 | 29 Jun 2025 | 28 Jun 2026 |
| 287 | petemjones.com | Wild West Domains, LLC | 26 Jan 2016 | 26 Jan 2016 | 26 Jan 2017 |
| 288 | petempad.com | GoDaddy.com, LLC | 29 Jul 2019 | 29 Jul 2019 | 29 Jul 2020 |
| 289 | petemergencymidwayanimalhospital.com | Key-Systems GmbH | 10 Feb 2016 | 10 Feb 2016 | 10 Feb 2017 |
| 290 | petempiresupply.com | Launchpad, Inc. | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 291 | petemianal.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 292 | petemeltzerjr.website | Reserved for non-billable transactions where Regis… | 5 Feb 2016 | - | 5 Feb 2017 |
| 293 | petemoss.mobi | Wild West Domains, LLC | 5 Feb 2016 | 3 Feb 2017 | 5 Feb 2018 |
| 294 | petemgroup.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2018 |
| 295 | petemilton.com | eNom, Inc. | 5 Feb 2016 | 5 Feb 2016 | 5 Feb 2019 |
| 296 | petemarvelous.com | Network Solutions, LLC | 9 Feb 2016 | 5 Mar 2017 | 8 Feb 2018 |
| 297 | petemran.com | Dynadot, LLC | 10 Feb 2016 | 10 Feb 2016 | 10 Feb 2017 |
| 298 | petemper.site | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2017 |
| 299 | petemac.com | Network Solutions, LLC | 2 Jun 1999 | 11 Apr 2025 | 2 Jun 2026 |
| 300 | petemacs.com | Eranet International Limited | 24 Apr 2021 | 10 Jun 2023 | 24 Apr 2023 |
| 301 | petemergencies.net | GoDaddy.com, LLC | 16 Feb 2016 | 19 Dec 2024 | 18 Dec 2028 |
| 302 | petemergency.pet | Go France Domains, LLC | 23 Feb 2016 | 14 Jun 2024 | 23 Feb 2027 |
| 303 | petemacinnis.com | Tucows Domains Inc. | 24 Feb 2016 | 26 Apr 2025 | 24 Feb 2026 |
| 304 | petemper.com | DropCatch.com 358 LLC | 14 May 2017 | 16 May 2017 | 14 May 2018 |
| 305 | petemcginn.com | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 306 | petemo.us | Gandi SAS | 5 Mar 2016 | 29 Jan 2017 | 4 Mar 2018 |
| 307 | petemagnusson.com | GoDaddy.com, LLC | 5 Mar 2016 | 5 Mar 2016 | 5 Mar 2018 |
| 308 | petemarivich.com | GoDaddy.com, LLC | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2017 |
| 309 | petemergencycards.net | GoDaddy.com, LLC | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 310 | petemergencycard.net | GoDaddy.com, LLC | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 311 | petemergency.cards | GoDaddy.com, LLC | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 312 | petemalinowski.net | GoDaddy.com, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 313 | petemalinowski.com | GoDaddy.com, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 314 | petemckeonbuildingco.org | GoDaddy.com, LLC | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 315 | petemckeonbuildingco.net | GoDaddy.com, LLC | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 316 | petemartingallery.com | eNom, Inc. | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 317 | petemooredds.com | register.com, Inc. | 15 Dec 2004 | 16 Dec 2024 | 15 Dec 2025 |
| 318 | petemorava.com | GoDaddy.com, LLC | 28 Mar 2016 | 14 Mar 2025 | 28 Mar 2027 |
| 319 | petemaddy.com | Crazy Domains FZ-LLC | 28 Mar 2016 | 28 Mar 2016 | 28 Mar 2017 |
| 320 | petemediition.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 30 Mar 2016 | 31 Mar 2017 | 30 Mar 2018 |
| 321 | petemihalek.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Sep 2024 | 19 Nov 2025 | 3 Sep 2026 |
| 322 | petemergencyservice.com | Webfusion Ltd. | 1 Apr 2016 | 2 Apr 2025 | 1 Apr 2026 |
| 323 | petemarsh.com | Tucows Domains Inc. | 31 Jan 2022 | 27 Feb 2025 | 31 Jan 2026 |
| 324 | petemobileappsforfree.xyz | NameCheap, Inc. | 11 Apr 2016 | 27 Apr 2016 | 11 Apr 2017 |
| 325 | petemobileapps.xyz | NameCheap, Inc. | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 326 | petemobile.xyz | NameCheap, Inc. | 11 Apr 2016 | 27 Apr 2016 | 11 Apr 2017 |
| 327 | petemobiappsforfree.xyz | NameCheap, Inc. | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 328 | petemobiapps.xyz | NameCheap, Inc. | 11 Apr 2016 | 27 Apr 2016 | 11 Apr 2017 |
| 329 | petemobi.xyz | NameCheap, Inc. | 11 Apr 2016 | 27 Apr 2016 | 11 Apr 2017 |
| 330 | petemaster.com | Vautron Rechenzentrum AG | 14 Apr 2016 | 14 Apr 2016 | 14 Apr 2017 |
| 331 | petemark.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 Sep 2022 | 26 Sep 2023 | 25 Sep 2024 |
| 332 | petemcelroy.scot | Easyspace LTD | 23 Sep 2014 | 24 Aug 2017 | 23 Sep 2018 |
| 333 | peteman.scot | 1&1 Internet AG | 23 Sep 2014 | - | 23 Sep 2016 |
| 334 | petemblems.com | GoDaddy.com, LLC | 19 Dec 2005 | 16 Apr 2025 | 19 Dec 2025 |
| 335 | petemendrin.com | GoDaddy.com, LLC | 2 May 2016 | 2 May 2016 | 2 May 2017 |
| 336 | petemccarthybooks.com | GoDaddy.com, LLC | 2 May 2016 | 2 May 2025 | 2 May 2026 |
| 337 | petemcpa.com | Network Solutions, LLC | 28 Oct 1998 | 30 Aug 2021 | 27 Oct 2026 |
| 338 | petems.org | GoDaddy.com, LLC | 4 May 2016 | 4 May 2016 | 4 May 2017 |
| 339 | petemilionis.com | FastDomain Inc. | 12 May 2016 | 6 May 2017 | 12 May 2018 |
| 340 | petemillerpiano.com | Network Solutions, LLC | 17 May 2016 | 17 May 2016 | 17 May 2018 |
| 341 | petemacumber.com | Google, Inc. | 29 Aug 2023 | 28 Aug 2025 | 29 Aug 2026 |
| 342 | petemattcreative.net | GoDaddy.com, LLC | 19 May 2016 | 19 May 2016 | 19 May 2017 |
| 343 | petemergencycenter.info | Network Solutions, LLC | 20 May 2016 | 20 May 2016 | 20 May 2017 |
| 344 | petemacfarlane.com | Squarespace Domains LLC | 27 Feb 2025 | 27 Feb 2025 | 27 Feb 2028 |
| 345 | petemus.club | Tucows Domains Inc. | 25 Apr 2016 | 25 Apr 2016 | 24 Apr 2017 |
| 346 | petemoneydesings.com | GoDaddy.com, LLC | 27 May 2016 | 27 May 2016 | 27 May 2017 |
| 347 | petemagnabosco.com | register.com, Inc. | 27 May 2016 | 27 May 2016 | 27 May 2017 |
| 348 | petemoore.biz | Mesh Digital Limited | 28 Jun 2002 | 24 Oct 2025 | 27 Jun 2027 |
| 349 | petempawrium.com | NameCheap, Inc. | 21 Mar 2024 | 29 Apr 2025 | 21 Mar 2026 |
| 350 | petemitchelmore.com | NameCheap, Inc. | 2 Jun 2016 | 3 May 2025 | 2 Jun 2026 |
| 351 | petemillson.com | NameCheap, Inc. | 8 Oct 2025 | 8 Oct 2025 | 8 Oct 2026 |
| 352 | petemaloney.org | Google, Inc. | 5 Jun 2016 | 17 Jul 2025 | 5 Jun 2026 |
| 353 | petemoore.com | GoDaddy.com, LLC | 18 Oct 1996 | 13 Oct 2025 | 17 Oct 2030 |
| 354 | petemillers.com | GoDaddy.com, LLC | 17 Mar 2000 | 17 Mar 2025 | 17 Mar 2026 |
| 355 | petemparker.com | GoDaddy.com, LLC | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 356 | petempresa.com | Hostinger, UAB | 15 Oct 2024 | 18 Sep 2025 | 15 Oct 2026 |
| 357 | petemarasmitch.com | Namesilo, LLC | 11 Nov 2017 | 9 Nov 2025 | 11 Nov 2026 |
| 358 | petemooresings.com | GoDaddy.com, LLC | 18 Jun 2016 | 18 Jun 2016 | 18 Jun 2018 |
| 359 | petemcgeephotography.com | FastDomain Inc. | 18 Jun 2016 | 3 Jun 2025 | 18 Jun 2026 |
| 360 | petemcdowell.info | GoDaddy.com, LLC | 21 Jan 2020 | 7 Mar 2025 | 21 Jan 2026 |
| 361 | petemarrieskate.com | eNom, Inc. | 21 Jun 2016 | 21 Jun 2016 | 21 Jun 2017 |
| 362 | petemergencycontacts.com | GoDaddy.com, LLC | 29 Jun 2016 | 22 Sep 2022 | 29 Jun 2026 |
| 363 | petemergencycontact.com | GoDaddy.com, LLC | 29 Jun 2016 | 22 Sep 2022 | 29 Jun 2026 |
| 364 | petemergencycontactcards.com | GoDaddy.com, LLC | 29 Jun 2016 | 30 Jun 2024 | 29 Jun 2026 |
| 365 | petemergencycontactcard.com | GoDaddy.com, LLC | 29 Jun 2016 | 30 Jun 2024 | 29 Jun 2026 |
| 366 | petemitchell.live | CloudFlare, Inc. | 1 Jul 2016 | 6 Jun 2025 | 1 Jul 2026 |
| 367 | petemergencycontact.org | GoDaddy.com, LLC | 2 Jul 2016 | 16 Aug 2024 | 2 Jul 2026 |
| 368 | petemergencybuffalo.com | GoDaddy.com, LLC | 4 Sep 2013 | 7 Jun 2023 | 4 Sep 2032 |
| 369 | petemaina.com | 1&1 Internet AG | 19 Jun 2006 | 24 Jun 2022 | 19 Jun 2026 |
| 370 | petemhicks.com | register.com, Inc. | 8 Jul 2016 | 8 Jul 2016 | 8 Jul 2026 |
| 371 | petemcdowell.xyz | OVH sas | 20 Jun 2016 | 3 Aug 2017 | 20 Jun 2018 |
| 372 | petemm.com | 1&1 Internet AG | 9 Jul 2016 | 10 Oct 2025 | 9 Jul 2026 |
| 373 | petemkasa.com | GoDaddy.com, LLC | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 374 | petemitchell.ninja | CloudFlare, Inc. | 12 Jun 2014 | 18 May 2025 | 12 Jun 2026 |
| 375 | petemassey.photography | 1&1 Internet AG | 18 Feb 2014 | 4 Apr 2025 | 18 Feb 2026 |
| 376 | petemccutchen.photography | GoDaddy.com, LLC | 3 Apr 2014 | 18 May 2020 | 3 Apr 2022 |
| 377 | petemcbride.florist | 1&1 Internet AG | 9 Apr 2014 | 24 May 2016 | 9 Apr 2017 |
| 378 | petemotion.com | NameCheap, Inc. | 22 Oct 2024 | 22 Sep 2025 | 22 Oct 2026 |
| 379 | petemergencyandreferralcenter.biz | Network Solutions, LLC | 10 Sep 2013 | 16 Jul 2018 | 9 Sep 2020 |
| 380 | petemoss.biz | Wild West Domains, LLC | 30 May 2007 | 30 May 2017 | 29 May 2018 |
| 381 | petemergencyclinic.biz | 1&1 Internet AG | 12 Apr 2010 | 12 May 2025 | 11 Apr 2025 |
| 382 | petemccracken.biz | GoDaddy.com, LLC | 26 Mar 2007 | 12 Aug 2016 | 25 Mar 2017 |
| 383 | petemorris.biz | GoDaddy.com, LLC | 5 Jun 2002 | 10 Jun 2019 | 4 Jun 2020 |
| 384 | petemackey.com | Tucows Domains Inc. | 17 Jul 2016 | 3 Jul 2025 | 17 Jul 2026 |
| 385 | petemackey.net | Tucows Domains Inc. | 17 Jul 2016 | 3 Jul 2025 | 17 Jul 2026 |
| 386 | petemackey.org | Tucows Domains Inc. | 17 Jul 2016 | 8 Jul 2025 | 17 Jul 2026 |
| 387 | petemacfarlanememorials.com | GoDaddy.com, LLC | 19 Jul 2016 | 19 Jul 2016 | 19 Jul 2018 |
| 388 | petemeinholz.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2018 |
| 389 | petemason.com | GoDaddy.com, LLC | 10 Oct 2019 | 24 Oct 2025 | 10 Oct 2026 |
| 390 | petember.com | GoDaddy.com, LLC | 23 Jul 2016 | 28 Jul 2024 | 23 Jul 2026 |
| 391 | petember.net | GoDaddy.com, LLC | 23 Jul 2016 | 28 Jul 2024 | 23 Jul 2026 |
| 392 | petemayberrygames.com | Google, Inc. | 29 Jul 2016 | 28 Jul 2017 | 29 Jul 2018 |
| 393 | petemccall.com | DropCatch.com 714 LLC | 26 Oct 2019 | 26 Oct 2019 | 26 Oct 2020 |
| 394 | petemiller.us | - | 6 Aug 2007 | 6 Aug 2007 | 5 Aug 2016 |
| 395 | petemurrayscornfarm.com | Network Solutions, LLC | 16 Jun 2008 | 14 Jun 2024 | 16 Jun 2026 |
| 396 | petemurdock.com | CloudFlare, Inc. | 13 Aug 2007 | 14 Jul 2025 | 13 Aug 2026 |
| 397 | petemergencyandreferralcenter.info | Network Solutions, LLC | 15 Aug 2016 | 27 Sep 2017 | 15 Aug 2018 |
| 398 | petemoore.info | GoDaddy.com, LLC | 20 Aug 2016 | 4 Oct 2025 | 20 Aug 2026 |
| 399 | petemclachlan.com | FastDomain Inc. | 11 Nov 2021 | 18 May 2023 | 11 Nov 2026 |
| 400 | petemanglaviti.com | GoDaddy.com, LLC | 25 Aug 2016 | 25 Aug 2016 | 25 Aug 2017 |
| 401 | petemonroe.com | GoDaddy.com, LLC | 25 Aug 2016 | 25 Aug 2016 | 25 Aug 2018 |
| 402 | petemanrealty.com | - | 29 Aug 2016 | 29 Aug 2016 | 29 Aug 2019 |
| 403 | petematthew.live | 1&1 Internet AG | 1 Sep 2016 | 16 Oct 2025 | 1 Sep 2026 |
| 404 | petemurrayinsingapore.com | DomainName Driveway, Inc. | 20 Nov 2019 | 20 Nov 2019 | 20 Nov 2020 |
| 405 | petemilner.com | GoDaddy.com, LLC | 2 Sep 2016 | 2 Sep 2024 | 2 Sep 2026 |
| 406 | petemasters.com | GoDaddy.com, LLC | 6 Sep 2016 | 7 Sep 2024 | 6 Sep 2026 |
| 407 | petemoon.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 26 Feb 2025 | 25 Apr 2025 | 26 Feb 2026 |
| 408 | petemiernicki.com | eNom, Inc. | 15 Sep 2016 | 14 Aug 2017 | 15 Sep 2018 |
| 409 | petemartin.us | - | 13 Sep 2016 | 13 Sep 2016 | 12 Sep 2021 |
| 410 | petemcmanus.com | GoDaddy.com, LLC | 22 Mar 2006 | 22 Mar 2025 | 22 Mar 2026 |
| 411 | petemerzin.com | eNom, Inc. | 16 May 2009 | 1 May 2025 | 16 May 2026 |
| 412 | petemeechan.com | Webfusion Ltd. | 10 Sep 2001 | 24 Nov 2022 | 10 Sep 2022 |
| 413 | petemclaughlinconsulting.com | GoDaddy.com, LLC | 19 Oct 2010 | 20 Oct 2025 | 19 Oct 2026 |
| 414 | petemillerlaw.com | GoDaddy.com, LLC | 16 Jul 2009 | 6 Sep 2022 | 16 Jul 2029 |
| 415 | petemergencyclinicdesmoineswa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 416 | petemuscle.com | 1&1 Internet AG | 17 Dec 2008 | 6 Jan 2025 | 17 Dec 2025 |
| 417 | petemergencyclinicauburnwa.com | GoDaddy.com, LLC | 19 Jan 2012 | 20 Jan 2016 | 19 Jan 2017 |
| 418 | petemichaud.com | GoDaddy.com, LLC | 5 Dec 2009 | 6 Dec 2024 | 5 Dec 2025 |
| 419 | petemachalektedx.com | GoDaddy.com, LLC | 17 Oct 2015 | 20 Jan 2025 | 19 Jan 2026 |
| 420 | petemanriquez.com | GoDaddy.com, LLC | 21 May 2012 | 21 May 2012 | 21 May 2017 |
| 421 | petemergencysticker.com | GoDaddy.com, LLC | 6 Mar 2009 | 9 Mar 2016 | 6 Mar 2017 |
| 422 | petemunoz.com | Wild West Domains, LLC | 20 Jul 2008 | 5 Sep 2022 | 20 Jul 2032 |
| 423 | petemccabe.com | Tucows Domains Inc. | 17 Jul 2024 | 16 Jul 2025 | 17 Jul 2026 |
| 424 | petemooreautogroup.com | MarkMonitor Inc. | 16 Jul 2007 | 14 Jun 2017 | 16 Jul 2018 |
| 425 | petemoser.com | Easyspace LTD | 25 May 2011 | 24 May 2025 | 25 May 2027 |
| 426 | petemccutchen.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Sep 2025 | 10 Nov 2025 | 7 Sep 2026 |
| 427 | petemcnerney.com | NameCheap, Inc. | 16 Oct 2012 | 16 Sep 2025 | 16 Oct 2026 |
| 428 | petemergencyvetfederalwaywa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 429 | petemiksza.com | Wild West Domains, LLC | 3 May 2013 | 3 Apr 2025 | 3 May 2026 |
| 430 | petemergencyclinicalgonawa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 431 | petemanleyremodeling.com | Tucows Domains Inc. | 2 Mar 2009 | 16 Feb 2025 | 2 Mar 2026 |
| 432 | petemountain.com | Webfusion Ltd. | 10 Apr 2009 | 21 Apr 2024 | 10 Apr 2026 |
| 433 | petemarchant.com | NetEarth One Inc. d/b/a NetEarth | 20 Jan 2008 | 3 Jan 2025 | 20 Jan 2026 |
| 434 | petemccormickagency.com | GoDaddy.com, LLC | 2 Dec 2005 | 1 Dec 2014 | 2 Dec 2019 |
| 435 | petemay.com | Wild West Domains, LLC | 3 Dec 1999 | 4 Dec 2024 | 3 Dec 2025 |
| 436 | petematter.com | GoDaddy.com, LLC | 11 Jul 2010 | 12 Jul 2016 | 11 Jul 2017 |
| 437 | petemorley.com | eNom, Inc. | 14 Jan 2008 | 8 Jan 2024 | 14 Jan 2026 |
| 438 | petemaravichtrophy.com | Domainwards.com LLC | 13 Jun 2014 | 14 Jun 2017 | 13 Jun 2018 |
| 439 | petemiller.com | Google, Inc. | 17 Dec 2009 | 2 Dec 2024 | 17 Dec 2025 |
| 440 | petemcreynolds.com | GoDaddy.com, LLC | 20 Feb 2006 | 21 Feb 2025 | 20 Feb 2026 |
| 441 | petemoulton.com | GoDaddy.com, LLC | 9 Jul 2000 | 2 Oct 2025 | 2 Oct 2028 |
| 442 | petemauganstv.com | GoDaddy.com, LLC | 25 Jan 2011 | 26 Jan 2016 | 25 Jan 2017 |
| 443 | petemccluskey.com | GoDaddy.com, LLC | 18 May 2013 | 19 May 2015 | 18 May 2017 |
| 444 | petemergencydesmoineswa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 445 | petemedaughdds.com | GoDaddy.com, LLC | 7 Mar 2006 | 8 Mar 2025 | 7 Mar 2026 |
| 446 | petemaric.com | One.com A/S | 4 Oct 2024 | 5 Oct 2025 | 4 Oct 2026 |
| 447 | petemalinverni.com | Tucows Domains Inc. | 29 Jul 2000 | 14 Jul 2025 | 29 Jul 2026 |
| 448 | petemaimone.com | GoDaddy.com, LLC | 5 Feb 2007 | 6 Feb 2024 | 5 Feb 2026 |
| 449 | petemckinstry.com | Amazon Registrar, Inc. | 11 Oct 2007 | 6 Sep 2025 | 11 Oct 2026 |
| 450 | petemcbride.com | GoDaddy.com, LLC | 5 May 2004 | 6 May 2025 | 5 May 2027 |
| 451 | petemankinsnissan.com | Internet Domain Services BS Corp | 21 Jan 2008 | 23 Jan 2017 | 21 Jan 2018 |
| 452 | petemallon.com | Paragon Internet Group Ltd t/a Paragon Names | 16 May 2011 | 26 Jun 2024 | 16 May 2024 |
| 453 | petemaupin.com | GoDaddy.com, LLC | 28 Jun 2010 | 29 Jun 2024 | 28 Jun 2027 |
| 454 | petemccracken.com | Squarespace Domains LLC | 26 Mar 2007 | 3 Apr 2025 | 26 Mar 2026 |
| 455 | petemassey.com | eNom, Inc. | 16 Dec 2006 | 9 Dec 2024 | 16 Dec 2029 |
| 456 | petemartin.com | Instra Corporation Pty Ltd. | 16 Mar 2000 | 13 Mar 2025 | 16 Mar 2026 |
| 457 | petemylerberg.com | NameCheap, Inc. | 29 Apr 2005 | 27 Mar 2023 | 29 Apr 2026 |
| 458 | petemccleary.com | GoDaddy.com, LLC | 17 May 2014 | 22 Mar 2016 | 17 May 2018 |
| 459 | petemergencycovingtonwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 460 | petemergencyclinictn.com | eNom, Inc. | 11 Jun 2013 | 30 Oct 2017 | 11 Jun 2018 |
| 461 | petemergencyvetcovingtonwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 462 | petemergencyclinicspokane.com | Wild West Domains, LLC | 18 Jun 2024 | 18 Jun 2024 | 18 Jun 2027 |
| 463 | petemanning.com | FastDomain Inc. | 20 Jan 2014 | 5 Jan 2025 | 20 Jan 2026 |
| 464 | petemankinnissan.com | Network Solutions, LLC | 27 Aug 2007 | 2 Sep 2025 | 27 Aug 2026 |
| 465 | petemooremitsubishi.com | GoDaddy.com, LLC | 23 Jan 2001 | 2 Oct 2022 | 23 Jan 2027 |
| 466 | petemitchellinc.com | CloudFlare, Inc. | 29 Jul 2008 | 29 Jun 2025 | 29 Jul 2026 |
| 467 | petemaravichstory.com | enom447, Incorporated | 25 Apr 2025 | 28 Apr 2025 | 25 Apr 2026 |
| 468 | petemorris.com | GoDaddy.com, LLC | 22 May 2000 | 30 Sep 2025 | 5 Jul 2026 |
| 469 | petemcintosh.com | GoDaddy.com, LLC | 16 Jul 2009 | 17 Jul 2025 | 16 Jul 2026 |
| 470 | petematt.com | GoDaddy.com, LLC | 6 May 2012 | 11 Sep 2022 | 6 May 2027 |
| 471 | petemorrisdesign.com | Infomaniak Network SA | 16 Dec 2024 | 16 Dec 2024 | 16 Dec 2025 |
| 472 | petemets.com | GoDaddy.com, LLC | 30 Nov 2011 | 9 Apr 2015 | 3 Jun 2017 |
| 473 | petemagic.com | TurnCommerce, Inc. DBA NameBright.com | 30 Mar 2013 | 24 Mar 2021 | 30 Mar 2026 |
| 474 | petemustaniemi.com | NameCheap, Inc. | 20 Mar 2019 | 18 Feb 2025 | 20 Mar 2026 |
| 475 | petemattich.com | eNom, Inc. | 12 Dec 2007 | 7 Dec 2016 | 12 Dec 2017 |
| 476 | petemergencyvettukwilawa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 477 | petemergencypuyallupwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 478 | petemcasacuritiba.com | Network Solutions, LLC | 11 Oct 2013 | 15 Jun 2016 | 11 Oct 2016 |
| 479 | petemarshallphoto.com | Wild West Domains, LLC | 7 Mar 2013 | 8 Mar 2025 | 7 Mar 2026 |
| 480 | petemergencyvetkentwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 481 | petemankins.com | Network Solutions, LLC | 6 Sep 1997 | 7 Jul 2024 | 5 Sep 2029 |
| 482 | petemacintosh.com | GoDaddy.com, LLC | 4 May 2006 | 5 May 2025 | 4 May 2026 |
| 483 | petemott.com | Tucows Domains Inc. | 28 Aug 2010 | 30 Jul 2025 | 28 Aug 2026 |
| 484 | petemuir.com | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 25 Mar 2022 | 6 Jun 2023 | 25 Mar 2023 |
| 485 | petemartinezrealtor.com | GoDaddy.com, LLC | 14 Jun 2011 | 12 Jun 2015 | 14 Jun 2017 |
| 486 | petemitchellins.com | Network Solutions, LLC | 22 Mar 2005 | 25 Mar 2024 | 22 Mar 2029 |
| 487 | petemergencykit.com | TurnCommerce, Inc. DBA NameBright.com | 24 Jun 2014 | 18 Jun 2020 | 24 Jun 2026 |
| 488 | petemc.com | GoDaddy.com, LLC | 22 Oct 2008 | 23 Oct 2025 | 22 Oct 2026 |
| 489 | petemergencyvetpacificwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 15 Jan 2017 | 1 Feb 2018 |
| 490 | petemporiumelpasotx.com | Name.com, Inc. | 6 Jul 2005 | 10 May 2017 | 6 Jul 2017 |
| 491 | petemit.com | ZigZagNames.com LLC | 13 Aug 2022 | 27 Oct 2023 | 13 Aug 2023 |
| 492 | petemcgowan.com | GoDaddy.com, LLC | 4 Mar 2013 | 4 Mar 2025 | 4 Mar 2027 |
| 493 | petemazeika.com | register.com, Inc. | 12 Mar 2007 | 13 Mar 2025 | 12 Mar 2026 |
| 494 | petemorgan.com | TurnCommerce, Inc. DBA NameBright.com | 26 Aug 2012 | 19 Jul 2025 | 26 Aug 2026 |
| 495 | petemora.com | CloudFlare, Inc. | 29 Sep 2009 | 3 Oct 2025 | 29 Sep 2026 |
| 496 | petemes.com | GoDaddy.com, LLC | 12 Oct 2007 | 13 Oct 2025 | 12 Oct 2026 |
| 497 | petemalicki.com | Instra Corporation Pty Ltd. | 28 Aug 2008 | 22 Nov 2025 | 28 Aug 2030 |
| 498 | petemccoy.com | eNom, Inc. | 6 Oct 2003 | 2 Sep 2025 | 6 Oct 2026 |
| 499 | petemonro.com | Wild West Domains, LLC | 28 Nov 2004 | 29 Nov 2014 | 28 Nov 2016 |
| 500 | petemarkakos.com | 1&1 Internet AG | 3 Nov 2010 | 3 Nov 2010 | 3 Nov 2016 |
| 501 | petemaver.com | GoDaddy.com, LLC | 20 Jan 2005 | 21 Jan 2024 | 20 Jan 2027 |
| 502 | petemergencylakewoodranch.com | Namesilo, LLC | 21 Feb 2012 | 1 Nov 2017 | 21 Feb 2018 |
| 503 | petemar.com | Nicco Ltd. | 25 Dec 2006 | 28 May 2025 | 25 Dec 2025 |
| 504 | petemcleod.com | Annulet LLC | 6 Mar 2014 | 23 Apr 2025 | 6 Mar 2026 |
| 505 | petemergencycarecentertn.com | Internet Domain Services BS Corp | 25 Jul 2022 | 24 Jul 2025 | 25 Jul 2026 |
| 506 | petemccallum.com | GoDaddy.com, LLC | 20 Jul 2011 | 17 Jul 2025 | 20 Jul 2027 |
| 507 | petemassa.com | eNom, Inc. | 6 Mar 2002 | 3 Feb 2025 | 6 Mar 2026 |
| 508 | petemarshall.com | Uniregistrar Corp | 13 Jun 2014 | 28 Jan 2023 | 13 Jun 2030 |
| 509 | petemeachum.com | GoDaddy.com, LLC | 31 Jan 2010 | 1 Feb 2016 | 31 Jan 2018 |
| 510 | petemartin-music.com | 1&1 Internet AG | 1 Aug 2013 | 2 Aug 2016 | 1 Aug 2018 |
| 511 | petemurph.com | Cosmotown, Inc. | 15 Jan 2023 | 15 Jan 2023 | 15 Jan 2024 |
| 512 | petemergencyclinictukwilawa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 513 | petemagill.com | - | 14 Aug 2025 | 14 Aug 2025 | 14 Aug 2026 |
| 514 | petemaclean.com | Network Solutions, LLC | 26 May 2000 | 27 Mar 2021 | 26 May 2026 |
| 515 | petemergencytreatment.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jan 2006 | 10 Nov 2025 | 11 Jan 2026 |
| 516 | petemusic.com | GoDaddy.com, LLC | 16 Apr 2008 | 17 Apr 2025 | 16 Apr 2027 |
| 517 | petemaughan.com | GoDaddy.com, LLC | 22 Feb 2021 | 27 Oct 2022 | 22 Feb 2026 |
| 518 | petemon.com | TurnCommerce, Inc. DBA NameBright.com | 8 Aug 2017 | 2 Aug 2020 | 8 Aug 2026 |
| 519 | petemangione.com | GoDaddy.com, LLC | 16 Aug 2011 | 4 Aug 2016 | 16 Aug 2017 |
| 520 | peteminda.com | 1&1 Internet AG | 14 Jun 2005 | 17 Mar 2018 | 14 Jun 2026 |
| 521 | petemarcin.com | GoDaddy.com, LLC | 13 Feb 2012 | 14 Feb 2024 | 13 Feb 2026 |
| 522 | petemazzocchi.com | DreamHost, LLC | 6 Apr 2010 | 6 Mar 2025 | 7 Apr 2026 |
| 523 | petemuldoon.com | - | 11 Nov 2025 | 11 Nov 2025 | 11 Nov 2026 |
| 524 | petematthew.com | 1&1 Internet AG | 13 Sep 2008 | 17 Mar 2018 | 13 Sep 2026 |
| 525 | petemergencyclinicbuckleywa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 526 | petemarcus.com | Tucows Domains Inc. | 18 Feb 2025 | 18 Feb 2025 | 18 Feb 2026 |
| 527 | petemartinez.com | Tucows Domains Inc. | 22 May 2006 | 23 Apr 2025 | 22 May 2026 |
| 528 | petemacgregor.com | GoDaddy.com, LLC | 6 Nov 2008 | 4 Nov 2024 | 6 Nov 2026 |
| 529 | petemorganfilms.com | Tucows Domains Inc. | 7 May 2009 | 11 May 2020 | 7 May 2020 |
| 530 | petemadigan.com | GoDaddy.com, LLC | 25 Sep 2013 | 26 Sep 2025 | 25 Sep 2026 |
| 531 | petemonster.com | GoDaddy.com, LLC | 17 Apr 2009 | 21 Feb 2015 | 17 Apr 2017 |
| 532 | petemagee.com | Network Solutions, LLC | 25 Jan 2002 | 5 Mar 2017 | 25 Jan 2018 |
| 533 | petemacho.com | GoDaddy.com, LLC | 4 Jul 2007 | 4 Sep 2022 | 4 Jul 2027 |
| 534 | petemiser.com | NameCheap, Inc. | 16 Sep 1999 | 22 Aug 2024 | 16 Sep 2033 |
| 535 | petemere.com | Wild West Domains, LLC | 9 Mar 2011 | 8 Mar 2016 | 9 Mar 2017 |
| 536 | petemergencyclinicedgewoodwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 537 | petemarquis.com | GoDaddy.com, LLC | 31 Oct 2011 | 1 Nov 2025 | 31 Oct 2027 |
| 538 | petemattila.com | GoDaddy.com, LLC | 16 Dec 2009 | 23 Nov 2025 | 16 Dec 2027 |
| 539 | petemrowka.com | GoDaddy.com, LLC | 21 Dec 2005 | 22 Dec 2024 | 21 Dec 2025 |
| 540 | petemergencyvetalgonawa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 541 | petemagasiny.com | GoDaddy.com, LLC | 22 Dec 2007 | 4 Sep 2022 | 22 Dec 2027 |
| 542 | petemacmahon.com | GoDaddy.com, LLC | 24 Sep 2009 | 25 Sep 2024 | 24 Sep 2026 |
| 543 | petemen.com | GoDaddy.com, LLC | 9 Jun 2011 | 9 Sep 2022 | 9 Jun 2026 |
| 544 | petemorrison.com | Tucows Domains Inc. | 11 Aug 2007 | 4 Aug 2025 | 11 Aug 2026 |
| 545 | petemergencyclinicblackdiamond.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 546 | petemajeski.com | register.com, Inc. | 11 May 2007 | 12 May 2025 | 11 May 2026 |
| 547 | petemergencyvetbuckleywa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 548 | petemitchellphoto.com | FastDomain Inc. | 17 Dec 2010 | 1 Dec 2024 | 17 Dec 2025 |
| 549 | petemartinezusa.com | GMO Internet Inc. | 5 Jun 2024 | 17 Jul 2025 | 5 Jun 2025 |
| 550 | petemergencyvetauburnwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 551 | petemurraymarketing.com | eNom, Inc. | 16 Sep 2013 | 28 Oct 2017 | 16 Sep 2017 |
| 552 | petemcguire.com | NameCheap, Inc. | 19 Dec 2000 | 19 Nov 2024 | 19 Dec 2025 |
| 553 | petemod.com | CloudFlare, Inc. | 4 Jul 2010 | 4 Jun 2025 | 4 Jul 2026 |
| 554 | petemoranmusic.com | register.com, Inc. | 29 Nov 2011 | 29 Nov 2011 | 29 Nov 2016 |
| 555 | petemergencytukwilawa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 556 | petemcdaniel.com | GoDaddy.com, LLC | 3 Feb 2011 | 16 Feb 2024 | 15 Feb 2026 |
| 557 | petemas.com | Eranet International Limited | 6 Nov 2021 | 6 Nov 2021 | 6 Nov 2022 |
| 558 | petemattson.com | GMO Internet Inc. | 14 Dec 2024 | 14 Dec 2024 | 14 Dec 2025 |
| 559 | petemikhjian.com | Google, Inc. | 3 Dec 2012 | 18 Nov 2024 | 3 Dec 2025 |
| 560 | petemondisbarbq.com | GoDaddy.com, LLC | 22 Jan 2014 | 23 Jan 2016 | 22 Jan 2017 |
| 561 | petemorales.com | DropCatch.com 486 LLC | 2 Jun 2017 | 16 Jul 2017 | 2 Jun 2018 |
| 562 | petemann.com | GoDaddy.com, LLC | 26 Feb 2008 | 26 Feb 2023 | 26 Feb 2026 |
| 563 | petemcclearys.com | GMO Internet Inc. | 9 Sep 2010 | 21 Oct 2017 | 9 Sep 2017 |
| 564 | petemackay.com | Wild West Domains, LLC | 14 Jul 2002 | 15 Jul 2025 | 14 Jul 2026 |
| 565 | petemcrae.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 15 Jul 2023 | 22 Aug 2024 | 15 Jul 2024 |
| 566 | petemergency911.com | Tucows Domains Inc. | 7 Apr 2025 | 7 Apr 2025 | 7 Apr 2026 |
| 567 | petemasse.com | GoDaddy.com, LLC | 3 Nov 2006 | 21 Dec 2010 | 3 Nov 2019 |
| 568 | petemonk.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 20 Jul 2010 | 18 Jul 2025 | 20 Jul 2026 |
| 569 | petemooreautocare.com | GoDaddy.com, LLC | 28 Apr 2014 | 10 May 2024 | 28 Apr 2025 |
| 570 | petemergencycliniccovingtonwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 571 | petemclaughlin.com | Webfusion Ltd. | 20 Feb 2004 | 21 Feb 2025 | 20 Feb 2026 |
| 572 | petemergencyalgonawa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 573 | petemacdonald.com | enom459, Incorporated | 22 Feb 2025 | 17 Mar 2025 | 22 Feb 2026 |
| 574 | petemarinovich.com | - | 19 May 2025 | 19 May 2025 | 19 May 2026 |
| 575 | petemergencyvetenumclawwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 576 | petemergencyclinicbonneylakewa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 577 | petembassy.com | TurnCommerce, Inc. DBA NameBright.com | 1 Sep 2011 | 26 Apr 2024 | 1 Sep 2026 |
| 578 | petemergencyvetwildernessvillagewa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 579 | petemobiledj.com | Tucows Domains Inc. | 25 Oct 2001 | 9 Oct 2024 | 25 Oct 2029 |
| 580 | petemergencymaplevalleywa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 581 | petemillermusic.com | Tucows Domains Inc. | 8 Apr 2005 | 10 Mar 2025 | 8 Apr 2026 |
| 582 | petemandik.com | Namesilo, LLC | 5 Jan 2005 | 6 Jan 2025 | 5 Jan 2026 |
| 583 | petemergencysd.com | Brandsight, Inc. | 11 Apr 2005 | 11 Mar 2025 | 11 Apr 2027 |
| 584 | petemergencyreferral.com | GoDaddy.com, LLC | 24 Apr 2014 | 24 Apr 2025 | 24 Apr 2026 |
| 585 | petemansi.com | Tucows Domains Inc. | 27 May 2011 | 12 May 2025 | 27 May 2026 |
| 586 | petemilazzo.com | GMO Internet Inc. | 21 Mar 2025 | 21 Mar 2025 | 21 Mar 2026 |
| 587 | petemonti.com | GoDaddy.com, LLC | 11 Jun 2009 | 13 Nov 2025 | 12 Nov 2026 |
| 588 | petemoraites.com | PSI-USA, Inc. dba Domain Robot | 9 Apr 2024 | 9 Apr 2024 | 9 Apr 2025 |
| 589 | petemploymenttrainingservice.com | GoDaddy.com, LLC | 25 Mar 2012 | 26 Mar 2024 | 25 Mar 2026 |
| 590 | petemploymentservice.com | GoDaddy.com, LLC | 25 Mar 2012 | 26 Mar 2024 | 25 Mar 2026 |
| 591 | petemyersrules.com | GoDaddy.com, LLC | 1 Dec 2020 | 1 Dec 2020 | 1 Dec 2021 |
| 592 | petemaxfield.com | GoDaddy.com, LLC | 17 Jul 2000 | 18 Jul 2025 | 17 Jul 2027 |
| 593 | petemilkman.com | Domain.com, LLC | 30 Dec 2001 | 9 Jul 2025 | 30 Dec 2025 |
| 594 | petemergencytag.com | Network Solutions, LLC | 8 Sep 2005 | 9 Jul 2025 | 8 Sep 2026 |
| 595 | petemarkey.com | Google, Inc. | 17 Oct 2006 | 2 Oct 2025 | 17 Oct 2026 |
| 596 | petemitchellsbarandgrill.com | - | 23 Oct 2025 | 14 Nov 2025 | 23 Oct 2026 |
| 597 | petemarlz.com | Crazy Domains FZ-LLC | 23 Feb 2013 | 15 Feb 2025 | 23 Feb 2027 |
| 598 | petemayisgay.com | register.com, Inc. | 26 Nov 2000 | 30 Aug 2011 | 26 Nov 2016 |
| 599 | petemattaliano.com | NameCheap, Inc. | 16 Feb 2013 | 17 Jan 2025 | 16 Feb 2026 |
| 600 | petemcpherson.com | GoDaddy.com, LLC | 15 Feb 2018 | 14 Mar 2024 | 15 Feb 2026 |
| 601 | petemillercpa.com | Wild West Domains, LLC | 5 Mar 2009 | 5 Feb 2024 | 5 Mar 2029 |
| 602 | petemilo.com | DomainPeople, Inc. | 8 Sep 2012 | 21 Oct 2017 | 8 Sep 2017 |
| 603 | petemichelle2003.com | GoDaddy.com, LLC | 7 Oct 2008 | 7 Oct 2023 | 7 Oct 2028 |
| 604 | petemarshfineart.com | NameCheap, Inc. | 19 Sep 2018 | 19 Sep 2018 | 19 Sep 2019 |
| 605 | petemcleodcomedy.com | GoDaddy.com, LLC | 22 Jun 2012 | 16 Jul 2015 | 22 Jun 2018 |
| 606 | petemastroianni.com | GoDaddy.com, LLC | 21 Feb 2006 | 18 Feb 2025 | 21 Feb 2026 |
| 607 | petemchugh.com | GoDaddy.com, LLC | 9 Feb 2006 | 1 Mar 2025 | 9 Feb 2026 |
| 608 | petemillermotors.com | GoDaddy.com, LLC | 16 Dec 2012 | 25 Oct 2025 | 16 Dec 2025 |
| 609 | petemolinari.com | NameCheap, Inc. | 27 Jan 2025 | 27 Jan 2025 | 27 Jan 2026 |
| 610 | petemaher.com | Tucows Domains Inc. | 10 May 2012 | 20 Apr 2025 | 10 May 2026 |
| 611 | petemergencyofmc.com | GoDaddy.com, LLC | 31 Jan 2014 | 31 Jan 2025 | 31 Jan 2027 |
| 612 | petemapp.com | 1&1 Internet AG | 16 Mar 2013 | 17 Mar 2016 | 16 Mar 2017 |
| 613 | petemergencypacificwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 614 | petemulry.com | GoDaddy.com, LLC | 27 Jan 2012 | 5 Feb 2024 | 27 Jan 2026 |
| 615 | petemaurer.com | GoDaddy.com, LLC | 21 Jun 2006 | 22 Jun 2024 | 21 Jun 2026 |
| 616 | petemertz.com | NameCheap, Inc. | 25 Jun 2014 | 26 May 2025 | 25 Jun 2026 |
| 617 | petemax.com | Domain.com, LLC | 12 Nov 1998 | 22 Oct 2025 | 11 Nov 2026 |
| 618 | petemitchell.com | Wild West Domains, LLC | 3 Dec 2004 | 4 Dec 2024 | 3 Dec 2025 |
| 619 | petemele.com | 1&1 Internet AG | 26 May 2007 | 17 Mar 2018 | 26 May 2026 |
| 620 | petemyall.com | Tucows Domains Inc. | 5 Feb 2013 | 9 Feb 2017 | 5 Feb 2017 |
| 621 | petemergencyteam.com | FastDomain Inc. | 24 Jul 2012 | 9 Jul 2025 | 24 Jul 2026 |
| 622 | petemillar.com | Tucows Domains Inc. | 13 Jan 2000 | 22 Nov 2023 | 13 Jan 2026 |
| 623 | petemolloyphotography.com | Wild West Domains, LLC | 6 Nov 2008 | 7 Nov 2014 | 6 Nov 2016 |
| 624 | petemanncoolcreations.com | Launchpad, Inc. | 21 Sep 2012 | 15 Oct 2015 | 21 Sep 2016 |
| 625 | petemcdonough.com | NameCheap, Inc. | 17 Sep 2025 | 22 Oct 2025 | 17 Sep 2026 |
| 626 | petemether.com | Tucows Domains Inc. | 5 May 2004 | 20 Jan 2023 | 5 May 2028 |
| 627 | petemcgarvey.com | Tucows Domains Inc. | 20 Dec 2013 | 5 Dec 2024 | 20 Dec 2025 |
| 628 | petemelov.com | Crazy Domains FZ-LLC | 20 Oct 2014 | 31 Oct 2017 | 20 Oct 2017 |
| 629 | petemergencyak.com | GoDaddy.com, LLC | 24 Oct 2013 | 30 Oct 2022 | 24 Oct 2026 |
| 630 | petemergencyvetrentonwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 631 | petemielke.com | Gandi SAS | 15 Aug 2024 | 15 Jul 2025 | 15 Aug 2026 |
| 632 | petemcdougall.com | Webfusion Ltd. | 27 Jun 2008 | 20 Jun 2016 | 27 Jun 2017 |
| 633 | petemergencyvetedgewoodwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 634 | petemastro.com | GoDaddy.com, LLC | 5 Apr 2011 | 5 Apr 2023 | 5 Apr 2028 |
| 635 | petemiller-multimedia.com | FastDomain Inc. | 2 Mar 2002 | 15 Feb 2025 | 2 Mar 2026 |
| 636 | petematthws.com | NameCheap, Inc. | 9 Dec 2010 | 9 Nov 2024 | 9 Dec 2025 |
| 637 | petemp.com | NameCheap, Inc. | 15 Aug 2013 | 16 Jul 2025 | 15 Aug 2026 |
| 638 | petemergencycenters.com | Network Solutions, LLC | 1 Dec 2006 | 1 Dec 2016 | 1 Dec 2026 |
| 639 | petemergencyclinicmaplevalleywa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 640 | petemcguinness.com | GoDaddy.com, LLC | 24 May 2006 | 25 May 2025 | 24 May 2027 |
| 641 | petemcclintock.com | GoDaddy.com, LLC | 28 Sep 2008 | 28 Jul 2025 | 28 Sep 2027 |
| 642 | petemercurio.com | DomainPeople, Inc. | 10 May 2012 | 25 Apr 2025 | 10 May 2026 |
| 643 | petemergencyroom.com | Annulet LLC | 26 Apr 2008 | 8 Mar 2025 | 19 Jan 2026 |
| 644 | petemontalvoinsurance.com | GoDaddy.com, LLC | 23 Apr 2009 | 5 May 2014 | 23 Apr 2017 |
| 645 | petemarinoguideservice.com | Tucows Domains Inc. | 22 May 2008 | 21 May 2025 | 22 May 2026 |
| 646 | petemergencyclinicpacificwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 647 | petemarriott.com | NameCheap, Inc. | 2 Mar 2007 | 31 Jan 2025 | 2 Mar 2026 |
| 648 | petemuenchdesigns.com | GoDaddy.com, LLC | 12 Sep 2010 | 12 Sep 2016 | 12 Sep 2018 |
| 649 | petemancuso.com | GoDaddy.com, LLC | 17 Apr 2007 | 17 Apr 2025 | 17 Apr 2026 |
| 650 | petemergencyclinictacomawa.com | GoDaddy.com, LLC | 19 Jan 2012 | 20 Jan 2016 | 19 Jan 2017 |
| 651 | petemergencyclinicsouthseattlewa.com | GoDaddy.com, LLC | 19 Jan 2012 | 20 Jan 2016 | 19 Jan 2017 |
| 652 | petemcleodaerosports.com | GoDaddy.com, LLC | 26 Jan 2006 | 3 Sep 2022 | 26 Jan 2026 |
| 653 | petemergencyblackdiamond.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 654 | petemacomber.com | GoDaddy.com, LLC | 27 Sep 2012 | 28 Sep 2014 | 27 Sep 2016 |
| 655 | petemasouras.com | Wild West Domains, LLC | 3 Dec 2012 | 21 May 2025 | 3 Dec 2025 |
| 656 | petemergencyclinicrentonwa.com | GoDaddy.com, LLC | 19 Jan 2012 | 20 Jan 2016 | 19 Jan 2017 |
| 657 | petemohan.com | GoDaddy.com, LLC | 5 Oct 2012 | 5 Oct 2024 | 5 Oct 2029 |
| 658 | petemergencyrooms.com | Rabbitsfoot.com LLC d/b/a Oxygen.nyc | 2 Aug 2009 | 20 Jan 2025 | 19 Jan 2026 |
| 659 | petemoffett.com | GoDaddy.com, LLC | 12 Aug 2009 | 12 Aug 2025 | 12 Aug 2026 |
| 660 | petemasterscarpentry.com | Launchpad, Inc. | 8 Oct 2013 | 8 Oct 2017 | 8 Oct 2017 |
| 661 | petemooreusedcars.com | GoDaddy.com, LLC | 21 Sep 2005 | 2 Oct 2022 | 21 Sep 2026 |
| 662 | petemillerphotography.com | GoDaddy.com, LLC | 17 Nov 2009 | 22 Sep 2015 | 17 Nov 2016 |
| 663 | petemccaskill.com | 1&1 Internet AG | 25 Jun 2008 | 26 Jun 2016 | 25 Jun 2018 |
| 664 | petemirk.com | Domain.com, LLC | 1 Mar 2002 | 24 Jun 2025 | 1 Mar 2026 |
| 665 | petemetcalfe.com | 1&1 Internet AG | 3 Feb 2012 | 17 Mar 2018 | 3 Feb 2026 |
| 666 | petemergencyclinickentwa.com | GoDaddy.com, LLC | 19 Jan 2012 | 20 Jan 2016 | 19 Jan 2017 |
| 667 | petemcmahon.com | GoDaddy.com, LLC | 26 Apr 2004 | 27 Apr 2025 | 26 Apr 2026 |
| 668 | petemporium4u.com | GoDaddy.com, LLC | 8 Mar 2006 | 9 Mar 2012 | 8 Mar 2017 |
| 669 | petemont.com | Key-Systems GmbH | 6 Nov 2024 | 6 Nov 2024 | 6 Nov 2026 |
| 670 | petemccann.com | eNom, Inc. | 3 Jan 2001 | 29 Dec 2024 | 3 Jan 2026 |
| 671 | petemcdonald.com | GoDaddy.com, LLC | 10 Jun 2021 | 14 May 2025 | 10 Jun 2026 |
| 672 | petemrobertson.com | GoDaddy.com, LLC | 11 Feb 2013 | 24 Mar 2025 | 11 Feb 2025 |
| 673 | petemcq.com | Crazy Domains FZ-LLC | 6 Apr 2010 | 8 Nov 2013 | 6 Apr 2018 |
| 674 | petemawhinney.com | TPP Domains Pty Ltd. dba TPP Internet | 22 Apr 2006 | 1 May 2019 | 22 Apr 2020 |
| 675 | petemclean.com | Webfusion Ltd. | 29 Jun 2018 | 30 Jun 2025 | 29 Jun 2026 |
| 676 | petemedcalfphoto.com | In2net Network, Inc. | 3 Sep 2009 | 13 Nov 2024 | 3 Sep 2024 |
| 677 | petemarino.com | GoDaddy.com, LLC | 25 Sep 1999 | 17 Nov 2023 | 25 Sep 2026 |
| 678 | petemead.com | NetEarth One Inc. d/b/a NetEarth | 5 Jan 2013 | 11 Dec 2024 | 5 Jan 2026 |
| 679 | petemcw.com | Porkbun, LLC | 19 Jun 2010 | 18 Jun 2025 | 19 Jun 2026 |
| 680 | petemarovichimages.com | DomainPeople, Inc. | 18 Jan 2008 | 3 Jan 2023 | 18 Jan 2026 |
| 681 | petemills.com | Tucows Domains Inc. | 17 Jun 2000 | 19 May 2025 | 17 Jun 2026 |
| 682 | petemorrisconsultancy.com | Register.it SPA | 1 Nov 2013 | 29 Oct 2025 | 1 Nov 2028 |
| 683 | petemacey.com | GoDaddy.com, LLC | 22 Sep 2006 | 23 Sep 2025 | 22 Sep 2026 |
| 684 | petemergencydoctor.com | GoDaddy.com, LLC | 6 Oct 2021 | 18 Dec 2023 | 6 Oct 2023 |
| 685 | petemporiumtextiles.com | eNom, Inc. | 20 Oct 2012 | 10 Oct 2017 | 20 Oct 2018 |
| 686 | petemds.com | GoDaddy.com, LLC | 19 Apr 2010 | 5 Feb 2025 | 1 Jun 2026 |
| 687 | petemergencyvetpuyallupwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 688 | petemasitti.com | GoDaddy.com, LLC | 4 Feb 2000 | 5 Feb 2024 | 4 Feb 2030 |
| 689 | petemerzbacher.com | GoDaddy.com, LLC | 17 Dec 2011 | 18 Dec 2015 | 17 Dec 2016 |
| 690 | petemanek.com | GoDaddy.com, LLC | 9 May 2011 | 10 May 2015 | 9 May 2017 |
| 691 | petemusson.com | Wix.com Ltd. | 30 Jun 2020 | 4 Jul 2024 | 30 Jun 2025 |
| 692 | petemccaffrey.com | register.com, Inc. | 2 May 2007 | 2 May 2007 | 2 May 2017 |
| 693 | petemergencyvehicle.com | FastDomain Inc. | 24 Jul 2012 | 9 Jul 2025 | 24 Jul 2026 |
| 694 | petemichaels.com | GoDaddy.com, LLC | 8 Feb 2021 | 2 Oct 2025 | 8 Feb 2026 |
| 695 | petemcgete.com | FastDomain Inc. | 14 Jan 2012 | 31 Dec 2024 | 14 Jan 2026 |
| 696 | petemergencywildernessvillagewa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 697 | petemooreauto.com | Domainjungle.net LLC | 13 Aug 2025 | 15 Aug 2025 | 13 Aug 2026 |
| 698 | petemotel.com | GoDaddy.com, LLC | 23 Oct 2005 | 24 Oct 2025 | 23 Oct 2027 |
| 699 | petemergencyclinic.com | register.com, Inc. | 23 Jul 2001 | 23 Jun 2025 | 23 Jul 2026 |
| 700 | petemosca.com | GoDaddy.com, LLC | 11 Nov 2009 | 12 Oct 2015 | 11 Nov 2016 |
| 701 | petemporia.com | GoDaddy.com, LLC | 17 Mar 2008 | 17 Mar 2025 | 17 Mar 2026 |
| 702 | petemanesiotis.com | GoDaddy.com, LLC | 20 Jun 2014 | 21 Jun 2016 | 20 Jun 2018 |
| 703 | petemageecpa.com | Network Solutions, LLC | 28 Apr 2005 | 3 May 2024 | 28 Apr 2027 |
| 704 | petemonsees.com | GoDaddy.com, LLC | 8 May 2012 | 8 Apr 2016 | 8 May 2018 |
| 705 | petemaugans.com | GoDaddy.com, LLC | 1 Nov 2007 | 2 Nov 2025 | 1 Nov 2027 |
| 706 | petemckeonbuildingco.com | GoDaddy.com, LLC | 19 Mar 2009 | 9 Sep 2022 | 19 Mar 2027 |
| 707 | petemasiello.com | register.com, Inc. | 16 Oct 2007 | 18 Oct 2025 | 16 Oct 2026 |
| 708 | petemeredith.com | GoDaddy.com, LLC | 19 Aug 2007 | 4 Sep 2022 | 19 Aug 2027 |
| 709 | petemundo.com | GoDaddy.com, LLC | 26 Sep 2013 | 27 Sep 2024 | 26 Sep 2026 |
| 710 | petemillard.com | Webfusion Ltd. | 4 Jan 2013 | 5 Jan 2025 | 4 Jan 2027 |
| 711 | petemploymentregistry.com | GoDaddy.com, LLC | 25 Mar 2012 | 26 Mar 2024 | 25 Mar 2026 |
| 712 | petemadden.com | GoDaddy.com, LLC | 16 Dec 2004 | 17 Dec 2024 | 16 Dec 2025 |
| 713 | petemama.com | Ä°simtescil BiliÅŸim A.Åž. | 16 May 2023 | 31 Jul 2025 | 16 May 2025 |
| 714 | petemorin.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Jun 2023 | 31 Aug 2024 | 29 Jun 2024 |
| 715 | petemccarthy.com | GoDaddy.com, LLC | 30 Apr 2024 | 11 Jun 2025 | 30 Apr 2025 |
| 716 | petemorrissette.com | eNom, Inc. | 21 Sep 2022 | 12 Sep 2025 | 21 Sep 2026 |
| 717 | petematthews.com | Dynadot, LLC | 27 Aug 2024 | 13 Aug 2025 | 27 Aug 2026 |
| 718 | petemistretta.com | FastDomain Inc. | 10 Mar 2011 | 22 Feb 2025 | 10 Mar 2026 |
| 719 | petemergencycenter.com | GoDaddy.com, LLC | 28 Dec 1998 | 20 Dec 2024 | 28 Dec 2025 |
| 720 | petemcarthur.com | NameCheap, Inc. | 13 Jun 2024 | 28 May 2025 | 13 Jun 2026 |
| 721 | petemellor.com | DropCatch.com 974 LLC | 5 Dec 2019 | 5 Dec 2019 | 5 Dec 2020 |
| 722 | petemoehrke.com | GoDaddy.com, LLC | 9 May 2007 | 10 May 2025 | 9 May 2026 |
| 723 | petemajerle.com | Wild West Domains, LLC | 20 May 2004 | 21 May 2025 | 20 May 2026 |
| 724 | petemaguire.com | FastDomain Inc. | 8 Jun 2006 | 16 May 2023 | 8 Jun 2027 |
| 725 | petemartini.com | DotNamed LLC | 16 Nov 2012 | 17 Nov 2016 | 16 Nov 2017 |
| 726 | petemcverry.com | Crazy Domains FZ-LLC | 14 Jan 2014 | 6 Jan 2025 | 14 Jan 2026 |
| 727 | petemerrigan.com | Tucows Domains Inc. | 30 Oct 2001 | 29 Oct 2025 | 30 Oct 2026 |
| 728 | petemurphyphotography.com | Mesh Digital Limited | 20 Mar 2013 | 20 Jan 2014 | 20 Mar 2018 |
| 729 | petemergenciestulsa.com | GoDaddy.com, LLC | 1 Feb 2012 | 15 Jan 2024 | 28 Jan 2026 |
| 730 | petemarketosisgay.com | GoDaddy.com, LLC | 5 Feb 2010 | 6 Feb 2016 | 5 Feb 2018 |
| 731 | petemedina.com | eNom, Inc. | 1 Nov 2008 | 26 Oct 2025 | 1 Nov 2026 |
| 732 | petemergencyvethospitallongisland.com | GoDaddy.com, LLC | 30 Jan 2014 | 4 Dec 2023 | 30 Jan 2029 |
| 733 | petemartingreenville.com | Wild West Domains, LLC | 27 Sep 2013 | 28 Sep 2025 | 27 Sep 2026 |
| 734 | petematanich.com | GoDaddy.com, LLC | 18 May 2010 | 19 May 2025 | 18 May 2026 |
| 735 | petemcallen.com | Squarespace Domains LLC | 10 May 2024 | 2 Jun 2025 | 10 May 2026 |
| 736 | petemauro.com | Lemon Shark Domains, LLC | 28 Jan 2023 | 12 Mar 2024 | 28 Jan 2024 |
| 737 | petemcmurray.com | GoDaddy.com, LLC | 28 Jun 1999 | 12 Jul 2023 | 28 Jun 2026 |
| 738 | petemacfarlanearchitectstonemasonmemorials.com | Tucows Domains Inc. | 27 Aug 2012 | 31 Aug 2017 | 27 Aug 2017 |
| 739 | petemergencywellington.com | GoDaddy.com, LLC | 1 Apr 2011 | 2 Apr 2025 | 1 Apr 2027 |
| 740 | petemcneil.com | DNC Holdings, Inc. | 28 Feb 2012 | 6 Mar 2025 | 28 Feb 2026 |
| 741 | petemacarts.com | DreamHost, LLC | 17 Aug 2012 | 18 Aug 2025 | 17 Aug 2026 |
| 742 | petemate.com | GMO Internet Inc. | 15 May 2007 | 26 Apr 2023 | 15 May 2026 |
| 743 | petemathews.com | Web Commerce Communications Limited dba WebNic.cc | 16 Mar 2024 | 16 Mar 2024 | 16 Mar 2026 |
| 744 | petemangum.com | eNom, Inc. | 11 Jan 2012 | 4 Jan 2025 | 11 Jan 2026 |
| 745 | petemill.com | Google, Inc. | 1 Nov 2010 | 17 Oct 2025 | 1 Nov 2026 |
| 746 | petemalone.com | ComfyDomains LLC | 13 Aug 2013 | 14 Aug 2016 | 13 Aug 2017 |
| 747 | petemoss.com | GoDaddy.com, LLC | 20 Jan 1999 | 30 Sep 2025 | 20 Jan 2026 |
| 748 | petemash.com | Dynadot6 LLC | 6 Sep 2022 | 16 Nov 2023 | 6 Sep 2023 |
| 749 | petemuellergroup.com | GoDaddy.com, LLC | 24 Oct 2008 | 29 Oct 2025 | 24 Oct 2026 |
| 750 | petemccawley.com | GoDaddy.com, LLC | 19 Sep 2019 | 30 Oct 2022 | 19 Sep 2029 |
| 751 | petemcgrane.com | Network Solutions, LLC | 6 Dec 2010 | 6 Nov 2024 | 6 Dec 2026 |
| 752 | petemesgleski.com | GoDaddy.com, LLC | 15 Aug 2007 | 16 Aug 2025 | 15 Aug 2026 |
| 753 | petemergencyvetblackdiamond.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 754 | petemaravichvideocentral.com | GoDaddy.com, LLC | 19 Sep 2006 | 19 Jan 2025 | 18 Jan 2026 |
| 755 | petemunro.com | GoDaddy.com, LLC | 19 Mar 2000 | 7 Apr 2025 | 19 Mar 2026 |
| 756 | petemployment.com | GoDaddy.com, LLC | 17 May 2007 | 17 May 2025 | 17 May 2027 |
| 757 | petemacintoshracing.com | GoDaddy.com, LLC | 6 Feb 2013 | 18 Oct 2014 | 6 Feb 2017 |
| 758 | petemanderfx.com | NameCheap, Inc. | 15 Jul 2025 | 15 Jul 2025 | 15 Jul 2026 |
| 759 | petemergencyciniclaketappswa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 760 | petemohr.com | GoDaddy.com, LLC | 26 Jun 2013 | 11 Jun 2025 | 26 Jun 2026 |
| 761 | petemeyer.com | GoDaddy.com, LLC | 13 Nov 2023 | 13 Nov 2023 | 13 Nov 2026 |
| 762 | petemorganbooks.com | Wild West Domains, LLC | 30 Dec 2013 | 29 Nov 2024 | 30 Dec 2025 |
| 763 | petemin.com | GoDaddy.com, LLC | 20 Jun 2005 | 22 Sep 2022 | 20 Jun 2026 |
| 764 | petemcgill.com | GoDaddy.com, LLC | 17 Sep 2010 | 19 Sep 2025 | 17 Sep 2027 |
| 765 | petemattis.com | Tucows Domains Inc. | 8 Mar 2008 | 6 Mar 2025 | 8 Mar 2026 |
| 766 | petemergencybundles.com | Domain.com, LLC | 8 Apr 2014 | 8 May 2016 | 8 Apr 2017 |
| 767 | petemamos.com | GoDaddy.com, LLC | 18 Oct 2002 | 18 Oct 2025 | 18 Oct 2026 |
| 768 | petemroz.com | Tucows Domains Inc. | 5 May 2006 | 6 Apr 2025 | 5 May 2026 |
| 769 | petemccormick.com | GoDaddy.com, LLC | 13 Aug 2007 | 14 Aug 2016 | 13 Aug 2017 |
| 770 | petemergencyvetmaplevalleywa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 771 | petemolina.com | GoDaddy.com, LLC | 26 Jan 2007 | 27 Jan 2025 | 26 Jan 2026 |
| 772 | petemergencymanagement.com | GoDaddy.com, LLC | 20 Oct 2009 | 1 Nov 2025 | 20 Oct 2026 |
| 773 | petemendez.com | TurnCommerce, Inc. DBA NameBright.com | 8 Dec 2022 | 17 Jan 2025 | 8 Dec 2024 |
| 774 | petemarus.com | - | 6 Mar 2009 | 3 Jun 2025 | 6 Mar 2027 |
| 775 | petemeenen.com | DNC Holdings, Inc. | 4 Jan 2006 | 15 Nov 2024 | 4 Jan 2030 |
| 776 | petemacnamara.com | GoDaddy.com, LLC | 2 May 2007 | 21 Dec 2023 | 22 Dec 2025 |
| 777 | petemergencies.com | GoDaddy.com, LLC | 6 May 2009 | 17 Jun 2025 | 6 May 2026 |
| 778 | petemonaco.com | Extra Threads Corporation | 6 Oct 2024 | 9 Oct 2025 | 6 Oct 2026 |
| 779 | petemergencyeducation.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Aug 2012 | 12 May 2025 | 31 Aug 2029 |
| 780 | petemccallsmlbstats.com | GoDaddy.com, LLC | 26 Mar 2014 | 13 Mar 2016 | 26 Mar 2017 |
| 781 | petemcarthurblog.com | Launchpad, Inc. | 28 May 2013 | 13 May 2017 | 28 May 2018 |
| 782 | petemiles.com | GoDaddy.com, LLC | 23 May 2012 | 1 Nov 2025 | 23 May 2027 |
| 783 | petemathison.com | register.com, Inc. | 13 Apr 2003 | 14 Apr 2025 | 13 Apr 2026 |
| 784 | petema.com | TurnCommerce, Inc. DBA NameBright.com | 13 Mar 2013 | 10 Nov 2025 | 13 Mar 2026 |
| 785 | petemonge.com | GoDaddy.com, LLC | 1 Apr 2006 | 2 Apr 2025 | 1 Apr 2026 |
| 786 | petemarkham.com | GoDaddy.com, LLC | 10 Oct 2018 | 11 Oct 2025 | 10 Oct 2026 |
| 787 | petemagda.com | Tucows Domains Inc. | 3 Mar 2025 | 23 Apr 2025 | 3 Mar 2026 |
| 788 | petemarchetto.com | Launchpad, Inc. | 19 Dec 2013 | 9 Dec 2016 | 19 Dec 2017 |
| 789 | petemanzo.com | GoDaddy.com, LLC | 8 Jan 2008 | 9 Jan 2025 | 8 Jan 2026 |
| 790 | petemergencyclinicfederalwaywa.com | GoDaddy.com, LLC | 19 Jan 2012 | 20 Jan 2016 | 19 Jan 2017 |
| 791 | petemeyers.com | GoDaddy.com, LLC | 10 May 2006 | 11 May 2025 | 10 May 2026 |
| 792 | petemcgraw.com | Squarespace Domains LLC | 12 Mar 2025 | 12 Mar 2025 | 12 Mar 2026 |
| 793 | petemadia.com | GoDaddy.com, LLC | 23 Sep 2008 | 24 Sep 2025 | 23 Sep 2030 |
| 794 | petemorton.com | Webfusion Ltd. | 21 Feb 2003 | 22 Feb 2025 | 21 Feb 2026 |
| 795 | petemontgomery.com | GoDaddy.com, LLC | 26 Jun 2005 | 27 Jun 2025 | 26 Jun 2026 |
| 796 | petemergencyvetlaketappswa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 797 | petemcalindon.com | CloudFlare, Inc. | 16 Aug 2009 | 17 Jul 2025 | 16 Aug 2026 |
| 798 | petemilan.com | Tucows Domains Inc. | 25 Mar 2012 | 24 Mar 2025 | 25 Mar 2026 |
| 799 | petemergencyclinicenumclawwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 800 | petemeyersandassoc.com | Wild West Domains, LLC | 7 Jun 2007 | 8 Jun 2025 | 7 Jun 2026 |
| 801 | petembellishment.com | register.com, Inc. | 9 Jul 2012 | 20 Aug 2016 | 9 Jul 2016 |
| 802 | petemergencybonneylakewa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 803 | petemadison.com | Network Solutions, LLC | 26 Dec 2002 | 27 Oct 2023 | 26 Dec 2026 |
| 804 | petemerrill.com | NameCheap, Inc. | 28 Mar 2021 | 21 Mar 2025 | 28 Mar 2026 |
| 805 | petemorford.com | 1&1 Internet AG | 31 Jul 2013 | 9 Sep 2024 | 31 Jul 2024 |
| 806 | petemartinezpaintings.com | eNom, Inc. | 9 May 2008 | 11 Apr 2025 | 9 May 2026 |
| 807 | petemockaitis.com | FastDomain Inc. | 21 Mar 2008 | 6 Mar 2025 | 21 Mar 2026 |
| 808 | petemstudio.com | GoDaddy.com, LLC | 18 Nov 2007 | 18 Nov 2024 | 18 Nov 2030 |
| 809 | petemergencytags.com | Network Solutions, LLC | 8 Sep 2005 | 9 Jul 2025 | 8 Sep 2026 |
| 810 | petemurphypublicity.com | Register.it SPA | 1 Jul 2013 | 1 Jul 2025 | 1 Jul 2027 |
| 811 | petemickeal.com | Zhengzhou Century Connect Electronic Technology De… | 4 Dec 2017 | 3 Dec 2018 | 4 Dec 2019 |
| 812 | petemonaghan.com | Cronon AG | 6 Aug 2005 | 25 Sep 2025 | 6 Aug 2026 |
| 813 | petemel.com | register.com, Inc. | 7 Mar 2007 | 9 Oct 2025 | 7 Mar 2027 |
| 814 | petemillwood.com | 1&1 Internet AG | 28 Aug 2013 | 29 Aug 2019 | 28 Aug 2026 |
| 815 | petemergencylaketappswa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 816 | petemoody.com | 1&1 Internet AG | 18 May 2014 | 17 Mar 2018 | 18 May 2026 |
| 817 | petemarcolina.com | GoDaddy.com, LLC | 6 Aug 2014 | 6 Aug 2016 | 6 Aug 2017 |
| 818 | petemeadows.com | NameCheap, Inc. | 22 Apr 2005 | 25 Apr 2025 | 22 Apr 2026 |
| 819 | petemergencyvetbonneylakewa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 820 | petemcelligott.com | Network Solutions, LLC | 13 Nov 2023 | 26 Dec 2024 | 13 Nov 2024 |
| 821 | petemurray.com | Tucows Domains Inc. | 23 May 2003 | 8 May 2025 | 23 May 2026 |
| 822 | petemunday.com | DROPCATCH.COM 816 LLC | 21 Feb 2024 | 3 May 2025 | 21 Feb 2025 |
| 823 | petemergencyservices.com | GoDaddy.com, LLC | 16 Feb 2009 | 19 Oct 2022 | 19 Oct 2032 |
| 824 | petemiszuk.com | Internet Domain Services BS Corp | 16 Jul 2012 | 17 Jul 2016 | 16 Jul 2016 |
| 825 | petemacgowan.com | Namesilo, LLC | 8 Apr 2022 | 11 May 2023 | 8 Apr 2023 |
| 826 | petemcgrath.com | TotallyDomain LLC | 28 Jun 2014 | 29 Jun 2017 | 28 Jun 2018 |
| 827 | petemoy.com | GoDaddy.com, LLC | 11 Feb 2011 | 12 Feb 2024 | 11 Feb 2026 |
| 828 | petemateo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jan 2013 | 13 Dec 2015 | 23 Jan 2017 |
| 829 | petemicklewrightpga.com | eNom, Inc. | 9 Jan 2013 | 11 Dec 2015 | 9 Jan 2017 |
| 830 | petemporiumsc.com | Network Solutions, LLC | 12 Dec 2013 | 12 Nov 2025 | 12 Dec 2025 |
| 831 | petemillskarate.com | Tucows Domains Inc. | 6 Apr 2007 | 9 Oct 2025 | 6 Apr 2026 |
| 832 | petemaurice.com | GoDaddy.com, LLC | 22 Feb 2023 | 5 May 2024 | 22 Feb 2024 |
| 833 | petemuntean.com | Tucows Domains Inc. | 20 Apr 2025 | 20 Apr 2025 | 20 Apr 2027 |
| 834 | petembriyo.com | IHS Telekom, Inc. | 12 Nov 2012 | 14 Nov 2016 | 12 Nov 2017 |
| 835 | petemosley.com | Register.it SPA | 4 Jun 2009 | 19 Apr 2025 | 19 Apr 2026 |
| 836 | petemergencyandspecialtycenter.com | Brandsight, Inc. | 11 Apr 2005 | 11 Mar 2025 | 11 Apr 2027 |
| 837 | petemergencybradenton.com | Namesilo, LLC | 21 Feb 2012 | 1 Nov 2017 | 21 Feb 2018 |
| 838 | petemiserendino.com | eNom, Inc. | 16 Feb 2004 | 21 Jan 2024 | 16 Feb 2026 |
| 839 | petemeehan.com | PSI-USA, Inc. dba Domain Robot | 14 Jun 2023 | 14 Aug 2024 | 14 Jun 2024 |
| 840 | petemorrow.com | GoDaddy.com, LLC | 13 Jul 2012 | 11 Sep 2022 | 13 Jul 2032 |
| 841 | petemoorechevy.com | GoDaddy.com, LLC | 1 Mar 2002 | 31 Oct 2022 | 1 Mar 2029 |
| 842 | petemckillop.com | Webfusion Ltd. | 7 Jun 2019 | 10 Jun 2025 | 7 Jun 2026 |
| 843 | petemcintoshracing.com | GoDaddy.com, LLC | 6 Feb 2013 | 19 Apr 2025 | 6 Feb 2025 |
| 844 | petemarketing.com | Go Australia Domains, LLC | 1 Jul 2014 | 10 Jul 2025 | 9 Jul 2026 |
| 845 | petemergencysandiego.com | Brandsight, Inc. | 11 Apr 2005 | 11 Mar 2025 | 11 Apr 2027 |
| 846 | petemichaelson.com | DreamHost, LLC | 17 Nov 2004 | 17 Nov 2025 | 17 Nov 2026 |
| 847 | petemoffat.com | Omnis Network, LLC | 3 Aug 2001 | 7 Jul 2025 | 3 Aug 2028 |
| 848 | petemerry.com | Webfusion Ltd. | 18 Jun 2008 | 11 Jun 2017 | 18 Jun 2018 |
| 849 | petemcleodracing.com | GoDaddy.com, LLC | 17 Mar 2009 | 5 Sep 2022 | 17 Mar 2026 |
| 850 | petemurphyhomes.com | GoDaddy.com, LLC | 27 Dec 2012 | 28 Dec 2014 | 27 Dec 2016 |
| 851 | petemingham.com | Network Solutions, LLC | 29 Jan 2007 | 13 Mar 2025 | 29 Jan 2025 |
| 852 | petemcphail.com | Gandi SAS | 5 Feb 2002 | 20 Jan 2025 | 5 Feb 2026 |
| 853 | petemalcolm.com | Webfusion Ltd. | 14 May 2011 | 15 May 2025 | 14 May 2026 |
| 854 | petemullerphotography.com | eNom, Inc. | 2 Sep 2008 | 26 Aug 2025 | 2 Sep 2026 |
| 855 | petemoreno.com | NameCheap, Inc. | 21 Jun 2005 | 6 Jun 2025 | 21 Jun 2026 |
| 856 | petemail.com | Name.com, Inc. | 28 Aug 2002 | 5 Oct 2025 | 28 Aug 2026 |
| 857 | petemazany.com | eNom, Inc. | 30 Nov 2010 | 28 Nov 2015 | 30 Nov 2016 |
| 858 | petemr.com | Name.com, Inc. | 16 Apr 2011 | 19 Mar 2025 | 16 Apr 2026 |
| 859 | petemodel.com | Brandon Gray Internet Services, Inc. (dba NameJuic… | 25 Sep 2001 | 4 Nov 2017 | 14 Dec 2017 |
| 860 | petemustoe.com | eNom, Inc. | 7 Jan 2010 | 5 Jan 2016 | 7 Jan 2017 |
| 861 | petemyers.com | NameCheap, Inc. | 7 Jan 2000 | 8 Dec 2024 | 7 Jan 2026 |
| 862 | petemaass.com | GoDaddy.com, LLC | 27 Jul 2012 | 28 Jul 2025 | 27 Jul 2026 |
| 863 | petemckenzie.com | NameCheap, Inc. | 25 Oct 2012 | 23 Sep 2024 | 25 Oct 2031 |
| 864 | petemumbower.com | 1&1 Internet AG | 28 Jun 2008 | 29 Jun 2016 | 28 Jun 2026 |
| 865 | petemarra.com | GoDaddy.com, LLC | 18 Feb 2006 | 18 Feb 2025 | 18 Feb 2026 |
| 866 | petemaloney.com | Tucows Domains Inc. | 20 May 2005 | 19 May 2025 | 20 May 2026 |
| 867 | petemanganphotography.com | register.com, Inc. | 27 Oct 2012 | 12 Oct 2014 | 27 Oct 2016 |
| 868 | petemcevoy.com | Tucows Domains Inc. | 7 Mar 2014 | 23 Apr 2025 | 7 Mar 2026 |
| 869 | petemayfieldfitness.com | PSI-USA, Inc. dba Domain Robot | 9 Nov 2023 | 9 Jan 2025 | 9 Nov 2024 |
| 870 | petemulvany.com | GoDaddy.com, LLC | 20 Jan 2003 | 21 Jan 2016 | 20 Jan 2017 |
| 871 | petemergencypearland.com | GoDaddy.com, LLC | 14 Jul 2014 | 14 Jul 2025 | 14 Jul 2026 |
| 872 | petemovie.com | 1&1 Internet AG | 22 Aug 2025 | 22 Aug 2025 | 22 Aug 2026 |
| 873 | petemccauley.com | DNC Holdings, Inc. | 1 Oct 2004 | 26 Sep 2025 | 1 Oct 2026 |
| 874 | petemakela.com | Tucows Domains Inc. | 22 Dec 2011 | 7 Dec 2024 | 22 Dec 2025 |
| 875 | petemazzaccaro.com | FastDomain Inc. | 22 Mar 2013 | 22 Mar 2017 | 22 Mar 2018 |
| 876 | petemoorevw.com | GoDaddy.com, LLC | 23 Mar 2013 | 1 Apr 2016 | 23 Mar 2017 |
| 877 | petemoorevwparts.com | Netowl, Inc. | 15 May 2020 | 15 May 2020 | 15 May 2021 |
| 878 | petemergencyclinicwildernessvillagewa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 879 | petemuse.com | GoDaddy.com, LLC | 19 Jul 2011 | 19 Jul 2011 | 19 Jul 2021 |
| 880 | petemarovich.com | DomainPeople, Inc. | 29 Apr 2011 | 13 Apr 2024 | 29 Apr 2027 |
| 881 | petemergencytulsa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2025 | 1 Feb 2027 |
| 882 | petemixmasterhammond.com | - | 11 Dec 2024 | 12 Dec 2024 | 11 Dec 2025 |
| 883 | petemergencysarasota.com | Domaincatcher LLC | 1 May 2020 | 1 May 2020 | 1 May 2021 |
| 884 | petemiddleton.com | GoDaddy.com, LLC | 1 Feb 2014 | 1 Feb 2025 | 1 Feb 2026 |
| 885 | petembroidery.com | Network Solutions, LLC | 23 Jan 2004 | 23 Nov 2022 | 23 Jan 2026 |
| 886 | petemartindrillingllc.com | NameCheap, Inc. | 25 Mar 2013 | 10 Mar 2025 | 25 Mar 2027 |
| 887 | petemergencyvettacomawa.com | GoDaddy.com, LLC | 19 Jan 2012 | 20 Jan 2016 | 19 Jan 2017 |
| 888 | petemacjobs.com | GoDaddy.com, LLC | 22 Jul 2005 | 23 Jul 2016 | 22 Jul 2018 |
| 889 | petemergencyclinicpuyallupwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2015 | 1 Feb 2017 |
| 890 | petembellishments.com | NameCheap, Inc. | 26 Apr 2019 | 26 Apr 2019 | 26 Apr 2020 |
| 891 | petemattcreative.com | GoDaddy.com, LLC | 7 Aug 2019 | 7 Aug 2019 | 7 Aug 2020 |
| 892 | petemarriottmusic.com | DNC Holdings, Inc. | 27 Mar 2014 | 29 Jan 2025 | 27 Mar 2026 |
| 893 | petemergencyandreferralcenter.com | GoDaddy.com, LLC | 19 Apr 2010 | 15 Oct 2022 | 24 Jul 2031 |
| 894 | petemcnamara.com | eNom, Inc. | 2 Feb 2012 | 9 Feb 2025 | 2 Feb 2026 |
| 895 | petemesleyphotography.com | GoDaddy.com, LLC | 4 Mar 2010 | 4 Mar 2024 | 4 Mar 2026 |
| 896 | petemergencyenumclawwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 897 | petemoorenomore.com | GoDaddy.com, LLC | 5 Aug 2012 | 4 Aug 2016 | 5 Aug 2017 |
| 898 | petemackenzie.com | Tucows Domains Inc. | 2 Jan 2024 | 28 Dec 2024 | 2 Jan 2026 |
| 899 | petemadsenguitar.com | GoDaddy.com, LLC | 11 Mar 2014 | 12 Mar 2024 | 11 Mar 2026 |
| 900 | petempire.com | GoDaddy.com, LLC | 8 Aug 2003 | 19 Jul 2025 | 8 Aug 2026 |
| 901 | petemagsig.com | Tucows Domains Inc. | 10 Apr 2010 | 9 Apr 2025 | 10 Apr 2026 |
| 902 | petemarcano.com | GoDaddy.com, LLC | 1 Mar 2011 | 2 Mar 2025 | 1 Mar 2026 |
| 903 | petemckay.com | GoDaddy.com, LLC | 6 Jun 2025 | 6 Jun 2025 | 6 Jun 2028 |
| 904 | petemathieuconstruction.com | Media Elite Holdings Limited | 18 May 2021 | 18 May 2021 | 18 May 2022 |
| 905 | petemarchica.com | DreamHost, LLC | 25 Aug 2010 | 7 Oct 2017 | 25 Aug 2017 |
| 906 | petemergencyfund.com | GoDaddy.com, LLC | 15 Feb 2007 | 16 Feb 2025 | 15 Feb 2026 |
| 907 | petemarples.com | Dynadot, LLC | 2 May 2013 | 21 Apr 2025 | 2 May 2026 |
| 908 | petemurphy.com | 1&1 Internet AG | 20 Jan 2004 | 5 Oct 2018 | 20 Jan 2026 |
| 909 | petemooney.com | NameCheap, Inc. | 16 Apr 2007 | 21 Apr 2025 | 16 Apr 2026 |
| 910 | petemack.com | Dynadot8 LLC | 4 Mar 2024 | 14 Apr 2025 | 4 Mar 2025 |
| 911 | petemaravichblog.com | GoDaddy.com, LLC | 5 Mar 2010 | 27 Feb 2025 | 5 Mar 2026 |
| 912 | petemuller.com | Network Solutions, LLC | 1 Jun 1999 | 2 Apr 2025 | 1 Jun 2026 |
