With support for 
Keyword: PEC
Reverse Whois » KEYWORD [pec ] { 56,482 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | pec.coop | Domains.coop Limited | 10 Oct 2001 | 7 Dec 2022 | 30 Jan 2026 |
| 2 | pec.com.tw | - | 1 May 1997 | - | 31 May 2022 |
| 3 | pec.it | - | 4 Oct 2000 | 22 Feb 2025 | 6 Feb 2026 |
| 4 | pec.ac.in | Edge, Inc. | 30 Apr 2003 | 11 May 2015 | 30 Apr 2024 |
| 5 | pec.com.cn | - | 17 Mar 1999 | - | 17 Mar 2033 |
| 6 | pec.edu.pk | - | 1 Jan 2011 | - | 1 Jan 2015 |
| 7 | pec.org.pk | Name.Space, Incorporated | 1 Jan 1998 | - | 1 Jan 2018 |
| 8 | pec.ir | Reserved for ICANN's Registry SLA Monitoring Syste… | - | 14 Aug 2016 | 20 Jan 2018 |
| 9 | pec.nu | - | - | - | - |
| 10 | pec.edu | - | 1 Dec 2000 | 31 Mar 2010 | 31 Jul 2017 |
| 11 | pec.us | Dynadot, LLC | 7 Jul 2005 | 6 Jul 2025 | 6 Jul 2026 |
| 12 | pec.photography | 1&1 Internet AG | 24 Jul 2014 | 6 Jan 2017 | 24 Jul 2017 |
| 13 | pec.bike | 1API GmbH | 28 Jul 2014 | 29 Jul 2014 | 28 Jul 2015 |
| 14 | pec.blackfriday | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 15 | pec.christmas | Uniregistrar Corp | 30 Sep 2014 | 1 Oct 2014 | 30 Sep 2015 |
| 16 | pec.company | GoDaddy.com, LLC | 13 Apr 2015 | 28 May 2025 | 13 Apr 2027 |
| 17 | pec.nyc | GoDaddy.com, LLC | 12 Jan 2017 | 17 Jan 2022 | 11 Jan 2027 |
| 18 | pec.tips | eNom, Inc. | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 19 | pec.life | Squarespace Domains LLC | 7 May 2024 | 21 Jul 2025 | 7 May 2027 |
| 20 | pec.events | Tucows Domains Inc. | 26 Sep 2018 | 30 Sep 2024 | 26 Sep 2025 |
| 21 | pec.capital | GoDaddy.com, LLC | 5 Apr 2021 | 20 May 2025 | 5 Apr 2026 |
| 22 | pec.vet | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 23 | pec.guide | eNom, Inc. | 21 Jan 2015 | 11 Mar 2017 | 21 Jan 2018 |
| 24 | pec.help | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 25 | pec.diet | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 26 | pec.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 27 | pec.hosting | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 28 | pec.website | eNom, Inc. | 14 Feb 2015 | 10 Feb 2025 | 14 Feb 2026 |
| 29 | pec.moscow | Regional Network Information Center, JSC dba RU-CE… | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 30 | pec.expert | united-domains AG | 6 Mar 2015 | 25 May 2025 | 6 Mar 2026 |
| 31 | pec.global | 1&1 Internet AG | 25 Mar 2015 | 9 May 2025 | 25 Mar 2026 |
| 32 | pec.legal | Hosting Concepts B.V. dba Openprovider | 23 Jun 2025 | 23 Jun 2025 | 23 Jun 2026 |
| 33 | pec.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 34 | pec.construction | GoDaddy.com, LLC | 13 Apr 2015 | 28 May 2025 | 13 Apr 2027 |
| 35 | pec.solutions | GoDaddy.com, LLC | 20 Feb 2024 | 3 Apr 2025 | 20 Feb 2025 |
| 36 | pec.party | NameCheap, Inc. | 18 Aug 2019 | 18 Aug 2019 | 18 Aug 2020 |
| 37 | pec.club | EJEE Group Holdings Limited | 28 Dec 2015 | 22 Jan 2020 | 27 Dec 2020 |
| 38 | pec.pub | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Apr 2021 | 13 Apr 2024 | 13 Apr 2025 |
| 39 | pec.one | NameCheap, Inc. | 6 Sep 2024 | 11 Sep 2024 | 6 Sep 2025 |
| 40 | pec.tech | Xin Net Technology Corporation | 21 Oct 2017 | 15 Mar 2025 | 21 Oct 2026 |
| 41 | pec.asia | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 26 May 2024 | 5 May 2025 | 26 May 2026 |
| 42 | pec.online | 1&1 Internet AG | 26 Aug 2015 | 23 Nov 2016 | 26 Aug 2017 |
| 43 | pec.xyz | NameKing.com Inc. | 27 Oct 2021 | 12 Dec 2024 | 27 Oct 2025 |
| 44 | pec.xin | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 11 Oct 2015 | 12 Oct 2023 | 11 Oct 2024 |
| 45 | pec.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2024 | 15 Oct 2025 |
| 46 | pec.net | Register.it SPA | 12 Feb 2013 | 7 Nov 2024 | 5 Oct 2025 |
| 47 | pec.org | Network Solutions, LLC | 29 Aug 1997 | 4 Jul 2025 | 28 Aug 2026 |
| 48 | pec.com | Fabulous.com Pty Ltd. | 1 Apr 1997 | 28 Oct 2024 | 2 Apr 2028 |
| 49 | pec.srl | Tucows Domains Inc. | 11 Nov 2015 | 2 Nov 2024 | 11 Nov 2025 |
| 50 | pec.space | TLD Registrar Solutions Ltd. | 27 Nov 2015 | 30 Nov 2024 | 27 Nov 2025 |
| 51 | pec.ski | GoDaddy.com, LLC | 7 May 2020 | 21 Jun 2025 | 7 May 2030 |
| 52 | pec.news | eNom, Inc. | 2 Aug 2018 | 9 Jul 2025 | 2 Aug 2026 |
| 53 | pec.design | NameCheap, Inc. | 15 Jan 2016 | 21 Dec 2016 | 15 Jan 2018 |
| 54 | pec.build | Reserved for non-billable transactions where Regis… | 9 Apr 2024 | 3 Apr 2025 | 9 Apr 2026 |
| 55 | pec.wine | Tucows Domains Inc. | 26 Sep 2018 | 30 Sep 2024 | 26 Sep 2025 |
| 56 | pec.io | GoDaddy.com, LLC | 11 Jan 2015 | 25 Feb 2025 | 11 Jan 2026 |
| 57 | pec.pet | Blue Razor Domains, LLC | 23 Feb 2016 | 23 Apr 2016 | 23 Feb 2018 |
| 58 | pec.press | NameCheap, Inc. | 26 Mar 2016 | 26 Mar 2016 | 26 Mar 2017 |
| 59 | pec.pics | Porkbun, LLC | 23 Jul 2023 | 4 Sep 2024 | 23 Jul 2024 |
| 60 | pec.church | - | 21 Jul 2025 | 21 Jul 2025 | 21 Jul 2026 |
| 61 | pec.digital | Tucows Domains Inc. | 11 May 2016 | 12 Apr 2025 | 11 May 2026 |
| 62 | pec.na | - | - | - | - |
| 63 | pec.academy | GoDaddy.com, LLC | 17 Apr 2024 | 15 Sep 2024 | 17 Apr 2027 |
| 64 | pec.best | Tucows Domains Inc. | 24 May 2016 | 24 May 2016 | 23 May 2017 |
| 65 | pec.cloud | Tucows Domains Inc. | 23 May 2016 | 29 Apr 2025 | 23 May 2026 |
| 66 | pec.ltd | Wild West Domains, LLC | 6 Jun 2019 | 18 Jun 2020 | 6 Jun 2021 |
| 67 | pec.gmbh | united-domains AG | 22 Jun 2016 | 22 Jun 2025 | 22 Jun 2026 |
| 68 | pec.store | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Jun 2016 | 16 Jun 2017 | 14 Jun 2019 |
| 69 | pec.science | Alpnames Limited | 25 Feb 2015 | 21 May 2016 | 24 Feb 2017 |
| 70 | pec.tattoo | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 71 | pec.directory | NameCheap, Inc. | 21 Jun 2021 | 21 Jun 2021 | 21 Jun 2022 |
| 72 | pec.lol | NameCheap, Inc. | 20 Feb 2024 | 4 Apr 2025 | 20 Feb 2025 |
| 73 | pec.gratis | eNom, Inc. | 1 Sep 2014 | 27 Jul 2024 | 1 Sep 2025 |
| 74 | pec.email | eNom, Inc. | 19 Mar 2014 | 26 Feb 2025 | 19 Mar 2026 |
| 75 | pec.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Nov 2020 | - | 26 Nov 2021 |
| 76 | pec.wiki | Tucows Domains Inc. | 27 May 2014 | 23 May 2025 | 27 May 2026 |
| 77 | pec.partners | Tucows Domains Inc. | 11 Jun 2014 | 19 Apr 2025 | 11 Jun 2026 |
| 78 | pec.link | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 79 | pec.consulting | GoDaddy.com, LLC | 27 Aug 2014 | 28 Aug 2017 | 27 Aug 2018 |
| 80 | pec.services | Tucows Domains Inc. | 9 Jul 2014 | 17 May 2025 | 9 Jul 2026 |
| 81 | pec.biz | Megazone Corp., dba HOSTING.KR | 27 Mar 2002 | 27 Mar 2024 | 26 Mar 2024 |
| 82 | pec.com.br | - | 30 Jul 2003 | 12 Aug 2024 | 30 Jul 2025 |
| 83 | pec.us.com | Network Solutions, LLC | 2 Jan 2008 | 31 Aug 2023 | 2 Jan 2026 |
| 84 | pec.info | Internet Domain Services BS Corp | 14 Jan 2004 | 28 Feb 2025 | 14 Jan 2026 |
| 85 | pec.mobi | NameCheap, Inc. | 22 Jun 2021 | 22 Jun 2021 | 22 Jun 2022 |
| 86 | pec.tel | Internet Domain Services BS Corp | 20 Apr 2015 | 25 Apr 2017 | 19 Apr 2018 |
| 87 | pec.versicherung | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 21 Feb 2016 | - | 21 Feb 2017 |
| 88 | pec.cat | Estrategias WebSite S.L. | 5 Jul 2011 | 7 Jun 2025 | 5 Jul 2026 |
| 89 | pec.dk | - | 11 Oct 1998 | - | 31 Dec 2021 |
| 90 | pec.fr | - | 14 Jul 1998 | 13 Apr 2018 | 29 Jun 2020 |
| 91 | pec.kr | HANGANG Systems, Inc. d/b/a doregi.com | 27 Mar 2007 | 2 Jul 2021 | 27 Mar 2023 |
| 92 | pec.li | - | - | - | - |
| 93 | pec.me | eNom, Inc. | 19 Jul 2008 | 30 Nov 2017 | 19 Jul 2019 |
| 94 | pec.ps | - | 27 Dec 2004 | 28 Nov 2022 | 27 Dec 2023 |
| 95 | pec.pl | Namware.com, Inc. | 26 Nov 2013 | 27 Feb 2025 | 26 Nov 2025 |
| 96 | pec.tv | Dynadot, LLC | 26 Dec 2014 | 23 Apr 2025 | 26 Dec 2025 |
| 97 | pec.co.uk | - | 16 Jul 1997 | 18 Jul 2025 | 16 Jul 2027 |
| 98 | pec.ws | Global Domains International, Inc. DBA DomainCostC… | 9 Mar 2003 | 6 May 2020 | 9 Mar 2029 |
| 99 | pec.at | - | - | 6 Jul 2011 | - |
| 100 | pec.training | Tucows Domains Inc. | 19 Jul 2018 | 23 Jul 2019 | 19 Jul 2020 |
| 101 | pec.farm | Key-Systems, LLC | 28 Mar 2017 | 29 Sep 2017 | 28 Mar 2018 |
| 102 | pec.international | GoDaddy.com, LLC | 13 Aug 2022 | 7 Sep 2024 | 13 Aug 2025 |
| 103 | pec.group | united-domains AG | 7 Jun 2017 | 24 Jul 2025 | 7 Jun 2026 |
| 104 | pec.agency | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Dec 2021 | 15 Dec 2021 | 10 Dec 2026 |
| 105 | pec.org.uk | - | 1 Feb 1999 | 25 Jan 2025 | 1 Feb 2026 |
| 106 | pec.uk | - | 12 Jun 2014 | 13 Jun 2025 | 12 Jun 2026 |
| 107 | pec.me.uk | - | 8 Nov 2015 | 7 Oct 2024 | 8 Nov 2025 |
| 108 | pec.today | NameCheap, Inc. | 2 Mar 2025 | 7 Mar 2025 | 2 Mar 2026 |
| 109 | pec.cool | Hostinger, UAB | 17 Jan 2024 | 26 Dec 2024 | 17 Jan 2026 |
| 110 | pec.guru | NameCheap, Inc. | 2 Mar 2025 | 7 Mar 2025 | 2 Mar 2026 |
| 111 | pec.co | - | 23 Apr 2010 | 7 Jun 2025 | 22 Apr 2026 |
| 112 | pec.technology | Google, Inc. | 12 Dec 2018 | 12 Dec 2018 | 12 Dec 2019 |
| 113 | pec.tools | CloudFlare, Inc. | 9 Jan 2019 | 14 Jun 2025 | 9 Jan 2027 |
| 114 | pec.world | - | 1 Sep 2024 | 1 Feb 2025 | 1 Sep 2025 |
| 115 | pec.education | Crazy Domains FZ-LLC | 25 Feb 2019 | 22 Feb 2020 | 25 Feb 2021 |
| 116 | pec.engineering | Tucows Domains Inc. | 29 Jan 2019 | 10 Mar 2024 | 29 Jan 2024 |
| 117 | pec.works | Google, Inc. | 4 Nov 2022 | 3 Jun 2025 | 4 Nov 2025 |
| 118 | pec.energy | GoDaddy.com, LLC | 20 Jun 2019 | 21 Jun 2025 | 20 Jun 2026 |
| 119 | pec.wtf | One.com A/S | 8 Aug 2022 | 8 Aug 2024 | 8 Aug 2025 |
| 120 | pec.black | OVH sas | 23 Jul 2019 | 23 Jul 2025 | 23 Jul 2026 |
| 121 | pec.media | Google, Inc. | 9 Aug 2019 | 9 Aug 2019 | 9 Aug 2020 |
| 122 | pec.holdings | NameCheap, Inc. | 23 Jun 2021 | 23 Jun 2021 | 23 Jun 2022 |
| 123 | pec.plus | Wild West Domains, LLC | 11 Feb 2020 | 10 Jun 2024 | 11 Feb 2026 |
| 124 | pec.network | Network Solutions, LLC | 24 Feb 2020 | 31 Dec 2024 | 24 Feb 2026 |
| 125 | pec.center | OVH sas | 8 Mar 2018 | 22 Apr 2025 | 8 Mar 2026 |
| 126 | pec.team | GoDaddy.com, LLC | 20 Jul 2020 | 21 Jul 2025 | 20 Jul 2026 |
| 127 | pec.ovh | OVH sas | 3 Oct 2017 | 25 Jul 2025 | 3 Oct 2025 |
| 128 | pec.photos | NameCheap, Inc. | 9 Nov 2020 | 9 Nov 2020 | 9 Nov 2021 |
| 129 | pec.show | GoDaddy.com, LLC | 13 Nov 2020 | 3 May 2025 | 13 Nov 2026 |
| 130 | pec.ventures | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2021 | 14 Mar 2025 | 28 Jan 2026 |
| 131 | pec.com.co | Wild West Domains, LLC | 28 Apr 2011 | 2 Apr 2025 | 27 Apr 2026 |
| 132 | pec.shopping | GoDaddy.com, LLC | 12 Feb 2021 | 29 Aug 2024 | 12 Feb 2027 |
| 133 | pec.ru.com | NameKing.com Inc. | 19 Jun 2025 | 19 Jun 2025 | 19 Jun 2026 |
| 134 | pec.pm | - | 20 Jul 2013 | 27 May 2022 | 4 Jun 2023 |
| 135 | pec.fyi | GoDaddy.com, LLC | 3 Nov 2021 | 18 Dec 2024 | 3 Nov 2025 |
| 136 | pec.exchange | NameCheap, Inc. | 30 Nov 2021 | 30 Nov 2021 | 30 Nov 2022 |
| 137 | pec.solar | Cronon AG | 7 Apr 2022 | 22 May 2025 | 7 Apr 2026 |
| 138 | pec.zone | Tucows Domains Inc. | 20 May 2022 | 24 May 2023 | 20 May 2024 |
| 139 | pec.in | - | 6 Apr 2012 | 11 Apr 2025 | 6 Apr 2026 |
| 140 | pec.ma | - | 31 Mar 2014 | 1 May 2025 | 31 Mar 2026 |
| 141 | pec.co.kr | Inames Co. Ltd. | 6 Mar 1999 | 16 Jun 2011 | 15 Oct 2022 |
| 142 | pec.re | - | 8 Mar 2018 | 21 Feb 2022 | 8 Mar 2023 |
| 143 | pec.gallery | Zoho Corporation Private Limited | 25 Jul 2022 | 27 Jul 2025 | 25 Jul 2026 |
| 144 | pec.land | - | 30 Mar 2025 | 17 Jun 2025 | 30 Mar 2026 |
| 145 | pec.management | GoDaddy.com, LLC | 24 Aug 2022 | 5 Oct 2024 | 24 Aug 2024 |
| 146 | pec.fund | GoDaddy.com, LLC | 24 Aug 2022 | 5 Oct 2024 | 24 Aug 2024 |
| 147 | pec.nl | The Registrar Company B.V. | 9 Oct 1997 | 23 Aug 2024 | - |
| 148 | pec.co.jp | - | 21 Oct 2021 | 1 Nov 2024 | - |
| 149 | pec.net.in | - | 24 May 2010 | 23 Apr 2025 | 24 May 2026 |
| 150 | pec.org.in | - | 19 Aug 2023 | 3 Oct 2024 | 19 Aug 2025 |
| 151 | pec.com.au | - | - | 5 Jul 2025 | - |
| 152 | pec.quest | Tucows Domains Inc. | 11 Nov 2022 | 20 Mar 2025 | 11 Nov 2025 |
| 153 | pec.ai | - | - | - | - |
| 154 | pec.blog | 1API GmbH | 15 Nov 2022 | 29 Dec 2022 | 15 Nov 2023 |
| 155 | pec.careers | Cronon AG | 11 Jan 2023 | 25 Feb 2025 | 11 Jan 2026 |
| 156 | pec.app | CloudFlare, Inc. | 8 May 2018 | 10 Jun 2025 | 8 May 2026 |
| 157 | pec.support | GoDaddy.com, LLC | 18 Jan 2023 | 9 Sep 2024 | 18 Jan 2027 |
| 158 | pec.pt | - | - | - | - |
| 159 | pec.com.pl | - | 7 Jul 1998 | 16 Jun 2025 | 6 Jul 2026 |
| 160 | pec.pe | - | - | - | - |
| 161 | pec.beer | Tucows Domains Inc. | 26 Sep 2018 | 30 Sep 2024 | 26 Sep 2025 |
| 162 | pec.buzz | GoDaddy.com, LLC | 25 Feb 2019 | 3 Mar 2025 | 25 Feb 2027 |
| 163 | pec.co.th | - | 19 Dec 2003 | 6 Nov 2024 | 18 Dec 2026 |
| 164 | pec.cab | Tucows Domains Inc. | 16 Feb 2018 | 23 Jan 2025 | 16 Feb 2026 |
| 165 | pec.qa | - | - | 30 Aug 2024 | - |
| 166 | pec.cm | - | 1 Feb 2018 | 11 Jul 2024 | 1 Feb 2020 |
| 167 | pec.bio | NameCheap, Inc. | 13 Mar 2023 | 24 Apr 2024 | 13 Mar 2024 |
| 168 | pec.vision | Google, Inc. | 22 Mar 2023 | 3 Jun 2025 | 22 Mar 2026 |
| 169 | pec.ro | - | 21 Feb 2008 | - | 18 Jun 2028 |
| 170 | pec.country | NameCheap, Inc. | 13 Apr 2023 | 23 Mar 2025 | 13 Apr 2026 |
| 171 | pec.earth | GoDaddy.com, LLC | 5 Apr 2021 | 11 Apr 2025 | 5 Apr 2026 |
| 172 | pec.ie | - | 26 Jan 2006 | 14 Mar 2024 | 26 Jan 2027 |
| 173 | pec.lt | - | 24 Nov 2021 | - | 25 Nov 2025 |
| 174 | pec.melbourne | GoDaddy.com, LLC | 20 Mar 2018 | 27 Mar 2025 | 20 Mar 2027 |
| 175 | pec.ac.nz | - | 30 Jun 2004 | 30 Jul 2024 | - |
| 176 | pec.co.nz | - | 26 Mar 1997 | 11 Feb 2025 | - |
| 177 | pec.nz | - | 14 Feb 2020 | 11 Feb 2025 | - |
| 178 | pec.net.pl | - | 20 Jul 2025 | 20 Jul 2025 | 20 Jul 2026 |
| 179 | pec.rip | GoDaddy.com, LLC | 1 Jan 2022 | 12 Feb 2024 | 1 Jan 2024 |
| 180 | pec.co.mz | Reserved | 29 Jun 2022 | 7 Jul 2025 | 29 Jun 2025 |
| 181 | pec.ae | - | - | - | - |
| 182 | pec.lat | Porkbun, LLC | 25 Aug 2023 | 7 Nov 2024 | 25 Aug 2024 |
| 183 | pec.delivery | NameCheap, Inc. | 25 Sep 2023 | 6 Dec 2024 | 25 Sep 2024 |
| 184 | pec.bet | Tucows Domains Inc. | 27 Sep 2023 | 17 Mar 2025 | 27 Sep 2025 |
| 185 | pec.beauty | GoDaddy.com, LLC | 17 Jan 2024 | 28 Feb 2025 | 17 Jan 2025 |
| 186 | pec.watch | Tucows Domains Inc. | 19 Jan 2024 | 17 Jan 2025 | 19 Jan 2026 |
| 187 | pec.vin | - | 1 Jun 2025 | 30 Jul 2025 | 1 Jun 2026 |
| 188 | pec.cn | ???????????? | 31 Mar 2003 | - | 31 Mar 2028 |
| 189 | pec.hr | - | 9 May 2006 | 2 Sep 2024 | 2 Sep 2025 |
| 190 | pec.uno | OVH sas | 8 Mar 2018 | 1 May 2025 | 8 Mar 2026 |
| 191 | pec.berlin | united-domains AG | 25 Mar 2024 | 23 May 2025 | 25 Mar 2026 |
| 192 | pec.ru | - | 7 May 2024 | - | 7 May 2026 |
| 193 | pec.su | - | 2 Feb 2012 | - | 2 Feb 2026 |
| 194 | pec.eu | - | - | - | - |
| 195 | pec.org.cn | - | 9 Jul 2024 | - | 9 Jul 2026 |
| 196 | pec.by | - | 12 Oct 2023 | 13 May 2025 | 12 Oct 2026 |
| 197 | pec.bz | GoDaddy.com, LLC | 24 Oct 2015 | 1 Aug 2023 | 24 Oct 2025 |
| 198 | pec.contractors | GoDaddy.com, LLC | 11 Sep 2024 | 16 Sep 2024 | 11 Sep 2025 |
| 199 | pec.finance | Hostinger, UAB | 11 Sep 2024 | 16 Sep 2024 | 11 Sep 2025 |
| 200 | pec.business | Gransy s.r.o. d/b/a subreg.cz | 4 Nov 2024 | 9 Nov 2024 | 4 Nov 2025 |
| 201 | pec.se | - | 4 Sep 2003 | 27 Jan 2025 | 4 Sep 2025 |
| 202 | pec.rocks | GoDaddy.com, LLC | 29 Dec 2024 | 3 Jan 2025 | 29 Dec 2025 |
| 203 | pec.fun | NameCheap, Inc. | 26 Jan 2025 | 13 Feb 2025 | 26 Jan 2026 |
| 204 | pec.chat | DNSPod, Inc. | 8 Feb 2025 | 13 Feb 2025 | 8 Feb 2026 |
| 205 | pec.associates | NameCheap, Inc. | 14 Feb 2025 | 19 Feb 2025 | 14 Feb 2026 |
| 206 | pec.homes | GoDaddy.com, LLC | 28 Feb 2025 | 25 Apr 2025 | 28 Feb 2026 |
| 207 | pec.de | - | - | 19 Dec 2007 | - |
| 208 | pec.uk.com | GoDaddy.com, LLC | 23 Apr 2025 | 27 May 2025 | 23 Apr 2026 |
| 209 | pec.sa.com | NameKing.com Inc. | 24 Jul 2025 | 29 Jul 2025 | 24 Jul 2026 |
| 210 | pecans.tv | Name.com, Inc. | 28 Oct 2010 | 27 Oct 2016 | 28 Oct 2017 |
| 211 | pectoralworkouts.com | DropCatch.com 519 LLC | 22 Feb 2016 | 23 Feb 2017 | 22 Feb 2018 |
| 212 | pec21c.com.tw | - | 26 Nov 1999 | - | 28 Jul 2022 |
| 213 | pecash.com | Moniker Online Services LLC | 12 Oct 1999 | 10 Oct 2024 | 12 Oct 2025 |
| 214 | peche-mignon.net | DROPCATCH.COM 774 LLC | 6 Mar 2022 | 23 Oct 2023 | 6 Mar 2026 |
| 215 | peckadesign.cz | - | 12 Jun 2000 | 15 May 2025 | 12 Jun 2026 |
| 216 | pecreation.com | CloudFlare, Inc. | 29 Apr 2010 | 23 May 2025 | 29 Apr 2026 |
| 217 | peccaminosi.net | Tucows Domains Inc. | 12 Dec 2011 | 16 Dec 2016 | 12 Dec 2016 |
| 218 | pecksdraincleaning.org | - | 25 Sep 2012 | 25 Sep 2012 | 25 Sep 2013 |
| 219 | pecsb.com.my | - | 27 Sep 2004 | 20 Sep 2011 | 27 Sep 2014 |
| 220 | pective.com | Porkbun, LLC | 11 Sep 2008 | 10 Sep 2024 | 11 Sep 2025 |
| 221 | peccaminosi.com | GoDaddy.com, LLC | 6 Jun 2025 | 9 Jul 2025 | 6 Jun 2026 |
| 222 | pecunix.com | GoDaddy.com, LLC | 29 Jun 2000 | 30 Jun 2025 | 29 Jun 2026 |
| 223 | pec300.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Sep 2024 | 5 Jul 2025 | 15 Sep 2025 |
| 224 | pechechassediscount.com | OVH sas | 26 Dec 2006 | 31 Oct 2024 | 26 Dec 2024 |
| 225 | peclersparis.com | CSC Corporate Domains, Inc. | 15 Dec 1997 | 3 Jan 2025 | 14 Dec 2025 |
| 226 | pecsipedia.com | DROPCATCH.COM 768 LLC | 30 Jul 2025 | 30 Jul 2025 | 30 Jul 2026 |
| 227 | pechakuchamontevideo.org | GoDaddy.com, LLC | 18 Feb 2010 | 4 Apr 2025 | 18 Feb 2026 |
| 228 | pectstocks.com | DropSave.com, Inc. | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 229 | pecca.com.br | - | 7 Mar 2006 | 8 Mar 2025 | 7 Mar 2026 |
| 230 | pechemaniac.com | Gandi SAS | 15 Apr 2002 | 2 Apr 2025 | 15 Apr 2026 |
| 231 | peckhamplex.com | Webfusion Ltd. | 23 May 2003 | 24 May 2025 | 23 May 2027 |
| 232 | pecatto.com.br | - | - | - | - |
| 233 | pecesycoralesbarato.com | Moniker Online Services LLC | 27 Apr 2011 | 28 Apr 2012 | 27 Apr 2013 |
| 234 | pecha-kucha.org | Amazon Registrar, Inc. | 31 Mar 2006 | 1 Mar 2025 | 31 Mar 2026 |
| 235 | peci.org | LiquidNet Ltd. | 7 Jan 1998 | 17 Mar 2023 | 6 Jan 2033 |
| 236 | peckish.co | GoDaddy.com, LLC | 2 Jul 2021 | 13 Aug 2023 | 2 Jul 2023 |
| 237 | pecomark.com | Nominalia Internet S.L. | 12 Jul 2012 | 8 Jan 2024 | 25 Jan 2026 |
| 238 | pecorine.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Apr 2008 | 14 Jan 2025 | 4 Apr 2026 |
| 239 | pecentral.org | CloudFlare, Inc. | 23 Mar 1999 | 26 Feb 2025 | 23 Mar 2026 |
| 240 | pecheetchasse.com | Internet Domain Services BS Corp | 24 Sep 2012 | 10 Jan 2025 | 24 Sep 2025 |
| 241 | peclights.com | Webfusion Ltd. | 16 Nov 2007 | 17 Nov 2024 | 16 Nov 2025 |
| 242 | pecos.com.tw | - | 11 Oct 2001 | - | 1 Nov 2016 |
| 243 | pecadosardentes.com | Old Tyme Domains, LLC | 12 May 2016 | 25 Jun 2017 | 12 May 2018 |
| 244 | pecco24.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 7 Dec 2011 | 12 Feb 2024 | 7 Dec 2025 |
| 245 | pechanga.net | Network Solutions, LLC | 16 Dec 1998 | 16 Dec 2023 | 16 Dec 2033 |
| 246 | pecintakomik.com | GoDaddy.com, LLC | 5 May 2012 | 6 May 2025 | 5 May 2026 |
| 247 | peckamodel.cz | - | 13 May 1998 | 16 Aug 2024 | 12 Oct 2025 |
| 248 | pecovatel.cz | - | 20 Jul 2000 | 30 Sep 2010 | 24 Jul 2015 |
| 249 | pectore-eco.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 Feb 2024 | 2 Apr 2025 | 25 Feb 2026 |
| 250 | pec24.com | GoDaddy.com, LLC | 5 Oct 2020 | 19 Feb 2025 | 5 Oct 2025 |
| 251 | pecadocarnal.com | Epik Inc. | 21 Jul 2017 | 22 Jul 2025 | 21 Jul 2025 |
| 252 | pecanbread.com | Google, Inc. | 23 Mar 2003 | 8 Mar 2025 | 23 Mar 2026 |
| 253 | pececik.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 31 Oct 2024 | 31 Oct 2024 | 30 Oct 2025 |
| 254 | pecera.info | Porkbun, LLC | 17 Aug 2022 | 19 Jul 2024 | 17 Aug 2025 |
| 255 | peche-direct.com | Gandi SAS | 18 Jul 2022 | 22 Jun 2025 | 18 Jul 2026 |
| 256 | pechesbancaires.eu | - | - | - | - |
| 257 | pecheur.info | Internet Domain Services BS Corp | 10 May 2010 | 23 Mar 2025 | 10 May 2026 |
| 258 | pecasplasticas.com | eName Technology Co., Ltd. | 25 Apr 2019 | 25 Apr 2019 | 25 Apr 2020 |
| 259 | peccavi.com | GoDaddy.com, LLC | 1 May 2016 | 23 Jan 2024 | 1 May 2026 |
| 260 | pecfest2012.in | - | 15 Oct 2012 | 15 Oct 2012 | 15 Oct 2013 |
| 261 | pecheur-du-net.com | GMO Internet Inc. | 23 Aug 2017 | - | 23 Aug 2018 |
| 262 | pecheur.com | Gandi SAS | 3 Feb 1999 | 30 Dec 2024 | 3 Feb 2026 |
| 263 | pechinchadavez.com.br | - | 15 Sep 2010 | 28 Sep 2015 | 15 Sep 2016 |
| 264 | pechiyug.com | - | 24 Sep 2023 | 25 Sep 2024 | 24 Sep 2025 |
| 265 | peck.it | - | 2 Apr 1997 | 24 Sep 2024 | 12 Sep 2025 |
| 266 | peckadesign.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 19 Mar 2001 | 13 Jul 2025 | 19 Mar 2026 |
| 267 | pecuaria.com.br | - | 30 Nov 1998 | 14 Aug 2021 | 30 Nov 2028 |
| 268 | pecimprese.it | Gandi SAS | 16 Mar 2009 | 8 Jun 2025 | 23 May 2026 |
| 269 | pectacularperformance.com | GoDaddy.com, LLC | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 270 | pecotur.com | Launchpad, Inc. | 21 Oct 2014 | 24 Oct 2016 | 21 Oct 2017 |
| 271 | pecorarodesign.com | Domain.com, LLC | 28 Dec 2023 | 8 Dec 2024 | 28 Dec 2025 |
| 272 | peco-cic.com | Webfusion Ltd. | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 273 | pecetesepeti.com | Reg2C.com Inc. | 20 Sep 2024 | 20 Nov 2024 | 20 Sep 2025 |
| 274 | pecelnisupikohoteri.com | EvoPlus Ltd. | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 275 | pecda.com | Squarespace Domains LLC | 12 Sep 2023 | 26 Sep 2024 | 12 Sep 2025 |
| 276 | pecanlandpark.com | GoDaddy.com, LLC | 22 Oct 2014 | 11 Oct 2024 | 22 Oct 2025 |
| 277 | pec-tacularperformance.com | GoDaddy.com, LLC | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 278 | pec-email.com | Register.it SPA | 2 May 2012 | 4 Jun 2025 | 2 May 2026 |
| 279 | pec-journal.com | SafeNames Ltd. | 21 Nov 2008 | 22 Nov 2024 | 21 Nov 2025 |
| 280 | pec-result.com | GoDaddy.com, LLC | 13 May 2013 | 14 May 2025 | 13 May 2026 |
| 281 | pecahbanget.com | NameCheap, Inc. | 8 Dec 2023 | 19 Feb 2025 | 8 Dec 2024 |
| 282 | pecandu.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 283 | pecapecasnaweb.com.br | - | 28 Feb 2013 | 26 Feb 2016 | 28 Feb 2017 |
| 284 | pecas-on-line.com.br | - | 1 Oct 1999 | 27 Sep 2023 | 1 Oct 2025 |
| 285 | pecasauto24.pt | - | 2 Apr 2013 | - | 2 Mar 2026 |
| 286 | pecasautoviaweb.com | 1&1 Internet AG | 24 Nov 2010 | 9 Apr 2024 | 24 Nov 2025 |
| 287 | pecat.co.rs | - | - | - | - |
| 288 | pecavvocatinola.it | - | 30 Oct 2009 | 15 Nov 2016 | 30 Oct 2017 |
| 289 | pecavvocatirieti.it | - | 30 Oct 2009 | 5 Nov 2024 | 20 Oct 2025 |
| 290 | pecb.org | Rebel.com Corp. | 11 Jun 2009 | 11 Jun 2025 | 11 Jun 2026 |
| 291 | peccatidigola.tv | NameCheap, Inc. | 14 Feb 2024 | 14 Feb 2025 | 14 Feb 2025 |
| 292 | peceniehrou.sk | - | 13 Jun 2008 | 13 Jun 2025 | 1 Jun 2026 |
| 293 | pecenieskamkou.eu | - | - | - | - |
| 294 | pecepoli.com.br | - | 25 Sep 2009 | 16 Sep 2020 | 25 Sep 2025 |
| 295 | pecetegetir.tv | Dynadot, LLC | 1 Jan 2015 | 22 Jan 2017 | 1 Jan 2018 |
| 296 | pecgratuita.it | - | 7 Nov 2023 | 23 Nov 2024 | 7 Nov 2025 |
| 297 | pechakucha.org | Amazon Registrar, Inc. | 3 Jan 2008 | 4 Dec 2024 | 3 Jan 2026 |
| 298 | pechanga.com | GoDaddy.com, LLC | 7 Mar 1996 | 3 Jul 2025 | 8 Mar 2035 |
| 299 | pechasoku.com | eNom, Inc. | 11 Aug 2014 | 10 Jul 2016 | 11 Aug 2018 |
| 300 | pechatnick.com | Regtime Ltd. | 10 Aug 2012 | 15 Oct 2024 | 16 Oct 2025 |
| 301 | peche-capdagde.com | OVH sas | 28 Jun 2007 | 28 Jun 2018 | 28 Jun 2019 |
| 302 | peche-leurre-evolution.com | Network Solutions, LLC | 30 May 2007 | 19 May 2025 | 30 May 2026 |
| 303 | peche-partage.fr | - | 19 Feb 2012 | 10 Apr 2025 | 20 Apr 2026 |
| 304 | pecheaustin.com | FastDomain Inc. | 28 Aug 2008 | 21 Jun 2025 | 7 Jul 2026 |
| 305 | pecheli.net | Tucows Domains Inc. | 4 Oct 2005 | 19 Sep 2024 | 4 Oct 2025 |
| 306 | pechemdoma.com | Regional Network Information Center, JSC dba RU-CE… | 23 Oct 2014 | 14 Oct 2024 | 22 Oct 2025 |
| 307 | pecherestaurant.com | GoDaddy.com, LLC | 30 Jan 2013 | 27 Jan 2023 | 30 Jan 2026 |
| 308 | pecheretchasser.com | OVH sas | 2 Jan 2007 | 13 Apr 2025 | 2 Jan 2026 |
| 309 | pecherskhall.com.ua | Internet NAYANA Inc. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 310 | pecicero.com.br | - | 6 Jan 1998 | 2 Jan 2025 | 6 Jan 2028 |
| 311 | pecinformation.com | Domainnovations, Inc. | 30 Mar 2022 | 2 Apr 2023 | 30 Mar 2024 |
| 312 | pecinileiloes.com.br | - | 10 Mar 2005 | 5 Feb 2021 | 10 Mar 2030 |
| 313 | pecireci.com | Hongkong Domain Name Information Management Co., L… | 11 Nov 2021 | 16 Nov 2022 | 11 Nov 2022 |
| 314 | peclist.com | Dynadot, LLC | 10 Sep 2022 | 19 Nov 2023 | 10 Sep 2023 |
| 315 | peco-japan.com | GMO Internet Inc. | 28 Nov 2014 | 13 Nov 2024 | 28 Nov 2025 |
| 316 | pecobikes.sk | - | 18 Aug 2011 | 12 Sep 2024 | 18 Aug 2025 |
| 317 | pecolly.jp | Japan Registry Services Co., Ltd. | 11 May 2012 | 1 Jun 2014 | 31 May 2015 |
| 318 | pecon.co.in | - | 7 Jun 2002 | 11 Jun 2025 | 7 Jun 2026 |
| 319 | pecoraverde.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jul 2012 | 15 Jan 2020 | 11 Jul 2025 |
| 320 | pecori.jp | - | 12 Nov 2005 | 1 Dec 2024 | 30 Nov 2025 |
| 321 | pecrc.in | - | 25 Apr 2011 | 10 May 2017 | 25 Apr 2018 |
| 322 | pecton.com.cn | Dagnabit, Incorporated | 1 Jan 2015 | - | 1 Jan 2016 |
| 323 | pectus.com | GoDaddy.com, LLC | 5 Jan 2000 | 5 Jan 2025 | 5 Jan 2026 |
| 324 | pecucoconut.com | PT Ardh Global Indonesia | 7 Nov 2012 | 24 Oct 2024 | 7 Nov 2025 |
| 325 | peculon.com | Tucows Domains Inc. | 2 Jul 2004 | 17 May 2024 | 2 Jul 2029 |
| 326 | pecuniapact.com | DropCatch.com 669 LLC | 8 May 2016 | 9 May 2017 | 8 May 2018 |
| 327 | pecuniapactsystem.com | GoDaddy.com, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 328 | pecuniasystems.com | NameCheap, Inc. | 16 Jan 2011 | 17 Jan 2025 | 16 Jan 2026 |
| 329 | peculr.org | GoDaddy.com, LLC | 19 Oct 2014 | 20 Oct 2016 | 19 Oct 2017 |
| 330 | pechosdemujer.org | Tucows Domains Inc. | 15 Oct 2011 | 19 Oct 2014 | 15 Oct 2015 |
| 331 | peconicriver123.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2017 |
| 332 | peckonthebeak.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2019 |
| 333 | pecklipbalm.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2019 |
| 334 | peckertrack.com | GoDaddy.com, LLC | 23 Oct 2014 | 10 Feb 2025 | 9 Feb 2026 |
| 335 | pecheloisir34.com | HiChina Zhicheng Technology Limited | 14 Dec 2019 | 14 Dec 2019 | 14 Dec 2020 |
| 336 | pecds.com | GMO Internet Inc. | 10 Jan 2023 | 20 Feb 2024 | 10 Jan 2024 |
| 337 | pecamusic.com | NameCheap, Inc. | 16 Jun 2025 | 16 Jun 2025 | 16 Jun 2026 |
| 338 | pecetowiec.pl | - | 25 Jul 2008 | 18 Jul 2017 | 25 Jul 2019 |
| 339 | pechatay.ru | - | 11 Jul 2023 | - | 11 Jul 2025 |
| 340 | pechati-don.ru | - | 29 Mar 2012 | - | 29 Mar 2026 |
| 341 | pechemdoma.ru | - | 20 Jan 2015 | - | 20 Jan 2026 |
| 342 | pechilux.ru | - | 11 Aug 2008 | - | 11 Aug 2026 |
| 343 | pectusexcavatum.ru | - | 2 Oct 2008 | - | 2 Oct 2025 |
| 344 | pechagina.ru | - | 1 Oct 2024 | - | 1 Oct 2025 |
| 345 | pechenuka.ru | - | 12 Oct 2017 | - | 12 Oct 2025 |
| 346 | pecom.ru | - | 22 Nov 2001 | - | 23 Nov 2025 |
| 347 | pec-siedlce.com.pl | home.pl S.A. | 26 Nov 1999 | 13 Oct 2023 | 25 Nov 2026 |
| 348 | pecgroup.ir | - | - | - | - |
| 349 | pechatinet.ru | - | 9 Feb 2006 | - | 9 Feb 2026 |
| 350 | pechatitut.ru | - | 23 Jun 2008 | - | 23 Jun 2026 |
| 351 | pechi-tut.ru | - | 17 Feb 2014 | - | 17 Feb 2026 |
| 352 | pechka003.ru | - | 1 Mar 2024 | - | 1 Mar 2025 |
| 353 | pechka03.ru | - | 15 Apr 2025 | - | 15 Apr 2026 |
| 354 | pechkin-mail.ru | - | 4 Jun 2024 | - | 4 Jun 2026 |
| 355 | pechkinnewbie.ru | - | - | - | - |
| 356 | pechkinstat.ru | - | 19 Sep 2012 | - | 19 Sep 2025 |
| 357 | pechkintrust.ru | - | 24 Sep 2024 | - | 24 Sep 2025 |
| 358 | pechundschwefel.eu | RegistryGate GmbH | - | - | - |
| 359 | pecsimami.hu | - | 27 Jun 2018 | - | - |
| 360 | pecsistop.hu | - | 18 Nov 2009 | - | - |
| 361 | pecsiujsag.hu | - | 19 Mar 2007 | - | - |
| 362 | pecsma.hu | - | 16 Apr 2009 | - | - |
| 363 | pecsradio.hu | - | 6 Mar 2022 | - | - |
| 364 | peczwolle.nl | - | 30 Mar 2005 | 23 Apr 2022 | - |
| 365 | peco-cic.org | Mesh Digital Limited | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 366 | peco.com | CSC Corporate Domains, Inc. | 21 Apr 1994 | 18 Apr 2025 | 22 Apr 2026 |
| 367 | peckiecrm.info | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 368 | pechky.ru | - | 6 Jun 2011 | - | 6 Jun 2026 |
| 369 | pechoratoday.ru | - | 9 Feb 2011 | - | 9 Feb 2026 |
| 370 | pechki.ru | - | 4 Sep 2001 | - | 6 Sep 2025 |
| 371 | pecoramannara.com | Name.com, Inc. | 23 Oct 2011 | 29 Sep 2024 | 23 Oct 2025 |
| 372 | pecari.es | - | - | - | - |
| 373 | peckamodel.sk | - | - | 2 Dec 2014 | 16 Dec 2015 |
| 374 | pecadodevinho.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Mar 2024 | 2 Jul 2025 | 7 Mar 2026 |
| 375 | pecadoras.com.mx | INTERNEXT | 10 Sep 2012 | 27 Oct 2014 | 10 Sep 2015 |
| 376 | pechat.bg | - | 26 Apr 2010 | - | 26 Apr 2019 |
| 377 | pechosvideos.com | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Sep 2019 | 17 Sep 2019 | 17 Sep 2020 |
| 378 | pechpech.net | GMO Internet Inc. | 18 Apr 2023 | 30 Jun 2025 | 18 Apr 2025 |
| 379 | peculiarknew.com | - | - | - | - |
| 380 | pecpuebla.com | Network Information Center Mexico, S.C. | 23 Oct 2014 | 26 Nov 2024 | 23 Oct 2027 |
| 381 | peckercare.com | Century Oriental International Co., Ltd. | 19 Oct 2013 | 23 Oct 2014 | 19 Oct 2015 |
| 382 | pechalatbourzat.com | GMO Internet Inc. | 1 May 2020 | 1 May 2020 | 1 May 2021 |
| 383 | peche-pesca-fishing-discount.com | GMO Internet Inc. | 26 Nov 2019 | 27 Nov 2019 | 26 Nov 2020 |
| 384 | pectopah.ru | - | 18 Feb 2000 | - | 28 Feb 2026 |
| 385 | peco-uk.com | Register.it SPA | 20 Aug 1997 | 1 Jul 2025 | 19 Aug 2026 |
| 386 | pecasvending.pt | - | 4 Oct 2013 | - | 4 Sep 2026 |
| 387 | pecina.cz | - | 3 Sep 2000 | 7 Mar 2010 | 3 Sep 2017 |
| 388 | pechosmenores.net | - | - | - | - |
| 389 | pec-michoacan.gob.mx | asf | 14 Sep 2007 | 14 Sep 2014 | 13 Sep 2015 |
| 390 | pecciolifutura.org | Tucows Domains Inc. | 31 Jan 2001 | 14 Jan 2025 | 31 Jan 2027 |
| 391 | pecadosdecafe.net | OVH sas | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 392 | pecapecas.com.br | - | - | - | - |
| 393 | pechatnaruzhka.ru | - | 2 Jul 2024 | - | 2 Jul 2026 |
| 394 | pechostiernos.com | NetEarth One Inc. d/b/a NetEarth | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 395 | pectusinfo.com | Namesilo, LLC | 10 Jan 2003 | 11 Jan 2025 | 10 Jan 2026 |
| 396 | pecformas.ind.br | - | - | - | - |
| 397 | peche-poissons.com | Internet Domain Services BS Corp | 29 May 2000 | 14 Apr 2025 | 29 May 2027 |
| 398 | pechati-m.ru | - | 28 Sep 2006 | - | 28 Sep 2025 |
| 399 | pecodrive.net | GoDaddy.com, LLC | 14 Feb 2013 | 1 Apr 2025 | 14 Feb 2026 |
| 400 | pechoshot.net | - | - | - | - |
| 401 | pecg.com.cn | Dagnabit, Incorporated | 14 Jan 2015 | - | 14 Jan 2018 |
| 402 | pecritique.com | GoDaddy.com, LLC | 25 Aug 2012 | 29 Dec 2024 | 25 Aug 2026 |
| 403 | pecoton.com | OVH sas | 22 Feb 2019 | 23 Feb 2025 | 22 Feb 2026 |
| 404 | pecoll.com | GMO Internet Inc. | 2 Apr 2025 | 2 Apr 2025 | 2 Apr 2026 |
| 405 | peclassallday.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 406 | peckq.com | register.com, Inc. | 7 Sep 2014 | 24 Oct 2014 | 7 Sep 2015 |
| 407 | pecisongkok.com | Google, Inc. | 22 Aug 2023 | 18 Aug 2024 | 22 Aug 2025 |
| 408 | pechecatering.com | GoDaddy.com, LLC | 24 Oct 2014 | 25 Oct 2016 | 24 Oct 2017 |
| 409 | pecanparkproperties.com | Domain.com, LLC | 1 Nov 2013 | 17 Oct 2024 | 1 Nov 2025 |
| 410 | pecan-park.com | Wix.com Ltd. | 1 Nov 2013 | 2 Oct 2024 | 1 Nov 2025 |
| 411 | pecemeslucinou.cz | Red Register, Inc. | 19 Feb 2015 | 16 Apr 2014 | 19 Feb 2016 |
| 412 | pecordineavvocatipisa.it | - | 4 Dec 2009 | 17 Dec 2024 | 1 Dec 2025 |
| 413 | pechosbellos.net | - | - | - | - |
| 414 | pectrumfederal.com | Hebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.… | 10 Apr 2015 | 22 May 2015 | 10 Apr 2016 |
| 415 | pechemaster.com | DropCatch.com 1545 LLC | 21 Jul 2019 | 15 Jul 2025 | 21 Jul 2026 |
| 416 | peconsoft.com | Visesh Infotecnics Ltd. d/b/a Signdomains.com | 15 Dec 2010 | 14 Jan 2019 | 15 Dec 2019 |
| 417 | pechedelatruite.com | enom469, Incorporated | 16 Jun 2022 | 18 Jun 2025 | 16 Jun 2026 |
| 418 | pechoin.com | HiChina Zhicheng Technology Limited | 26 Sep 2008 | 29 Nov 2023 | 26 Sep 2027 |
| 419 | pechimax.ru | - | 31 Oct 2011 | - | 31 Oct 2025 |
| 420 | pecopallet.com | Network Solutions, LLC | 20 Aug 1997 | 19 Aug 2024 | 19 Aug 2034 |
| 421 | pecosos.com | Arab Internet Names, Incorporated | 24 Dec 2024 | 24 Dec 2024 | 24 Dec 2025 |
| 422 | pechatnik-spb.ru | - | 6 Jun 2023 | - | 6 Jun 2026 |
| 423 | pechati-1.ru | - | 16 Sep 2011 | - | 16 Sep 2025 |
| 424 | pecmedia.co.za | Domainz Limited | 30 May 2015 | - | - |
| 425 | pecintabinatang.com | Hostinger, UAB | 10 Jan 2024 | 25 Mar 2025 | 10 Jan 2025 |
| 426 | pechosregister.com | NetEarth One Inc. d/b/a NetEarth | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 427 | pechdvorik.ru | - | 28 Aug 2024 | - | 28 Aug 2025 |
| 428 | pechenibolezni.ru | - | 24 Apr 2024 | - | 24 Apr 2026 |
| 429 | pechi-kaminy-barbeku.ru | - | 26 Aug 2011 | - | 26 Aug 2025 |
| 430 | peck.co.uk | - | 9 Feb 1999 | 10 Feb 2025 | 9 Feb 2026 |
| 431 | peche2caps.net | OVH sas | 24 Mar 2005 | 25 Mar 2025 | 24 Mar 2026 |
| 432 | pecksbadboymusic.com | GoDaddy.com, LLC | 24 May 2013 | 25 May 2015 | 24 May 2016 |
| 433 | peckerpants.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Oct 2019 | 6 Oct 2024 | 4 Oct 2025 |
| 434 | pechalatbourzat.net | OVH sas | 19 Oct 2013 | 23 Oct 2014 | 19 Oct 2016 |
| 435 | pecksbadboyband.com | GoDaddy.com, LLC | 24 May 2013 | 25 May 2015 | 24 May 2016 |
| 436 | pecksbadboyartist.com | GoDaddy.com, LLC | 24 May 2013 | 25 May 2015 | 24 May 2016 |
| 437 | pecksbadboygroup.com | GoDaddy.com, LLC | 24 May 2013 | 25 May 2015 | 24 May 2016 |
| 438 | pecel.tv | GoDaddy.com, LLC | 24 May 2011 | 25 May 2015 | 24 May 2016 |
| 439 | peculiarca.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Feb 2019 | 7 Feb 2019 | 7 Feb 2020 |
| 440 | pecintakuliner.com | CV. Jogjacamp | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2016 |
| 441 | pecintaburung.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Aug 2021 | 1 May 2022 | 10 Aug 2022 |
| 442 | pecanscook.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Jun 2021 | 19 Aug 2023 | 17 Jun 2023 |
| 443 | pectushoy.com | GoDaddy.com, LLC | 29 May 2012 | 30 May 2015 | 29 May 2016 |
| 444 | pecoraverdi.tv | GoDaddy.com, LLC | 29 May 2012 | 30 May 2015 | 29 May 2016 |
| 445 | peculiarfaithministries.org | Dynadot, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 446 | pecoton.net | eNom, Inc. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 447 | peckfamily.ws | - | - | - | - |
| 448 | pecashios.com | GoDaddy.com, LLC | 1 Jun 2014 | 1 Jun 2015 | 1 Jun 2016 |
| 449 | pecoramotorsport.org | GoDaddy.com, LLC | 1 Jun 2010 | 13 Jun 2015 | 1 Jun 2016 |
| 450 | pecuniousrealestate.com | GoDaddy.com, LLC | 2 Jun 2014 | 13 Jun 2015 | 2 Jun 2016 |
| 451 | pecoramotorsport.net | GoDaddy.com, LLC | 1 Jun 2010 | 2 Jun 2015 | 1 Jun 2016 |
| 452 | pecoramotorsport.info | GoDaddy.com, LLC | 1 Jun 2010 | 1 Jun 2015 | 1 Jun 2016 |
| 453 | peccla.org | Go Canada Domains, LLC | 2 Jun 2014 | 18 May 2025 | 2 Jun 2026 |
| 454 | pechoinws.com | HiChina Zhicheng Technology Limited | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 455 | pecangrovebusiness.com | NameCheap, Inc. | 27 Oct 2014 | 10 Jan 2018 | 27 Oct 2018 |
| 456 | pecesacuario.com | Realtime Register B.V. | 20 Mar 2023 | 21 Mar 2025 | 20 Mar 2026 |
| 457 | pecoton.org | eNom, Inc. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 458 | peccoleranchlasvegas.com | GoDaddy.com, LLC | 5 Mar 2025 | 5 Mar 2025 | 5 Mar 2028 |
| 459 | peccoleranchlasvegas.net | GoDaddy.com, LLC | 22 May 2013 | 23 May 2015 | 22 May 2016 |
| 460 | pecadordelapradera.com | NameCheap, Inc. | 28 Oct 2020 | 28 Oct 2022 | 28 Oct 2023 |
| 461 | pecanindia.com | GoDaddy.com, LLC | 23 May 2012 | 24 May 2015 | 23 May 2016 |
| 462 | peckandartisans.net | GoDaddy.com, LLC | 23 May 2007 | 24 May 2015 | 23 May 2016 |
| 463 | pechulsdesign.com | GoDaddy.com, LLC | 4 Jun 2013 | 5 Jun 2015 | 4 Jun 2016 |
| 464 | pecerabali2014.com | GMO Internet Inc. | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 465 | peconicriversportsmansclub.com | Squarespace Domains LLC | 15 Jun 2022 | 31 May 2025 | 15 Jun 2026 |
| 466 | pechugaccs.com | Network Solutions, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2016 |
| 467 | pecco-us.com | Tucows Domains Inc. | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 468 | pecadosvip.com | TurnCommerce, Inc. DBA NameBright.com | 20 Mar 2022 | 21 Apr 2024 | 20 Mar 2024 |
| 469 | peckinpaughmedia.com | GoDaddy.com, LLC | 5 Jun 2008 | 6 Jun 2015 | 5 Jun 2016 |
| 470 | pecwest.org | Go Montenegro Domains, LLC | 17 Mar 2017 | 17 May 2017 | 17 Mar 2018 |
| 471 | pecanpassion.com | - | - | - | - |
| 472 | pecanpassioncandy.com | - | - | - | - |
| 473 | pechelli.net | Wild West Domains, LLC | 18 Aug 2012 | 29 Jan 2015 | 18 Aug 2015 |
| 474 | peccamen.com | GoDaddy.com, LLC | 24 Jan 2002 | 21 Jul 2025 | 24 Jan 2027 |
| 475 | peckererection.com | GoDaddy.com, LLC | 10 Nov 2009 | 10 Nov 2024 | 10 Nov 2025 |
| 476 | peckererection.net | GoDaddy.com, LLC | 10 Nov 2009 | 10 Nov 2014 | 10 Nov 2015 |
| 477 | peckererections.com | GoDaddy.com, LLC | 10 Nov 2009 | 10 Nov 2024 | 10 Nov 2025 |
| 478 | pechemotors.com | Tucows Domains Inc. | 17 Aug 2022 | 18 Jul 2024 | 17 Aug 2025 |
| 479 | peckandpartners.net | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 480 | pecosriverantiquemall.com | GoDaddy.com, LLC | 10 Jun 2022 | 22 Jul 2024 | 10 Jun 2024 |
| 481 | pechangahotel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Aug 2004 | 7 Jun 2024 | 21 Aug 2025 |
| 482 | pechenegs.com | eNom, Inc. | 4 Jan 2012 | 23 Jan 2017 | 4 Jan 2018 |
| 483 | pecka.com | eNom, Inc. | 25 May 2005 | 2 Jun 2025 | 25 May 2026 |
| 484 | peckassociates.com | eNom, Inc. | 20 Dec 2010 | 11 Dec 2024 | 20 Dec 2025 |
| 485 | pecam.com | eNom, Inc. | 25 Aug 2007 | 24 Aug 2024 | 25 Aug 2025 |
| 486 | pecanacres.com | eNom, Inc. | 29 Sep 1999 | 26 Sep 2024 | 29 Sep 2025 |
| 487 | pecasagricolas.com | eNom, Inc. | 20 Aug 2010 | 20 Aug 2024 | 20 Aug 2025 |
| 488 | pecetto.com | Regional Network Information Center, JSC dba RU-CE… | 24 Jun 2025 | 24 Jun 2025 | 23 Jun 2026 |
| 489 | pecheaufouet.com | eNom, Inc. | 20 Jan 2011 | 23 Jan 2017 | 20 Jan 2018 |
| 490 | pecamais.com | Google, Inc. | 18 Feb 2025 | 18 Feb 2025 | 18 Feb 2026 |
| 491 | peccatore.com | GoDaddy.com, LLC | 22 Jan 2020 | 5 Feb 2025 | 22 Jan 2026 |
| 492 | peccatori.com | eNom, Inc. | 19 Mar 2009 | 20 Mar 2025 | 19 Mar 2026 |
| 493 | pecesdeacuarios.com | GoDaddy.com, LLC | 14 Jan 2022 | 19 Feb 2025 | 14 Jan 2026 |
| 494 | pecheloisirs.com | eNom, Inc. | 5 Jan 2012 | 10 Jan 2025 | 5 Jan 2026 |
| 495 | pecheresse.com | eNom, Inc. | 11 May 2011 | 21 May 2025 | 11 May 2026 |
| 496 | peckhill.com | TurnCommerce, Inc. DBA NameBright.com | 6 Jul 2019 | 30 Jun 2020 | 6 Jul 2025 |
| 497 | pecoroni.com | eNom, Inc. | 7 Jul 2012 | 11 Jul 2025 | 7 Jul 2026 |
| 498 | peculiarchildren.com | eNom, Inc. | 4 Aug 2012 | 2 Aug 2024 | 4 Aug 2025 |
| 499 | pecyna.com | eNom, Inc. | 8 Sep 2012 | 6 Sep 2024 | 8 Sep 2025 |
| 500 | pecarara.com | GoDaddy.com, LLC | 17 Mar 2025 | 17 Mar 2025 | 17 Mar 2028 |
| 501 | pecasdemotos.com | eNom, Inc. | 18 Jul 2010 | 19 Jul 2025 | 18 Jul 2026 |
| 502 | pecangroveplantation.com | GoDaddy.com, LLC | 16 Apr 2011 | 17 Apr 2024 | 16 Apr 2026 |
| 503 | peccolo.com | GoDaddy.com, LLC | 27 May 2020 | 28 Jun 2025 | 27 May 2026 |
| 504 | pececito.com | eNom, Inc. | 4 Jul 2012 | 11 Jul 2025 | 4 Jul 2026 |
| 505 | pecere.com | eNom, Inc. | 8 Sep 2009 | 6 Sep 2024 | 8 Sep 2025 |
| 506 | pecetem.com | eNom, Inc. | 22 Feb 2011 | 22 Feb 2017 | 22 Feb 2018 |
| 507 | pechau.com | eNom, Inc. | 20 Jun 2012 | 3 Jul 2025 | 20 Jun 2026 |
| 508 | pecs-uk.com | - | 6 Oct 2022 | 7 Nov 2023 | 6 Oct 2023 |
| 509 | pectoralaugmentation.com | Annulet LLC | 24 Apr 2016 | 6 Feb 2017 | 24 Apr 2018 |
| 510 | pecsaperu.com | Tucows Domains Inc. | 26 Oct 2011 | 29 Oct 2014 | 26 Oct 2015 |
| 511 | pecostafeltennis.com | GoDaddy.com, LLC | 28 Oct 2014 | 1 Sep 2016 | 28 Oct 2017 |
| 512 | pecime.com | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Sep 2019 | 9 Sep 2019 | 9 Sep 2020 |
| 513 | pecfarmforsale.com | Tucows Domains Inc. | 25 Oct 2012 | 29 Oct 2018 | 25 Oct 2018 |
| 514 | pecantexas.com | eNom, Inc. | 28 Oct 2014 | 24 Oct 2016 | 28 Oct 2017 |
| 515 | pecanstexas.com | Barracuda Domains, LLC | 5 Apr 2019 | 6 Apr 2019 | 5 Apr 2020 |
| 516 | pecancreekturkeywaddle.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 517 | pecoplan.com | GoDaddy.com, LLC | 13 Jan 2014 | 29 Jun 2015 | 13 Jan 2016 |
| 518 | pecos.tv | eNom, Inc. | 27 Jul 2012 | 4 Aug 2014 | 27 Jul 2015 |
| 519 | pecheu.com | Wild West Domains, LLC | 23 Feb 2014 | 3 Feb 2025 | 23 Feb 2026 |
| 520 | pecandu.com | Go France Domains, LLC | 12 Apr 2015 | 23 Mar 2025 | 12 Apr 2026 |
| 521 | pecadorasdailha.com | GoDaddy.com, LLC | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 522 | pecet.org | CommuniGal Communication Ltd. | 9 Apr 2016 | 6 Sep 2016 | 9 Apr 2017 |
| 523 | pecs.biz | GoDaddy.com, LLC | 2 Nov 2017 | 8 Nov 2024 | 2 Nov 2025 |
| 524 | peckerinspector.com | GoDaddy.com, LLC | 11 Nov 2003 | 13 Apr 2015 | 11 Nov 2015 |
| 525 | pecatto.com | eNom, Inc. | 16 Oct 2009 | 16 Oct 2024 | 16 Oct 2025 |
| 526 | peccio.com | eNom, Inc. | 30 Sep 2011 | 21 Dec 2016 | 30 Sep 2017 |
| 527 | pechenka.com | GoDaddy.com, LLC | 25 Sep 2023 | 19 Nov 2024 | 25 Sep 2025 |
| 528 | peculiars.com | eNom, Inc. | 19 Apr 2009 | 22 Apr 2025 | 19 Apr 2026 |
| 529 | pecertification.com | GoDaddy.com, LLC | 11 Dec 2009 | 21 Nov 2024 | 11 Dec 2025 |
| 530 | peconicriversportsmansclub.net | Squarespace Domains LLC | 15 Jun 2022 | 31 May 2025 | 15 Jun 2026 |
| 531 | pecintaislam.org | Belmontdomains.com LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 532 | pechealacarpe.com | Namesilo, LLC | 9 Aug 2010 | 31 Jul 2024 | 9 Aug 2025 |
| 533 | pecanking.com | GoDaddy.com, LLC | 17 May 2017 | 18 May 2025 | 17 May 2026 |
| 534 | pecadozero.com | GoDaddy.com, LLC | 10 Jun 2011 | 21 May 2025 | 10 Jun 2026 |
| 535 | pecoscabin.com | GoDaddy.com, LLC | 21 Apr 2007 | 30 Jan 2025 | 21 Apr 2026 |
| 536 | pecoshomes.com | GoDaddy.com, LLC | 21 Jun 2010 | 29 May 2025 | 21 Jun 2026 |
| 537 | pecosrentals.com | NameCheap, Inc. | 24 Sep 2024 | 24 Sep 2024 | 24 Sep 2025 |
| 538 | pector.com | GoDaddy.com, LLC | 7 Aug 2000 | 22 Jul 2025 | 7 Aug 2026 |
| 539 | pecebuk.com | GoDaddy.com, LLC | 19 Aug 2013 | 7 Aug 2014 | 19 Aug 2015 |
| 540 | peccavi.info | GoDaddy.com, LLC | 18 Dec 2008 | 29 Jan 2015 | 18 Dec 2015 |
| 541 | peccatu.com | GoDaddy.com, LLC | 30 Jan 2014 | 17 Apr 2015 | 30 Jan 2016 |
| 542 | pecanolla.com | GoDaddy.com, LLC | 3 Nov 2014 | 19 Apr 2015 | 3 Nov 2015 |
| 543 | pecku.com | PSI-USA, Inc. dba Domain Robot | 14 Jul 2010 | 11 Jul 2025 | 14 Jul 2026 |
| 544 | pecplongbeach.com | GoDaddy.com, LLC | 29 Oct 2014 | 19 Feb 2025 | 29 Oct 2025 |
| 545 | pecosriverlandsllc.com | Domain.com, LLC | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2016 |
| 546 | peckofpeppers.com | GoDaddy.com, LLC | 28 Jan 2018 | 5 Dec 2022 | 28 Jan 2028 |
| 547 | pechooin.com | GMO Internet Inc. | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 548 | pechesdeminuit.com | 1&1 Internet AG | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 549 | pecchina.com | - | 24 Jan 2025 | 24 Jan 2025 | 24 Jan 2026 |
| 550 | peckncoo.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Apr 2015 | 27 Jul 2025 | 26 Apr 2026 |
| 551 | pecankings.com | GoDaddy.com, LLC | 7 May 2015 | 8 May 2025 | 7 May 2026 |
| 552 | pecaminoso.com | GoDaddy.com, LLC | 13 Feb 2014 | 13 Jun 2025 | 13 Feb 2026 |
| 553 | pecan-plantation.com | GoDaddy.com, LLC | 8 Nov 2007 | 12 Dec 2023 | 12 Dec 2025 |
| 554 | pechos.org | GoDaddy.com, LLC | 15 Dec 2005 | 1 Dec 2024 | 15 Dec 2025 |
| 555 | peckandlandis.com | GoDaddy.com, LLC | 8 Jun 2006 | 11 May 2015 | 8 Jun 2016 |
| 556 | pecer.com | PSI-USA, Inc. dba Domain Robot | 10 Mar 2010 | 29 Apr 2025 | 10 Mar 2026 |
| 557 | pectate.com | GoDaddy.com, LLC | 10 Oct 2020 | 11 Mar 2025 | 10 Oct 2025 |
| 558 | pecil.com | PSI-USA, Inc. dba Domain Robot | 15 Nov 2002 | 4 Jan 2025 | 15 Nov 2025 |
| 559 | pecin.com | PSI-USA, Inc. dba Domain Robot | 15 Nov 2002 | 4 Jan 2025 | 15 Nov 2025 |
| 560 | pech.net | GoDaddy.com, LLC | 19 May 2014 | 15 May 2025 | 19 May 2026 |
| 561 | pectoreeco.com | GoDaddy.com, LLC | 17 Nov 2014 | 19 Apr 2015 | 17 Nov 2015 |
| 562 | peced.com | PSI-USA, Inc. dba Domain Robot | 27 Apr 2009 | 16 Jun 2025 | 27 Apr 2026 |
| 563 | pecie.com | PSI-USA, Inc. dba Domain Robot | 4 Jun 2009 | 2 Jun 2025 | 4 Jun 2026 |
| 564 | pecdeckmachine.com | GoDaddy.com, LLC | 17 May 2015 | 17 May 2015 | 17 May 2016 |
| 565 | pec-247.com | GoDaddy.com, LLC | 2 Apr 2012 | 14 Apr 2015 | 2 Apr 2016 |
| 566 | pec-24.com | GoDaddy.com, LLC | 2 Apr 2012 | 3 Apr 2014 | 2 Apr 2016 |
| 567 | pec247.com | GoDaddy.com, LLC | 8 Jul 2016 | 8 Jul 2016 | 8 Jul 2017 |
| 568 | pecc24.com | GoDaddy.com, LLC | 27 Apr 2014 | 26 Apr 2015 | 27 Apr 2016 |
| 569 | pecanera.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Jul 2019 | 22 Jul 2019 | 22 Jul 2020 |
| 570 | pecdy.com | PSI-USA, Inc. dba Domain Robot | 5 Jul 2009 | 2 Jul 2025 | 5 Jul 2026 |
| 571 | pecay.com | PSI-USA, Inc. dba Domain Robot | 24 Jun 2008 | 27 Jun 2025 | 24 Jun 2026 |
| 572 | pecro.com | PSI-USA, Inc. dba Domain Robot | 21 Jun 2008 | 27 Jun 2025 | 21 Jun 2026 |
| 573 | pecta.com | PSI-USA, Inc. dba Domain Robot | 31 May 2002 | 30 May 2025 | 31 May 2026 |
| 574 | peconicriversportsmansclub.org | Tucows Domains Inc. | 15 Jun 2022 | 5 Jun 2025 | 15 Jun 2026 |
| 575 | pechatvizitok.pro | Regional Network Information Center, JSC dba RU-CE… | 29 Sep 2010 | 31 Oct 2015 | 29 Sep 2016 |
| 576 | pecc18.org | - | 23 Oct 2024 | 6 Mar 2025 | 23 Oct 2025 |
| 577 | pecandessert.com | Namesilo, LLC | 23 Jun 2009 | 10 Jun 2025 | 23 Jun 2026 |
| 578 | pecadobarroco.com | GoDaddy.com, LLC | 10 Feb 2013 | 2 Feb 2015 | 10 Feb 2016 |
| 579 | pecsol.com | eNom1038, Inc. | 24 Jan 2025 | 17 Mar 2025 | 24 Jan 2026 |
| 580 | pecatu.com | CV. Jogjacamp | 28 Oct 2011 | 16 Jun 2025 | 28 Oct 2025 |
| 581 | pecek.com | PSI-USA, Inc. dba Domain Robot | 13 Apr 2010 | 2 Jun 2025 | 13 Apr 2026 |
| 582 | pecdeck.com | GoDaddy.com, LLC | 8 Sep 2007 | 9 Sep 2023 | 8 Sep 2030 |
| 583 | pechelesford.com | Brandsight, Inc. | 10 Feb 2003 | 10 Jan 2025 | 10 Feb 2026 |
| 584 | pecesdiscos.com | Tucows Domains Inc. | 26 May 2023 | 26 May 2023 | 26 May 2024 |
| 585 | pecpemail.com | Name.com, Inc. | 31 Oct 2014 | 14 Sep 2017 | 31 Oct 2018 |
| 586 | pecpeapp.com | Name.com, Inc. | 31 Oct 2014 | 14 Sep 2017 | 31 Oct 2018 |
| 587 | pecotos.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2017 |
| 588 | pecaserv.com | Instra Corporation Pty Ltd. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 589 | pecanwayapartments.com | GoDaddy.com, LLC | 30 Oct 2014 | 31 Oct 2016 | 30 Oct 2018 |
| 590 | pecanisland.com | Go Australia Domains, LLC | 8 Jan 2010 | 5 Feb 2025 | 8 Jan 2026 |
| 591 | pecansforsale.net | GoDaddy.com, LLC | 1 Feb 2007 | 27 Apr 2015 | 1 Feb 2016 |
| 592 | pecfield-cochrane.org | 1API GmbH | 2 Feb 2016 | 24 Mar 2017 | 2 Feb 2018 |
| 593 | peceodusi.net | Namesilo, LLC | 22 Mar 2023 | 19 Mar 2025 | 22 Mar 2026 |
| 594 | pecay.info | Dynadot, LLC | 1 Nov 2021 | 1 Nov 2023 | 1 Nov 2024 |
| 595 | pecatonicafire.org | 1&1 Internet AG | 23 May 2025 | 28 May 2025 | 23 May 2026 |
| 596 | pecaproject.org | GoDaddy.com, LLC | 24 Oct 2024 | 29 Oct 2024 | 24 Oct 2025 |
| 597 | pecig.com | GoDaddy.com, LLC | 23 Jun 2013 | 23 Jun 2025 | 23 Jun 2026 |
| 598 | pec-ontario.ca | - | - | - | - |
| 599 | pec-ontario.com | GoDaddy.com, LLC | 31 Dec 2013 | 4 May 2015 | 31 Dec 2015 |
| 600 | pecaw.com | GoDaddy.com, LLC | 29 Jan 2021 | 14 May 2025 | 29 Jan 2026 |
| 601 | pecete.org | GoDaddy.com, LLC | 26 May 2015 | 11 May 2025 | 26 May 2026 |
| 602 | peconicpublicadjusters.com | GoDaddy.com, LLC | 31 Oct 2014 | 1 Nov 2016 | 31 Oct 2017 |
| 603 | pechismoney.com | eNom, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 604 | pecesacuarios.com | Promo People inc. | 15 Feb 2022 | 27 Apr 2023 | 15 Feb 2023 |
| 605 | pecbuilt.com | GoDaddy.com, LLC | 31 Oct 2014 | 1 Nov 2024 | 31 Oct 2025 |
| 606 | pecz.com | GoDaddy.com, LLC | 8 Apr 2003 | 16 Apr 2025 | 8 Apr 2031 |
| 607 | pecangroup.org | GoDaddy.com, LLC | 29 Mar 2009 | 13 May 2025 | 29 Mar 2026 |
| 608 | peckings.com | Azprivatez LLC | 12 Aug 2015 | 27 Sep 2024 | 12 Aug 2025 |
| 609 | pecok.com | GoDaddy.com, LLC | 5 Apr 2007 | 3 Jun 2025 | 5 Apr 2026 |
| 610 | pecangrove.org | Wild West Domains, LLC | 23 Aug 1999 | 7 Oct 2024 | 23 Aug 2026 |
| 611 | pecutx.org | GoDaddy.com, LLC | 24 Jan 2000 | 13 May 2025 | 24 Jan 2026 |
| 612 | peconicbayautobody.com | eNom, Inc. | 6 Apr 2001 | 25 Mar 2017 | 6 Apr 2018 |
| 613 | pecangrovecemetery.com | GoDaddy.com, LLC | 3 Jun 2010 | 15 Jul 2025 | 3 Jun 2025 |
| 614 | peces.co | GoDaddy.com, LLC | 20 Jul 2010 | 1 May 2017 | 19 Jul 2019 |
| 615 | pecanisland.net | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 29 Nov 2024 | 29 Nov 2024 | 29 Nov 2025 |
| 616 | pecansheller.com | GoDaddy.com, LLC | 25 Jan 2002 | 16 Apr 2025 | 25 Jan 2031 |
| 617 | peckaeroplanerestoration.com | FastDomain Inc. | 21 Mar 2002 | 7 Mar 2025 | 21 Mar 2026 |
| 618 | peckhannafordbriggs.com | GoDaddy.com, LLC | 29 Oct 1998 | 30 Sep 2024 | 28 Oct 2031 |
| 619 | pechtree.com | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Jan 2022 | 29 Jan 2022 | 29 Jan 2023 |
| 620 | pechemouchefrance.com | Name Find Source LLC | 24 Jun 2023 | 25 Jun 2025 | 24 Jun 2026 |
| 621 | pecasolighting.com | DropCatch.com 556 LLC | 1 Sep 2024 | 2 Sep 2024 | 1 Sep 2025 |
| 622 | pecksseafood.com | Wild West Domains, LLC | 26 May 2011 | 21 Sep 2022 | 26 May 2031 |
| 623 | peckmusic.com | Google, Inc. | 9 Jul 2013 | 24 Jun 2025 | 9 Jul 2026 |
| 624 | pecuniarily.com | GoDaddy.com, LLC | 2 Dec 2011 | 6 Dec 2024 | 2 Dec 2025 |
| 625 | pecf.com | GoDaddy.com, LLC | 30 Apr 2005 | 10 Mar 2025 | 30 Apr 2026 |
| 626 | pecanlakesgolfclub.net | 1API GmbH | 13 Aug 2013 | 14 Aug 2024 | 13 Aug 2025 |
| 627 | peconicmarble.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Dec 2006 | 23 Nov 2016 | 14 Dec 2017 |
| 628 | pecangrovervresort.com | Porkbun, LLC | 1 Jan 2013 | 1 Dec 2024 | 1 Jan 2026 |
| 629 | pecorilawyers.com | GoDaddy.com, LLC | 15 Sep 2005 | 16 Sep 2024 | 15 Sep 2025 |
| 630 | pectus.org | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 22 Feb 2001 | 18 Feb 2025 | 22 Feb 2026 |
| 631 | pecy.net | GoDaddy.com, LLC | 28 Oct 2012 | 28 Oct 2024 | 28 Oct 2025 |
| 632 | peculiarnationinchrist.org | Name.com, Inc. | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 633 | pechest.us | eNom, Inc. | 30 Oct 2014 | 30 Oct 2014 | 29 Oct 2015 |
| 634 | pecostrails.com | - | - | - | - |
| 635 | pectora.com | GoDaddy.com, LLC | 18 Apr 2017 | 14 Feb 2024 | 18 Apr 2026 |
| 636 | pecosmartideas.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 15 Nov 2024 | 16 Nov 2024 | 15 Nov 2025 |
| 637 | peck.biz | GoDaddy.com, LLC | 30 Jul 2018 | 14 Nov 2018 | 30 Jul 2019 |
| 638 | pecannutbusters.com | register.com, Inc. | 18 Feb 2011 | 19 Jan 2025 | 18 Feb 2026 |
| 639 | pecofasteners.com | Wild West Domains, LLC | 4 Nov 1997 | 5 Sep 2023 | 2 Nov 2028 |
| 640 | peconicstarfleet.com | GoDaddy.com, LLC | 28 Apr 2010 | 10 May 2025 | 28 Apr 2026 |
| 641 | pecanlandmall.com | GoDaddy.com, LLC | 19 Mar 1997 | 5 May 2025 | 20 Mar 2026 |
| 642 | pecksbeesupplies.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Aug 2010 | 25 Jul 2017 | 29 Aug 2018 |
| 643 | peckovers.com | TurnCommerce, Inc. DBA NameBright.com | 12 Apr 2020 | 6 Apr 2021 | 12 Apr 2026 |
| 644 | pecheaucoupmagazine.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Mar 2008 | 24 Feb 2017 | 21 Mar 2018 |
| 645 | pectelusa.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Apr 2000 | 5 Apr 2017 | 13 Apr 2018 |
| 646 | pecocamping.com | enom425, Incorporated | 11 Sep 2024 | 12 May 2025 | 11 Sep 2025 |
| 647 | pecksflooring-america.com | GoDaddy.com, LLC | 5 Nov 2008 | 7 Mar 2025 | 5 Nov 2026 |
| 648 | pecanlodge.com | GoDaddy.com, LLC | 19 Nov 2008 | 8 Dec 2024 | 19 Nov 2029 |
| 649 | peche-en-thailande.com | Steamline Domains, LLC | 22 Sep 2024 | 25 Sep 2024 | 22 Sep 2025 |
| 650 | pecefficiency.com | GoDaddy.com, LLC | 12 Jun 2012 | 1 Feb 2025 | 31 Jan 2026 |
| 651 | peck.com | NameCheap, Inc. | 17 Feb 1992 | 22 Jun 2024 | 26 Oct 2026 |
| 652 | pecosabbey.org | NameCheap, Inc. | 27 Jun 2025 | 27 Jun 2025 | 27 Jun 2026 |
| 653 | pecksniffs.com | GoDaddy.com, LLC | 13 Jul 1999 | 7 Jul 2025 | 13 Jul 2026 |
| 654 | pecosriverbrass.com | Network Solutions, LLC | 17 Jan 2000 | 14 Jun 2024 | 17 Jan 2026 |
| 655 | peche-passion-17.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Mar 2012 | 24 Jun 2014 | 11 Mar 2016 |
| 656 | peckandgartner.com | Wild West Domains, LLC | 1 Oct 2021 | 2 Oct 2024 | 1 Oct 2025 |
| 657 | pecheurmarocain.com | GoDaddy.com, LLC | 20 Mar 2017 | 20 Mar 2017 | 20 Mar 2018 |
| 658 | pechanga-nsn.gov | - | - | - | - |
| 659 | pecetegetir.com | ChocolateChipDomains, LLC | 23 Jun 2024 | 26 Jun 2025 | 23 Jun 2026 |
| 660 | pechcare.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Aug 2006 | 25 Jul 2017 | 19 Aug 2018 |
| 661 | pectphoto.com | Dynadot, LLC | 2 Nov 2014 | 12 Dec 2023 | 2 Nov 2023 |
| 662 | pectm.com | HiChina Zhicheng Technology Limited | 31 Dec 2020 | 14 Dec 2023 | 31 Dec 2025 |
| 663 | peclouds.com | GoDaddy.com, LLC | 6 Oct 2016 | 7 Oct 2024 | 6 Oct 2025 |
| 664 | pecetehazirla.com | register.com, Inc. | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 665 | pecascitycom.com | eNom, Inc. | 1 Nov 2014 | 18 Oct 2016 | 1 Nov 2017 |
| 666 | pecofacet.com | Key-Systems GmbH | 29 Oct 2007 | 28 Sep 2024 | 29 Oct 2025 |
| 667 | pecavidro.pt | - | - | - | 11 Jan 2026 |
| 668 | pecheur.co | Key-Systems GmbH | 10 Sep 2020 | 20 Sep 2024 | 10 Sep 2025 |
| 669 | pecaa-sites.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Nov 2023 | 7 Dec 2024 | 12 Nov 2025 |
| 670 | peckycypressdepot.com | Media Elite Holdings Limited | 5 Feb 2021 | 5 Feb 2021 | 5 Feb 2022 |
| 671 | pecanstore.com | GoDaddy.com, LLC | 16 Jul 1999 | 4 Sep 2022 | 18 Feb 2026 |
| 672 | peckenpaughs.com | Realtime Register B.V. | 10 Nov 2022 | 24 Nov 2023 | 10 Nov 2023 |
| 673 | pecourses.com | NameCheap, Inc. | 15 May 2022 | 16 Apr 2025 | 15 May 2026 |
| 674 | pecansunlimited.com | GoDaddy.com, LLC | 19 Jul 1998 | 18 Jul 2025 | 18 Jul 2026 |
| 675 | peconicenergy.com | Tucows Domains Inc. | 5 Aug 2005 | 21 Jul 2025 | 5 Aug 2026 |
| 676 | peculiarparkplacervpark.com | GoDaddy.com, LLC | 2 Mar 2005 | 10 Mar 2025 | 2 Mar 2030 |
| 677 | pecklife.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Aug 2024 | 9 Aug 2024 | 9 Aug 2025 |
| 678 | pecompany.net | Google, Inc. | 19 Oct 2020 | 19 Oct 2020 | 19 Oct 2021 |
| 679 | pecantle.net | Dynadot, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 680 | pecah.com | TurnCommerce, Inc. DBA NameBright.com | 30 May 2014 | 24 May 2021 | 30 May 2026 |
| 681 | peckish.net | GoDaddy.com, LLC | 18 Dec 2010 | 19 Dec 2024 | 18 Dec 2025 |
| 682 | pecva.info | GoDaddy.com, LLC | 1 Nov 2014 | 2 Nov 2019 | 1 Nov 2020 |
| 683 | pecvacationrental.com | Names On The Drop LLC | 1 May 2023 | 14 Jun 2024 | 1 May 2024 |
| 684 | peculiarinteriors.com | Tucows Domains Inc. | 21 Jul 2016 | 25 Jul 2019 | 21 Jul 2019 |
| 685 | peckprivateclient.com | Wix.com Ltd. | 16 May 2022 | 17 May 2025 | 16 May 2026 |
| 686 | pecura.com | TurnCommerce, Inc. DBA NameBright.com | 25 Aug 1999 | 15 Jan 2020 | 25 Aug 2025 |
| 687 | peculiarsms.com | Namesilo, LLC | 6 Jul 2018 | 8 Sep 2018 | 6 Jul 2019 |
| 688 | pecapeca.com | Google, Inc. | 5 Jan 2022 | 21 Dec 2024 | 5 Jan 2026 |
| 689 | peconicstarboats.com | GoDaddy.com, LLC | 1 Apr 2014 | 1 Apr 2025 | 1 Apr 2026 |
| 690 | pecan-grove.net | Network Solutions, LLC | 21 Oct 2008 | 22 Aug 2022 | 21 Oct 2027 |
| 691 | pecancottage.com | GoDaddy.com, LLC | 29 Oct 2024 | 29 Oct 2024 | 29 Oct 2025 |
| 692 | pecados.mx | Dynadot, LLC | 8 Mar 2014 | 3 Apr 2015 | 8 Mar 2016 |
| 693 | peculiarhealth.com | NameCheap, Inc. | 11 Feb 2025 | 11 Feb 2025 | 11 Feb 2026 |
| 694 | pechini.com | Regional Network Information Center, JSC dba RU-CE… | 22 Oct 2014 | 26 Nov 2024 | 22 Oct 2025 |
| 695 | pecheauxgrosreunion.com | - | - | - | - |
| 696 | pecheaugrosreunion.com | OVH sas | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 697 | peche-aux-gros-reunion.com | OVH sas | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 698 | peche-au-gros-reunion.com | OVH sas | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 699 | pecademy.com | NameCheap, Inc. | 2 Nov 2014 | 4 Nov 2024 | 2 Nov 2025 |
| 700 | pecanplacepoodlesandpoos.com | GoDaddy.com, LLC | 30 Sep 2008 | 25 Jun 2025 | 30 Sep 2027 |
| 701 | pecanplantation.com | Network Solutions, LLC | 10 Apr 2000 | 13 Feb 2023 | 10 Apr 2028 |
| 702 | pecheleshonda.com | GoDaddy.com, LLC | 24 Feb 2010 | 24 Feb 2025 | 24 Feb 2026 |
| 703 | pechostiernos.net | NetEarth One Inc. d/b/a NetEarth | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 704 | pecia.org | GoDaddy.com, LLC | 2 Jun 2018 | 17 Jul 2025 | 2 Jun 2026 |
| 705 | peckedtodeathbychickens.com | GMO Internet Inc. | 12 Sep 2022 | 24 Nov 2023 | 12 Sep 2023 |
| 706 | peckfuneralhome.com | GoDaddy.com, LLC | 23 Oct 2000 | 9 Jun 2025 | 23 Oct 2025 |
| 707 | peckkia.com | CSC Corporate Domains, Inc. | 30 Mar 2005 | 26 Mar 2025 | 30 Mar 2026 |
| 708 | peconicstar.com | GoDaddy.com, LLC | 5 Mar 2025 | 26 May 2025 | 5 Mar 2027 |
| 709 | pecosvalleycowboychurch.org | GoDaddy.com, LLC | 26 Feb 2010 | 12 Apr 2025 | 26 Feb 2026 |
| 710 | pechorin.com | Amazon Registrar, Inc. | 8 May 2001 | 3 Apr 2025 | 8 May 2026 |
| 711 | pec517.com | Namesilo, LLC | 31 May 2018 | 31 May 2018 | 31 May 2019 |
| 712 | pecos.net | GKG.NET, INC. | 1 Jul 1996 | 2 Mar 2023 | 30 Jun 2026 |
| 713 | pecosnorth.com | GoDaddy.com, LLC | 9 Jun 2003 | 10 Jun 2015 | 9 Jun 2016 |
| 714 | peconicproperties.com | GoDaddy.com, LLC | 25 May 2016 | 22 Sep 2022 | 25 May 2026 |
| 715 | peci.com | Network Solutions, LLC | 8 Nov 1994 | 8 Sep 2023 | 7 Nov 2026 |
| 716 | peculiarprintables.com | Name.com, Inc. | 10 Jun 2014 | 8 Jun 2017 | 10 Jun 2018 |
| 717 | pecva.org | GKG.NET, INC. | 21 Jul 1999 | 27 May 2025 | 21 Jul 2028 |
| 718 | peculiararquitetura.com | Network Solutions, LLC | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 719 | pechin.com | GoDaddy.com, LLC | 19 Nov 1999 | 22 Jul 2024 | 19 Nov 2025 |
| 720 | pecsia.us | - | 1 Nov 2014 | - | 31 Oct 2015 |
| 721 | peckhamarchitects-arcatacaarchitect.com | GoDaddy.com, LLC | 11 Jun 2013 | 11 Jun 2015 | 11 Jun 2016 |
| 722 | pechay.com | GoDaddy.com, LLC | 10 Jun 2012 | 21 May 2025 | 10 Jun 2026 |
| 723 | pecsporthorses.com | Network Solutions, LLC | 13 Mar 2000 | 19 Mar 2024 | 13 Mar 2034 |
| 724 | peckhamarchitects-fortunacaarchitect.com | GoDaddy.com, LLC | 10 Jun 2013 | 11 Jun 2015 | 10 Jun 2016 |
| 725 | peckhamarchitects-mckinleyvillecaarchitect.com | GoDaddy.com, LLC | 10 Jun 2013 | 11 Jun 2015 | 10 Jun 2016 |
| 726 | peckhamarchitects-eurekacaarchitect.com | GoDaddy.com, LLC | 10 Jun 2013 | 11 Jun 2015 | 10 Jun 2016 |
| 727 | peckservices.com | GoDaddy.com, LLC | 2 Nov 1998 | 1 Nov 2024 | 1 Nov 2025 |
| 728 | pecdata.com | GoDaddy.com, LLC | 18 Jul 2012 | 19 Jul 2025 | 18 Jul 2026 |
| 729 | pecanoil.com | GoDaddy.com, LLC | 6 Oct 2004 | 6 Oct 2024 | 6 Oct 2025 |
| 730 | pecancreeklodge.net | GoDaddy.com, LLC | 21 Nov 2016 | 6 Dec 2024 | 21 Nov 2025 |
| 731 | pecunem.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 12 Mar 2025 | 12 Mar 2025 | 12 Mar 2026 |
| 732 | pecoslodging.com | GoDaddy.com, LLC | 3 Nov 2014 | 4 Nov 2024 | 3 Nov 2025 |
| 733 | peckmouse.com | eNom, Inc. | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 734 | pecinawedding.com | Network Solutions, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 735 | peceteyihazirla.com | 1&1 Internet AG | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 736 | pecasautosusadas.com | 1&1 Internet AG | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 737 | pecefi.eu | eNom, Inc. | - | - | - |
| 738 | pecasgenuinas.com.br | - | - | - | - |
| 739 | pecand.com | GoDaddy.com, LLC | 4 Oct 2017 | 12 Jul 2025 | 4 Oct 2025 |
| 740 | pecsafety.com | GoDaddy.com, LLC | 16 Oct 2011 | 17 Oct 2024 | 16 Oct 2025 |
| 741 | pectapure.com | eNom, Inc. | 21 Sep 2018 | 4 Dec 2024 | 21 Sep 2024 |
| 742 | pecanbox.com | GoDaddy.com, LLC | 15 Dec 2021 | 13 Dec 2024 | 15 Dec 2025 |
| 743 | pecanpointfarm.com | Media Elite Holdings Limited | 2 Jul 2020 | 5 Jul 2024 | 2 Jul 2026 |
| 744 | pecometh.org | Network Solutions, LLC | 13 Jan 2000 | 26 Oct 2024 | 13 Jan 2026 |
| 745 | peck-tuneski.com | Network Solutions, LLC | 24 Dec 1997 | 24 Dec 2019 | 23 Dec 2029 |
| 746 | pecosleague.com | GoDaddy.com, LLC | 4 Jul 2010 | 5 Jul 2025 | 4 Jul 2026 |
| 747 | peckham.org | Network Solutions, LLC | 29 Apr 1998 | 27 Feb 2021 | 28 Apr 2026 |
| 748 | pecans.com | GoDaddy.com, LLC | 30 May 1996 | 4 Oct 2023 | 29 May 2031 |
| 749 | peculiarcemetery.org | Network Solutions, LLC | 17 Oct 2013 | 22 Sep 2024 | 17 Oct 2025 |
| 750 | peckandassociates.com | register.com, Inc. | 6 May 2002 | 8 May 2025 | 6 May 2028 |
| 751 | pecosbillboots.com | GoDaddy.com, LLC | 19 Jun 2013 | 2 Jan 2025 | 19 Jun 2026 |
| 752 | pecschools.org | Key-Systems GmbH | 8 Apr 2009 | 23 May 2025 | 8 Apr 2026 |
| 753 | pecocarwash.com | Network Solutions, LLC | 16 Jan 1997 | 18 Nov 2024 | 17 Jan 2030 |
| 754 | peckcpa.com | Network Solutions, LLC | 4 Dec 1997 | 7 Dec 2024 | 3 Dec 2029 |
| 755 | pechmerle.com | OVH sas | 21 Mar 2002 | 22 Mar 2024 | 21 Mar 2025 |
| 756 | pecanwarehouse.com | GoDaddy.com, LLC | 26 Jun 2022 | 27 Jun 2025 | 26 Jun 2026 |
| 757 | peccalendar.org | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 10 May 2008 | 22 Jan 2017 | 10 May 2018 |
| 758 | peckdaniel.com | GoDaddy.com, LLC | 24 Jan 2001 | 25 Jan 2025 | 24 Jan 2027 |
| 759 | pecanpierecipe.com | Epik Inc. | 28 Dec 2001 | 5 Feb 2025 | 28 Dec 2025 |
| 760 | pecunify.com | Crazy Domains FZ-LLC | 5 Nov 2014 | 16 Oct 2023 | 5 Nov 2025 |
| 761 | peculiarvibz.com | Tucows Domains Inc. | 4 Nov 2014 | 8 Nov 2015 | 4 Nov 2016 |
| 762 | peculiarsound.com | Wix.com Ltd. | 19 Sep 2023 | 20 Aug 2024 | 19 Sep 2025 |
| 763 | peckulatorx.com | Tucows Domains Inc. | 1 Nov 2011 | 5 Nov 2014 | 1 Nov 2015 |
| 764 | peckcloths.com | GKG.NET, INC. | 8 Feb 2023 | 19 Feb 2024 | 8 Feb 2024 |
| 765 | pecintakaos.com | TLD Registrar Solutions Ltd. | 3 Nov 2014 | 5 Nov 2014 | 3 Nov 2015 |
| 766 | pechyvo.com | OnlineNIC, Inc. | 15 Jul 2022 | 24 Aug 2023 | 15 Jul 2023 |
| 767 | pechico.com | Namesilo, LLC | 2 Aug 2019 | 3 Aug 2019 | 2 Aug 2020 |
| 768 | pechenauvergne.com | PSI-USA, Inc. dba Domain Robot | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 769 | peche-au-carnassier.com | OVH sas | 24 Oct 2024 | 24 Oct 2024 | 24 Oct 2025 |
| 770 | pecclips.com | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2016 |
| 771 | peccavi-fashion.com | Mesh Digital Limited | 29 Jan 2014 | 5 Nov 2014 | 29 Jan 2016 |
| 772 | pecan-street.com | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2016 |
| 773 | pec-kuroda.com | DropCatch.com 494 LLC | 12 Sep 2020 | 12 Sep 2020 | 12 Sep 2021 |
| 774 | pec-huberitalia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 23 Oct 2024 | 4 Nov 2025 |
| 775 | peck-polymers.com | GoDaddy.com, LLC | 27 Jan 1999 | 28 Jan 2025 | 27 Jan 2026 |
| 776 | pecknelmusic.com | Network Solutions, LLC | 28 Nov 1997 | 5 Dec 2023 | 27 Nov 2027 |
| 777 | pecangrovefamilydentist.com | Brandsight, Inc. | 20 Jul 2014 | 19 Jun 2025 | 20 Jul 2026 |
| 778 | peckandco.com | GoDaddy.com, LLC | 5 Jan 2012 | 6 Jan 2025 | 5 Jan 2026 |
| 779 | pecpantherlive.com | GoDaddy.com, LLC | 22 Sep 2007 | 21 May 2025 | 22 Sep 2025 |
| 780 | peckahentas.com | GoDaddy.com, LLC | 12 Jun 2009 | 13 Jun 2015 | 12 Jun 2016 |
| 781 | pecasyfresas.co | GoDaddy.com, LLC | 13 Jun 2014 | 18 Jun 2015 | 12 Jun 2015 |
| 782 | peckandperch.com | 1&1 Internet AG | 20 Jul 2022 | 20 Jul 2022 | 20 Jul 2026 |
| 783 | pecspersonalfitness.info | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 784 | peceanlig.com | Network Solutions, LLC | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 785 | peck12.com | Gabia, Inc. | 18 Aug 2014 | 23 Aug 2015 | 18 Aug 2016 |
| 786 | peck77.com | Gabia, Inc. | 18 Aug 2014 | 23 Aug 2015 | 18 Aug 2016 |
| 787 | peckhamgourmand.com | 1API GmbH | 6 Nov 2020 | 6 Nov 2020 | 6 Nov 2021 |
| 788 | peckhamgourmand.net | 1&1 Internet AG | 18 Aug 2014 | 18 Aug 2016 | 18 Aug 2017 |
| 789 | pecia-eg.com | GoDaddy.com, LLC | 12 Jun 2014 | 13 Jun 2015 | 12 Jun 2016 |
| 790 | peconiclaneadvisory.com | GoDaddy.com, LLC | 12 Jun 2013 | 13 Jun 2015 | 12 Jun 2016 |
| 791 | peckylicious.com | Wild West Domains, LLC | 14 Jun 2013 | 15 Jun 2015 | 14 Jun 2016 |
| 792 | pecinaslawnandlandscapellc.com | GoDaddy.com, LLC | 14 Jun 2014 | 15 Jun 2015 | 14 Jun 2016 |
| 793 | pechinchando.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jan 2020 | 24 Dec 2024 | 24 Jan 2026 |
| 794 | peculasio.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 795 | peckersuckers.com | Google, Inc. | 22 Jul 2021 | 22 Jul 2021 | 22 Jul 2022 |
| 796 | pecker-johnson.com | NameCheap, Inc. | 5 Nov 2014 | 6 Oct 2024 | 5 Nov 2025 |
| 797 | peckandpepper.com | GoDaddy.com, LLC | 6 Nov 2014 | 7 Nov 2024 | 6 Nov 2025 |
| 798 | peche-savoyarde.com | OVH sas | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 799 | pec-pratocorde.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Nov 2014 | 23 Oct 2024 | 5 Nov 2025 |
| 800 | pecwineservices.com | GoDaddy.com, LLC | 16 Jun 2014 | 17 Jun 2015 | 16 Jun 2016 |
| 801 | peckydill.com | GoDaddy.com, LLC | 16 Jun 2014 | 17 Jun 2015 | 16 Jun 2016 |
| 802 | peconicbaysaltwatertaffy.com | GoDaddy.com, LLC | 17 Jun 2014 | 18 Jun 2015 | 17 Jun 2016 |
| 803 | pecanridgeapts.com | Brandsight, Inc. | 1 Mar 2022 | 22 Nov 2024 | 1 Mar 2026 |
| 804 | pecaojeans.com | GoDaddy.com, LLC | 3 Jun 2022 | 15 Aug 2024 | 3 Jun 2024 |
| 805 | pecasimports.com | GoDaddy.com, LLC | 23 May 2019 | 4 Jul 2024 | 23 May 2024 |
| 806 | peccarita.com | GMO Internet Inc. | 13 Nov 2016 | 14 Sep 2017 | 13 Nov 2018 |
| 807 | peccataminutabistro.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 808 | peccleaners.com | GoDaddy.com, LLC | 18 Aug 2014 | 11 Aug 2024 | 18 Aug 2025 |
| 809 | pecegroup.com | HiChina Zhicheng Technology Limited | 27 Apr 2021 | 28 Apr 2024 | 27 Apr 2025 |
| 810 | pechehautespyrenees.com | Wix.com Ltd. | 2 Jul 2020 | 25 Jun 2024 | 2 Jul 2026 |
| 811 | pechesmignons.net | PSI-USA, Inc. dba Domain Robot | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 812 | pecoschoolsurvey.com | - | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2017 |
| 813 | peconicbayseasalt.com | Launchpad, Inc. | 3 May 2016 | 18 Apr 2017 | 3 May 2018 |
| 814 | pecoramotorsport.com | GoDaddy.com, LLC | 17 Jun 2009 | 18 Jun 2015 | 17 Jun 2016 |
| 815 | peccifamily.com | GoDaddy.com, LLC | 18 Jun 2007 | 19 Jun 2015 | 18 Jun 2016 |
| 816 | peckvilleflowers.com | GoDaddy.com, LLC | 18 Jun 2010 | 19 Jun 2015 | 18 Jun 2016 |
| 817 | pecoualmonds.com | GoDaddy.com, LLC | 18 Jun 2013 | 19 Jun 2015 | 18 Jun 2016 |
| 818 | pecogoodshepherd.com | GoDaddy.com, LLC | 19 Jun 2011 | 20 Jun 2015 | 19 Jun 2016 |
| 819 | peckerheadwine.com | GoDaddy.com, LLC | 25 Nov 2005 | 17 Mar 2015 | 17 Apr 2016 |
| 820 | peckhamproperty.com | TurnCommerce, Inc. DBA NameBright.com | 15 May 2017 | 26 Jul 2025 | 15 May 2025 |
| 821 | pecr.com | Dynadot, LLC | 19 Jul 2011 | 28 Aug 2024 | 19 Jul 2026 |
| 822 | pechanz.com | Mesh Digital Limited | 19 Aug 2014 | 18 Aug 2024 | 19 Aug 2025 |
| 823 | peche-truites.com | OVH sas | 19 Aug 2014 | 20 Aug 2024 | 19 Aug 2025 |
| 824 | peckenstv.com | Web Commerce Communications Limited dba WebNic.cc | 6 Feb 2020 | 29 Jan 2025 | 6 Feb 2026 |
| 825 | pecorasescorts.com | GoDaddy.com, LLC | 11 Feb 2020 | 7 Jun 2025 | 11 Feb 2026 |
| 826 | pecqueur.org | OVH sas | 14 Aug 2009 | 14 Jul 2024 | 14 Aug 2027 |
| 827 | peculi.com | GoDaddy.com, LLC | 19 Aug 2014 | 20 Aug 2024 | 19 Aug 2025 |
| 828 | pecspersonalfitness.org | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 829 | pecspersonalfitness.net | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 830 | peccadillo.net | Porkbun, LLC | 25 Jul 2023 | 6 Sep 2024 | 25 Jul 2024 |
| 831 | pecaminosos.com | GoDaddy.com, LLC | 15 Mar 2019 | 15 Mar 2019 | 15 Mar 2020 |
| 832 | pecangrovecafe.com | GoDaddy.com, LLC | 24 Jun 2015 | 30 Jun 2025 | 24 Jun 2027 |
| 833 | pecheondesign.com | 1&1 Internet AG | 24 Jun 2015 | 25 Jun 2016 | 24 Jun 2018 |
| 834 | pechriandev.com | NameCheap, Inc. | 24 Jun 2015 | 25 Jun 2025 | 24 Jun 2026 |
| 835 | pecindustries.com | TurnCommerce, Inc. DBA NameBright.com | 26 Jun 2019 | 26 Jul 2025 | 26 Jun 2025 |
| 836 | pecirooms.com | eNom, Inc. | 19 Aug 2023 | 30 Sep 2024 | 19 Aug 2024 |
| 837 | pecopteris.com | TurnCommerce, Inc. DBA NameBright.com | 12 Sep 2018 | 22 Oct 2024 | 12 Sep 2024 |
| 838 | pecorinowines.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 839 | pecuariadeprecision.com | Gandi SAS | 17 Jul 2025 | 17 Jul 2025 | 17 Jul 2026 |
| 840 | pecwine.com | Squarespace Domains LLC | 1 Jul 2023 | 16 Jun 2025 | 1 Jul 2026 |
| 841 | pecwines.com | Google, Inc. | 16 Jan 2023 | 26 Apr 2024 | 16 Jan 2028 |
| 842 | pecansforsale.biz | Domain.com, LLC | 6 Nov 2014 | 26 Oct 2017 | 5 Nov 2018 |
| 843 | pecadovotardemocrata.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2016 | 20 Aug 2017 |
| 844 | pecanparkthemovie.com | register.com, Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 845 | pecdrilling.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 846 | peceto.com | Tucows Domains Inc. | 21 Aug 2014 | 20 Aug 2024 | 21 Aug 2025 |
| 847 | pechibella.com | GMO Internet Inc. | 2 Apr 2023 | 14 May 2024 | 2 Apr 2024 |
| 848 | peckerwood.org | GoDaddy.com, LLC | 9 Aug 2023 | 28 Aug 2024 | 9 Aug 2026 |
| 849 | peckhealth.com | CSC Corporate Domains, Inc. | 12 Sep 2020 | 14 Aug 2024 | 12 Sep 2025 |
| 850 | pectrading.com | GoDaddy.com, LLC | 23 May 2017 | 24 May 2025 | 23 May 2026 |
| 851 | peculiarosities.com | GoDaddy.com, LLC | 13 Feb 2020 | 13 Feb 2020 | 13 Feb 2021 |
| 852 | pecode.com | Vitalwerks Internet Solutions, LLC DBA No-IP | 13 Mar 2016 | 17 Feb 2025 | 14 Mar 2026 |
| 853 | pecmv.com | Gandi SAS | 7 Nov 2014 | 3 Oct 2016 | 7 Nov 2017 |
| 854 | peckstation.com | GoDaddy.com, LLC | 6 Nov 2014 | 19 Apr 2015 | 6 Nov 2017 |
| 855 | pecksfaced.com | Google, Inc. | 14 Jun 2019 | 14 Jun 2019 | 14 Jun 2020 |
| 856 | pechuer.com | GoDaddy.com, LLC | 16 Nov 2018 | 16 Nov 2018 | 16 Nov 2019 |
| 857 | pecher-online.com | 1&1 Internet AG | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 858 | pechebrown.com | Marcaria.com International, Inc. | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 859 | pechatikiev.com | OnlineNIC, Inc. | 6 Nov 2014 | 31 Oct 2024 | 6 Nov 2025 |
| 860 | pecansforsaleonline.com | Domain.com, LLC | 6 Nov 2014 | 22 Oct 2017 | 6 Nov 2018 |
| 861 | pecadofino.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 862 | pec-vertrieb.com | Tucows Domains Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 863 | pecheur-maroc.com | Tucows Domains Inc. | 9 Jan 2014 | 13 Jan 2016 | 9 Jan 2017 |
| 864 | peckery.com | NameCheap, Inc. | 6 Jul 2016 | 4 Jan 2025 | 6 Jul 2026 |
| 865 | pecnfp.com | 1&1 Internet AG | 13 Jan 2015 | 13 Jan 2017 | 13 Jan 2018 |
| 866 | pecquet.net | Gandi SAS | 11 Jan 2001 | 10 Jan 2025 | 11 Jan 2026 |
| 867 | pecuariapeninsular.com | Network Information Center Mexico, S.C. | 12 Jan 2015 | 13 Jan 2018 | 12 Jan 2018 |
| 868 | peculiarcookie.com | eNom, Inc. | 13 Jan 2015 | 29 Dec 2016 | 13 Jan 2018 |
| 869 | peculiarheritagephotography.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 870 | pec-homes.com | Wild West Domains, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 871 | pecheaugrosilemaurice.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Aug 2024 | 21 Aug 2025 |
| 872 | pecicilan.com | CV. Jogjacamp | 23 Jul 2022 | 29 Sep 2023 | 23 Jul 2023 |
| 873 | peckishblog.com | Google, Inc. | 2 Jan 2023 | 3 Mar 2024 | 2 Jan 2024 |
| 874 | pecks.info | NameCheap, Inc. | 4 Jul 2025 | 4 Jul 2025 | 4 Jul 2026 |
| 875 | pecl-solutions.com | BigRock Solutions Ltd. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 876 | pecoswellnesscenter.com | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 877 | pecsaconstuctora.com | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 878 | pecsmedicaluniversity.info | - | 19 May 2023 | 30 Jun 2024 | 19 May 2024 |
| 879 | pecanlumber.com | GoDaddy.com, LLC | 6 Feb 2015 | 7 Feb 2025 | 6 Feb 2026 |
| 880 | pecanmantels.com | GoDaddy.com, LLC | 6 Feb 2015 | 7 Feb 2025 | 6 Feb 2026 |
| 881 | pecc-kenya.org | Network Solutions, LLC | 6 Feb 2015 | 3 Feb 2025 | 6 Feb 2026 |
| 882 | peccorina.com | Wild West Domains, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 883 | pecnewsletter.com | Moniker Online Services LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 884 | pecsar.com | CSC Corporate Domains, Inc. | 6 Feb 2015 | 2 Feb 2025 | 6 Feb 2026 |
| 885 | pecsarch.com | CSC Corporate Domains, Inc. | 6 Feb 2015 | 2 Feb 2025 | 6 Feb 2026 |
| 886 | pecsbdc.com | CSC Corporate Domains, Inc. | 6 Feb 2015 | 2 Feb 2025 | 6 Feb 2026 |
| 887 | pecsbom.com | CSC Corporate Domains, Inc. | 6 Feb 2015 | 2 Feb 2025 | 6 Feb 2026 |
| 888 | pecssnap.com | CSC Corporate Domains, Inc. | 6 Feb 2015 | 2 Feb 2025 | 6 Feb 2026 |
| 889 | pecsusg.com | CSC Corporate Domains, Inc. | 6 Feb 2015 | 2 Feb 2025 | 6 Feb 2026 |
| 890 | pechataembanner.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 891 | pecproducts.net | GoDaddy.com, LLC | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 892 | pecuneo.com | EPAG Domainservices GmbH | 28 Feb 2015 | 1 Mar 2025 | 28 Feb 2026 |
| 893 | pecyt.com | Jiangsu Bangning Science and technology Co. Ltd. | 7 Nov 2022 | 11 Dec 2023 | 7 Nov 2023 |
| 894 | pecsfactor.com | GoDaddy.com, LLC | 27 Oct 2018 | 28 Oct 2024 | 27 Oct 2025 |
| 895 | pecklandscape.com | Key-Systems GmbH | 7 Nov 2014 | 8 Nov 2024 | 7 Nov 2025 |
| 896 | peckinpahaustin.com | Network Solutions, LLC | 20 Feb 2016 | 18 Feb 2017 | 20 Feb 2018 |
| 897 | peckdmd.com | GoDaddy.com, LLC | 7 Nov 2014 | 8 Nov 2024 | 7 Nov 2029 |
| 898 | pecexpert.com | Nordreg AB | 7 Nov 2014 | 7 Nov 2024 | 7 Nov 2025 |
| 899 | pecengineerings.com | OnlineNIC, Inc. | 7 Mar 2022 | 11 Mar 2025 | 7 Mar 2026 |
| 900 | pecaparacarro.com | Tucows Domains Inc. | 7 Nov 2014 | 11 Nov 2020 | 7 Nov 2020 |
| 901 | pec-de.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2024 | 23 Aug 2026 |
| 902 | pecancrackerking.com | eNom, Inc. | 22 Aug 2014 | 12 Aug 2015 | 22 Aug 2018 |
| 903 | pecatonicatracking.org | GoDaddy.com, LLC | 22 Aug 2014 | 6 Jul 2024 | 22 Aug 2025 |
| 904 | pechenik.net | - | 7 Aug 2016 | 7 Aug 2016 | 7 Aug 2017 |
| 905 | peconn.com | Google, Inc. | 11 Jan 2019 | 27 Dec 2024 | 11 Jan 2026 |
| 906 | pecpoli.com | Everyones Internet, Ltd. dba SoftLayer | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 907 | pecual.com | Tucows Domains Inc. | 19 Aug 2010 | 23 Aug 2014 | 19 Aug 2015 |
| 908 | pecansupplier.com | Web4Africa Inc | 14 Apr 2015 | 24 May 2025 | 14 Apr 2026 |
| 909 | pechatnik.net | DropCatch.com 887 LLC | 23 Jun 2018 | 23 Jun 2018 | 23 Jun 2019 |
| 910 | peco-ng.org | Name.com, Inc. | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 911 | peco136.com | Network Solutions, LLC | 14 Apr 2015 | 1 Apr 2025 | 14 Apr 2027 |
| 912 | pecoleranchmortgages.com | GoDaddy.com, LLC | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2017 |
| 913 | pecorile.com | Tucows Domains Inc. | 13 Apr 2007 | 13 Apr 2007 | 13 Apr 2017 |
| 914 | pechenegfx.org | Dynadot, LLC | 7 Sep 2022 | 2 Nov 2024 | 7 Sep 2025 |
| 915 | pecasa.net | GoDaddy.com, LLC | 30 Jan 2023 | 27 Jan 2025 | 30 Jan 2027 |
| 916 | pecabroad.com | Wild West Domains, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 917 | pecafacil.com | eNom, Inc. | 17 Aug 2007 | 17 Jul 2025 | 17 Aug 2026 |
| 918 | pechia.com | NameCheap, Inc. | 5 Aug 2025 | 5 Aug 2025 | 5 Aug 2026 |
| 919 | pecosbob.com | Tucows Domains Inc. | 7 Apr 2004 | 11 Apr 2015 | 7 Apr 2016 |
| 920 | pecrezo.com | Network Solutions, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 921 | pectom.com | GMO Internet Inc. | 31 Jul 2023 | 11 Oct 2024 | 31 Jul 2024 |
| 922 | pecadosinconfesos.com | Mesh Digital Limited | 13 Apr 2021 | 13 Apr 2021 | 13 Apr 2022 |
| 923 | pecaseventos.com | Arsys Internet, S.L. dba NICLINE.COM | 12 Aug 2014 | 19 Oct 2022 | 12 Aug 2025 |
| 924 | peccagrorepuestos.com | Acens Technologies, S.L.U. | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 925 | pecfrme.com | Beijing Lanhai Jiye Technology Co., Ltd | 18 Jul 2021 | 19 Sep 2024 | 18 Jul 2024 |
| 926 | pecheux.net | Tucows Domains Inc. | 10 Aug 2001 | 9 Aug 2024 | 10 Aug 2025 |
| 927 | pechinchador.com | Hosting Concepts B.V. dba Openprovider | 16 Dec 2022 | 25 Jan 2025 | 16 Dec 2024 |
| 928 | pechorojo.com | NameCheap, Inc. | 18 Oct 2023 | 29 Nov 2024 | 18 Oct 2024 |
| 929 | peckplacepto.org | Tucows Domains Inc. | 8 Aug 2012 | 12 Aug 2014 | 8 Aug 2015 |
| 930 | peconicfirst.com | 1&1 Internet AG | 12 Aug 2014 | 17 Mar 2018 | 12 Aug 2025 |
| 931 | pecostrailcafe.net | Domain.com, LLC | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 932 | pec-forum.com | Name.com, Inc. | 14 Jan 2025 | 14 Jan 2025 | 14 Jan 2026 |
| 933 | pecahtelur.com | Name Find Source LLC | 19 Jul 2024 | 25 Jul 2025 | 19 Jul 2026 |
| 934 | pececillo.com | GoDaddy.com, LLC | 21 Jul 2003 | 26 Jul 2025 | 21 Jul 2026 |
| 935 | peckreality.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 936 | pecsnabs.com | Domainwards.com LLC | 12 Feb 2013 | 13 Feb 2017 | 12 Feb 2018 |
| 937 | pecsolution.com | GoDaddy.com, LLC | 24 Aug 2014 | 7 Jun 2024 | 24 Aug 2025 |
| 938 | pecsvarad.info | GMO Internet Inc. | 8 Nov 2017 | 8 Nov 2017 | 8 Nov 2018 |
| 939 | pecuniumcapital.com | GoDaddy.com, LLC | 27 Mar 2019 | 27 Mar 2019 | 27 Mar 2020 |
| 940 | pecorini.com | - | 14 Dec 2022 | 3 Jun 2025 | 14 Dec 2025 |
| 941 | pecopump.com | GoDaddy.com, LLC | 8 Nov 2014 | 9 Nov 2024 | 8 Nov 2025 |
| 942 | peck1500.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 943 | pechmanlaw.com | GoDaddy.com, LLC | 8 Nov 2014 | 11 Mar 2025 | 10 Mar 2027 |
| 944 | pecatuindah.com | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 945 | pecheriesprevel.net | HiChina Zhicheng Technology Limited | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 946 | pecan-capital.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 947 | pecancapitalfurniture.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 948 | pecancapitalwoodworks.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 949 | pecancapitalww.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 950 | pecanwoodworks.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 951 | peccant-hv3fwzw.info | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 952 | pececitofeliz.com | Mesh Digital Limited | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 953 | pechnik-spb.com | Limited Liability Company "Registrar of domain nam… | 26 Dec 2022 | 5 Mar 2024 | 26 Dec 2023 |
| 954 | peclassifieds.net | TPP Wholesale Pty Ltd. | 14 Aug 2014 | 28 Nov 2017 | 14 Aug 2019 |
| 955 | pectusexcavatum.net | NameCheap, Inc. | 12 Mar 2019 | 24 May 2025 | 12 Mar 2025 |
| 956 | pecufiliate.com | 1API GmbH | 13 Aug 2014 | 24 Jun 2025 | 13 Aug 2025 |
| 957 | pecahh.com | Google, Inc. | 28 Jun 2019 | 28 Jul 2020 | 28 Jun 2020 |
| 958 | pecaheaven.com | Gabia, Inc. | 27 Aug 2014 | 13 Aug 2015 | 27 Aug 2017 |
| 959 | pecanacresbaptist.org | Tucows Domains Inc. | 21 Aug 2006 | 25 Aug 2014 | 21 Aug 2015 |
| 960 | pecancoffee.com | NameKing.com Inc. | 26 Dec 2019 | 24 Dec 2024 | 26 Dec 2025 |
| 961 | pecanvalleychiroandrehab.com | Tucows Domains Inc. | 22 Aug 2012 | 26 Aug 2014 | 22 Aug 2015 |
| 962 | pecas-auto.com | Register.it SPA | 8 Apr 2017 | 8 Apr 2017 | 8 Apr 2018 |
| 963 | pecasparaacumuladoreshidropneumaticos.net | - | 22 Aug 2011 | 22 Aug 2011 | 22 Aug 2017 |
| 964 | pecdi.us | - | 25 Aug 2014 | - | 24 Aug 2015 |
| 965 | pecheriedopale.com | Gandi SAS | 26 Aug 2014 | 26 Jul 2017 | 26 Aug 2018 |
| 966 | pechesmignons.org | PSI-USA, Inc. dba Domain Robot | 26 Aug 2014 | 27 Aug 2016 | 26 Aug 2017 |
| 967 | peckdin.com | Namesilo, LLC | 15 May 2021 | 18 Jun 2023 | 15 May 2023 |
| 968 | peckerhead-brewery.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 969 | peckerhead-camo.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 970 | peckerhead-winery.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 971 | peckerheadapparel.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 972 | peckerheadcharters.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 973 | peckerheaddecoys.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 974 | peckerheaddistillery.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 975 | peckerheadfarms.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 976 | peckerheadgraphics.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 977 | peckerheadlogistics.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 978 | peckerheadmoonshine.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 979 | peckerheadmushrooms.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 980 | peckerheadoutdoors.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 981 | peckerheadpub.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 982 | peckerheadranch.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 983 | peckerheadshrooms.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 984 | peckerheadspirits.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 985 | peckerheadyachtclub.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2024 | 27 Aug 2026 |
| 986 | pecloud.net | Google, Inc. | 26 Aug 2024 | 10 Sep 2024 | 26 Aug 2025 |
| 987 | pecoantenna.com | Netowl, Inc. | 26 Aug 2014 | 26 Jul 2024 | 26 Aug 2025 |
| 988 | peconi.org | eNom, Inc. | 26 Dec 2021 | 25 Aug 2024 | 26 Dec 2033 |
| 989 | pecorahampshire.com | Tucows Domains Inc. | 25 Aug 2014 | 29 Aug 2015 | 25 Aug 2016 |
| 990 | pecosliving.com | register.com, Inc. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2018 |
| 991 | pecosperu.com | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 992 | pecproducts.com | TurnCommerce, Inc. DBA NameBright.com | 4 May 2014 | 15 Jul 2025 | 4 May 2025 |
| 993 | pectol.org | Network Solutions, LLC | 26 Aug 2014 | 1 Jul 2025 | 26 Aug 2026 |
| 994 | peculiarstores.com | FastDomain Inc. | 26 Jul 2022 | 27 Aug 2023 | 26 Jul 2023 |
| 995 | pec-10.com | GoDaddy.com, LLC | 15 Aug 2014 | 23 Jul 2025 | 15 Aug 2026 |
| 996 | pec10.com | GoDaddy.com, LLC | 15 Aug 2014 | 23 Jul 2025 | 15 Aug 2026 |
| 997 | pecet-net.com | Tucows Domains Inc. | 11 Aug 2009 | 14 Aug 2014 | 11 Aug 2015 |
| 998 | pechguitars.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Aug 2014 | 30 Jul 2025 | 14 Aug 2026 |
| 999 | pechugonas.com | GoDaddy.com, LLC | 25 Jul 2010 | 30 Jul 2025 | 25 Jul 2026 |
| 1000 | pecorinoabruzzese.com | Tucows Domains Inc. | 27 Feb 2019 | 20 Feb 2025 | 27 Feb 2026 |
Displaying 1,000 out of 56,482 domains starting with the keyword "PEC". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=pec
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |