Our database now contains whois records of 642 Million (642,985,560) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [642 Million Domains] $10,000 Details

Keyword: PEACEOFMINDPSYCH

Reverse Whois » KEYWORD [peaceofmindpsych ]  { 29 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1peaceofmindpsych.comGoDaddy.com, LLC23 May 201424 May 202523 May 2026
2peaceofmindpsych.netSquarespace Domains LLC27 Oct 202312 Oct 202427 Oct 2025
3peaceofmindpsychservices.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Feb 201617 Feb 202520 Feb 2026
4peaceofmindpsychology.com1&1 Internet AG22 Apr 20148 Mar 202422 Apr 2026
5peaceofmindpsychologypr.comTucows Domains Inc.21 Oct 202421 Oct 202421 Oct 2025
6peaceofmindpsychiatry.comNameCheap, Inc.23 Aug 202023 Aug 202023 Aug 2030
7peaceofmindpsychotherapy.orgeNom, Inc.1 Oct 20171 Oct 20171 Oct 2018
8peaceofmindpsychfl.comWix.com Ltd.6 Jul 20196 Jul 20196 Jul 2020
9peaceofmindpsychotherapy.comGoogle, Inc.24 Nov 20229 Nov 202424 Nov 2025
10peaceofmindpsychological.com1&1 Internet AG18 Aug 202018 Aug 202018 Aug 2021
11peaceofmindpsychologialservices.com1&1 Internet AG26 Aug 202026 Aug 202026 Aug 2021
12peaceofmindpsychotherapist.comregister.com, Inc.16 Aug 202327 Sep 202416 Aug 2024
13peaceofmindpsychologicalservices.comGoDaddy.com, LLC26 Jan 20218 Jan 202526 Jan 2027
14peaceofmindpsychllc.comGoDaddy.com, LLC23 Feb 202128 Feb 202423 Feb 2026
15peaceofmindpsychiatryllc.comGoDaddy.com, LLC13 Jul 202125 Aug 202513 Jul 2026
16peaceofmindpsychiatricservices.comNameCheap, Inc.13 Jan 202513 Jan 202513 Jan 2028
17peaceofmindpsychology.orgGoogle, Inc.31 Aug 202222 Aug 202531 Aug 2026
18peaceofmindpsychology.au--3 Jun 2024-
19peaceofmindpsychotherapyllc.comSquarespace Domains LLC14 Dec 202231 Jan 202514 Dec 2025
20peaceofmindpsychology.ca-11 Mar 20195 Jul 202511 Mar 2026
21peaceofmindpsychservice.comGoDaddy.com, LLC3 May 202115 Jul 20233 May 2023
22peaceofmindpsychiatricservicespllc.comGoDaddy.com, LLC14 Jun 202219 Dec 202414 Jun 2026
23peaceofmindpsychiatry.orgGoDaddy.com, LLC13 Jul 202124 Aug 202513 Jul 2025
24peaceofmindpsychiatry.onlineDomain.com, LLC16 Aug 202324 Jul 202516 Aug 2026
25peaceofmindpsychiatry.netDomain.com, LLC16 Aug 202318 Jul 202516 Aug 2026
26peaceofmindpsychiatry2.comGoDaddy.com, LLC9 Jun 202421 Jul 20259 Jun 2025
27peaceofmindpsychology.co.nz-10 Dec 20192 Sep 2025-
28peaceofmindpsychiatryatl.comHosting Concepts B.V. dba Openprovider5 Apr 202519 Jul 20255 Apr 2026
29peaceofmindpsychiatry1.comWix.com Ltd.30 Jun 202530 Jun 202530 Jun 2030

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=peaceofmindpsych

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now