| 913 | petemanias.com | Network Solutions, LLC | 30 May 2003 | 20 May 2024 | 30 May 2027 |
| 914 | petemarks.com | GoDaddy.com, LLC | 6 May 2010 | 7 May 2025 | 6 May 2026 |
| 915 | petemotions.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Mar 2004 | 28 Feb 2025 | 26 Mar 2026 |
| 916 | petemergency.com | Network Solutions, LLC | 6 Sep 1998 | 11 Aug 2025 | 5 Sep 2026 |
| 917 | petemetzger.com | GoDaddy.com, LLC | 27 Aug 2006 | 28 Aug 2025 | 27 Aug 2026 |
| 918 | petemag.com | Google, Inc. | 8 Apr 2002 | 21 May 2024 | 8 Apr 2026 |
| 919 | petemoscuforla.com | Uniregistrar Corp | 24 Feb 2010 | 7 May 2024 | 24 Feb 2024 |
| 920 | petemall.com | NameCheap, Inc. | 28 Oct 2011 | 28 Sep 2025 | 28 Oct 2026 |
| 921 | petemilano.com | Tucows Domains Inc. | 28 Nov 2002 | 19 Oct 2025 | 28 Nov 2026 |
| 922 | petemackool.com | 35 Technology Co., Ltd. | 7 Apr 2022 | 26 Apr 2023 | 7 Apr 2024 |
| 923 | petemartinstudios.com | Wild West Domains, LLC | 27 Sep 2013 | 28 Sep 2025 | 27 Sep 2026 |
| 924 | petemesley.com | GoDaddy.com, LLC | 16 Jan 2006 | 17 Jan 2025 | 16 Jan 2027 |
| 925 | petemooreband.com | GoDaddy.com, LLC | 1 Sep 2008 | 6 Sep 2022 | 1 Sep 2027 |
| 926 | petemolino.com | FastDomain Inc. | 15 Jul 2022 | 29 Jun 2025 | 15 Jul 2026 |
| 927 | petemayer.com | Dynadot, LLC | 27 Jul 2018 | 25 Aug 2025 | 27 Jul 2026 |
| 928 | petemergencybuckleywa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 929 | petemcdonaldmusic.com | Hefei Juming Network Technology Co., Ltd | 22 Apr 2021 | 24 Apr 2021 | 22 Apr 2022 |
| 930 | petemergencyedgewoodwa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 931 | petematchett.com | DreamHost, LLC | 16 Jul 2014 | 9 Jul 2025 | 16 Jul 2026 |
| 932 | petemackanin.com | GoDaddy.com, LLC | 30 Sep 2011 | 12 Oct 2025 | 30 Sep 2026 |
| 933 | petemoran.com | eNom, Inc. | 20 Jan 2009 | 19 Jan 2025 | 20 Jan 2026 |
| 934 | petemurphybaseball.com | Network Solutions, LLC | 21 Jun 2011 | 21 Apr 2017 | 20 Jun 2018 |
| 935 | petemeier.com | GoDaddy.com, LLC | 8 Apr 2024 | 8 Apr 2024 | 8 Apr 2025 |
| 936 | petemcveigh.com | Tucows Domains Inc. | 28 Jun 2023 | 8 Aug 2024 | 28 Jun 2024 |
| 937 | petemerkle.com | - | 7 Jul 2022 | 7 Jul 2023 | 7 Jul 2024 |
| 938 | petemergencyvetdesmoineswa.com | GoDaddy.com, LLC | 1 Feb 2012 | 28 Apr 2015 | 1 Feb 2017 |
| 939 | petemthomas.com | GoDaddy.com, LLC | 10 Apr 2014 | 11 Apr 2024 | 10 Apr 2025 |
| 940 | petemohrbacher.com | Tucows Domains Inc. | 12 Nov 2013 | 28 Oct 2025 | 12 Nov 2026 |
| 941 | petemergencyofmartincounty.com | register.com, Inc. | 15 Oct 2010 | 9 Mar 2016 | 15 Oct 2016 |
| 942 | petemu.com | TurnCommerce, Inc. DBA NameBright.com | 16 Sep 2012 | 10 Sep 2020 | 16 Sep 2026 |
| 943 | petemoorhouse.com | LCN.COM Ltd. | 10 Nov 2004 | 14 Jun 2017 | 10 Nov 2018 |
| 944 | petemarett.com | Webfusion Ltd. | 1 Feb 2011 | 25 Jan 2017 | 1 Feb 2019 |
| 945 | petemacintyre.com | Mesh Digital Limited | 15 Sep 2006 | 16 Sep 2025 | 15 Sep 2027 |
| 946 | petempiremn.com | GoDaddy.com, LLC | 22 Sep 2016 | 23 Sep 2025 | 22 Sep 2026 |
| 947 | petemaskovich.com | register.com, Inc. | 12 Jan 2023 | 26 Mar 2024 | 12 Jan 2024 |
| 948 | petemergencycare.com | Network Solutions, LLC | 16 Jun 2021 | 21 Jul 2025 | 16 Jun 2026 |
| 949 | petemazzone.com | - | 28 Sep 2016 | 28 Sep 2016 | 28 Sep 2018 |
| 950 | petemd.com | Google, Inc. | 27 Apr 2021 | 23 Apr 2025 | 27 Apr 2026 |
| 951 | petemargolis.com | - | 2 Oct 2016 | 2 Oct 2016 | 2 Oct 2018 |
| 952 | petemjohnston.com | NameCheap, Inc. | 5 Oct 2016 | 16 Nov 2025 | 5 Oct 2025 |
| 953 | petemed.pet | Global Domains International, Inc. DBA DomainCostC… | 4 Oct 2016 | 14 Nov 2017 | 4 Oct 2018 |
| 954 | petemarshall.info | Wild West Domains, LLC | 21 Aug 2012 | 2 Oct 2016 | 21 Aug 2017 |
| 955 | petemossiv.info | Wild West Domains, LLC | 20 May 2007 | 21 May 2017 | 20 May 2018 |
| 956 | petemporium.info | Tucows Domains Inc. | 28 Dec 2023 | 28 Dec 2023 | - |
| 957 | petemacmahon.info | GoDaddy.com, LLC | 24 Sep 2009 | 25 Sep 2025 | 24 Sep 2026 |
| 958 | petemccutchen.info | GoDaddy.com, LLC | 3 Apr 2014 | 4 Apr 2020 | 3 Apr 2022 |
| 959 | petemoss.info | NameCheap, Inc. | 5 Sep 2018 | 5 Sep 2018 | 5 Sep 2019 |
| 960 | petemccracken.info | GoDaddy.com, LLC | 26 Mar 2007 | 27 Mar 2015 | 26 Mar 2017 |
| 961 | petemorris.info | GoDaddy.com, LLC | 5 Jun 2002 | 6 Jun 2019 | 5 Jun 2020 |
| 962 | petemitchell.info | CommuniGal Communication Ltd. | 25 Nov 2024 | - | 25 Nov 2025 |
| 963 | petemccleary.info | GoDaddy.com, LLC | 17 May 2014 | 18 May 2020 | 17 May 2021 |
| 964 | petemurray.info | GoDaddy.com, LLC | 8 Nov 2013 | 9 Nov 2017 | 8 Nov 2018 |
| 965 | petemorrislocksheathdriving.mobi | Tucows Domains Inc. | 11 Dec 2013 | 5 Jun 2017 | 11 Dec 2017 |
| 966 | petemankinsreviews.com | - | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 967 | petemankinsnissanservice.com | - | 13 Oct 2016 | 13 Oct 2016 | 13 Oct 2017 |
| 968 | petemetz.com | GoDaddy.com, LLC | 4 Feb 2019 | 5 Feb 2025 | 4 Feb 2027 |
| 969 | petemployee.com | NameCheap, Inc. | 13 Aug 2021 | 14 Jul 2022 | 13 Aug 2023 |
| 970 | petemcgregorfishing.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Oct 2016 | 1 Oct 2025 | 14 Oct 2026 |
| 971 | petemcasacuritiba.net | Network Solutions, LLC | 11 Oct 2013 | 13 Oct 2016 | 11 Oct 2017 |
| 972 | petemergencyroom.net | GoDaddy.com, LLC | 7 Sep 2013 | 8 Sep 2016 | 7 Sep 2017 |
| 973 | petemaguire.net | Tucows Domains Inc. | 4 Apr 2010 | 20 Mar 2025 | 4 Apr 2026 |
| 974 | petemacgregor.net | 1&1 Internet AG | 30 Aug 2009 | 2 Oct 2018 | 30 Aug 2026 |
| 975 | petemolinari.net | GoDaddy.com, LLC | 12 Aug 2013 | 10 Jun 2016 | 12 Aug 2017 |
| 976 | petemartin.net | Squarespace Domains LLC | 1 Feb 2013 | 17 Jan 2025 | 1 Feb 2026 |
| 977 | petemeyersandassoc.net | Wild West Domains, LLC | 7 Jun 2007 | 8 Jun 2025 | 7 Jun 2026 |
| 978 | petemalcolm.net | Webfusion Ltd. | 14 May 2011 | 15 May 2025 | 14 May 2026 |
| 979 | petemiller.net | Tucows Domains Inc. | 31 Mar 2003 | 6 Mar 2024 | 30 Mar 2026 |
| 980 | petemac.net | NameCheap, Inc. | 6 Mar 2005 | 22 Apr 2025 | 22 May 2026 |
| 981 | petemoore.net | Domain.com, LLC | 20 Aug 2013 | 24 Jun 2025 | 20 Aug 2029 |
| 982 | petemotions.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Mar 2013 | 28 Feb 2025 | 30 Mar 2026 |
| 983 | petemajeski.net | register.com, Inc. | 11 May 2007 | 12 May 2025 | 11 May 2026 |
| 984 | petemahon.net | Instra Corporation Pty Ltd. | 2 May 2008 | 28 Feb 2021 | 2 May 2026 |
| 985 | petemclaughlin.net | Webfusion Ltd. | 28 Oct 2006 | 21 Oct 2017 | 28 Oct 2018 |
| 986 | petemergency911.net | FastDomain Inc. | 4 Sep 2011 | 19 Oct 2017 | 4 Sep 2017 |
| 987 | petemellor.net | DomainPeople, Inc. | 25 Jun 2008 | 27 May 2017 | 25 Jun 2018 |
| 988 | petemathews.net | GoDaddy.com, LLC | 14 Apr 2013 | 15 Apr 2025 | 14 Apr 2026 |
| 989 | petemoss.net | GoDaddy.com, LLC | 6 Sep 2020 | 7 Sep 2025 | 6 Sep 2026 |
| 990 | petemankins.net | GoDaddy.com, LLC | 21 Mar 2014 | 22 Mar 2025 | 21 Mar 2026 |
| 991 | petemuldoon.net | Tucows Domains Inc. | 6 Jul 2014 | 16 Sep 2023 | 6 Jul 2023 |
| 992 | petemccracken.net | GoDaddy.com, LLC | 26 Mar 2007 | 27 Mar 2015 | 26 Mar 2017 |
| 993 | petemacleod.net | Fenominal, Inc. | 17 Jan 2025 | 24 May 2025 | 17 Jan 2026 |
| 994 | petemuller.net | DreamHost, LLC | 24 Jun 2003 | 24 May 2025 | 24 Jun 2026 |
| 995 | petemergencymanagement.net | GoDaddy.com, LLC | 20 Oct 2009 | 1 Nov 2025 | 20 Oct 2026 |
| 996 | petemc.net | NameCheap, Inc. | 21 Dec 2002 | 21 Nov 2024 | 21 Dec 2025 |
| 997 | petemergencycenter.net | Network Solutions, LLC | 1 Dec 2006 | 12 Aug 2022 | 1 Dec 2026 |
| 998 | petemccutchen.net | GoDaddy.com, LLC | 3 Apr 2014 | 3 Apr 2016 | 3 Apr 2018 |
| 999 | petemcmanus.net | eNom, Inc. | 11 Jan 2013 | 19 Jun 2013 | 11 Jan 2018 |
| 1000 | petemichels.net | Beijing Lanhai Jiye Technology Co., Ltd | 28 May 2022 | 29 May 2023 | 28 May 2024 |
Displaying 1,000 out of 2,212 domains starting with the keyword "PETEM". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=petem
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |