Our database now contains whois records of 556 Million (556,226,671) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1563 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [556 Million Domains] $10,000 Details

Keyword: OFFICECLEANINGSERVICE

Reverse Whois » KEYWORD [officecleaningservice ]  { 161 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1officecleaningservice.london-10 May 201510 May 201510 May 2017
2officecleaningservice.bizGoogle, Inc.11 Nov 201916 Nov 201911 Nov 2020
3officecleaningservice.comGoDaddy.com, LLC31 Dec 199911 Dec 202331 Dec 2024
4officecleaningservice.netNetwork Solutions, LLC28 Oct 202328 Oct 202328 Oct 2024
5officecleaningservice.orgGoDaddy.com, LLC18 Oct 200819 Oct 201718 Oct 2018
6officecleaningservice.usNameCheap, Inc.22 Jan 201928 Dec 202322 Jan 2025
7officecleaningservice.co.uk-16 Feb 20083 Apr 201816 Feb 2020
8officecleaningservice.sydneySynergy Wholesale Pty Ltd23 Jan 202123 Jan 202123 Jan 2022
9officecleaningservice.proGoDaddy.com, LLC1 May 20211 May 20211 May 2022
10officecleaningservice.siteDOTSERVE INC.29 Jun 202331 Aug 202329 Jun 2024
11officecleaningservice.lifeGoDaddy.com, LLC12 Feb 202325 Mar 202412 Feb 2024
12officecleaningservice.xyzGoDaddy.com, LLC17 Mar 202328 Apr 202417 Mar 2024
13officecleaningservice.bondKey-Systems, LLC17 Dec 20235 Feb 202417 Dec 2024
14officecleaningservice.nycGoDaddy.com, LLC19 Mar 202419 Mar 202419 Mar 2025
15officecleaningservicechicago.comName.com, Inc.14 Nov 20149 May 201714 Nov 2017
16officecleaningserviceeastlansing.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
17officecleaningservicelansing.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
18officecleaningserviceokemos.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
19officecleaningservicesnashville.comGoDaddy.com, LLC30 Nov 20141 Dec 202330 Nov 2024
20officecleaningservicessingapore.comGoDaddy.com, LLC4 Dec 20144 Dec 20144 Dec 2015
21officecleaningservicestoronto.comTucows Domains Inc.6 Mar 202320 Feb 20246 Mar 2025
22officecleaningservicestoronto.netGoDaddy.com, LLC6 Dec 20146 Dec 20146 Dec 2015
23officecleaningservicestoronto.orgGoDaddy.com, LLC6 Dec 20146 Dec 20146 Dec 2015
24officecleaningservicegreenville.comeNom, Inc.22 Dec 201422 Dec 201422 Dec 2015
25officecleaningservices.bizNetwork Solutions, LLC19 Aug 201519 Aug 201518 Aug 2016
26officecleaningserviceslocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
27officecleaningservices.orgGoDaddy.com, LLC10 Sep 20199 Aug 202310 Sep 2024
28officecleaningservicesmarthasvineyard.comGoDaddy.com, LLC13 Mar 201525 Mar 202413 Mar 2025
29officecleaningservicesma.comGoDaddy.com, LLC6 Apr 20156 Apr 20156 Apr 2016
30officecleaningservicesnashvilletn.comGoDaddy.com, LLC13 Apr 201514 Apr 202413 Apr 2025
31officecleaningservicenashvilletn.comGoDaddy.com, LLC13 Apr 201513 Apr 201513 Apr 2016
32officecleaningservicessouthflorida.comGoDaddy.com, LLC14 Apr 201514 Apr 201514 Apr 2017
33officecleaningservicesteam.comGoDaddy.com, LLC11 May 201512 May 202411 May 2025
34officecleaningservicesnewyorkcity.comGoDaddy.com, LLC10 Jun 201510 Jun 201510 Jun 2016
35officecleaningservicesarizona.comTucows Domains Inc.21 Sep 201125 Sep 201521 Sep 2016
36officecleaningservicesllc.comGoDaddy.com, LLC25 Mar 201825 Mar 202425 Mar 2025
37officecleaningserviceeastlansing.usGoDaddy.com, LLC8 Oct 20158 Oct 20157 Oct 2016
38officecleaningservicesdenver.comGoDaddy.com, LLC21 Oct 201521 Oct 201521 Oct 2016
39officecleaningservicesdenver.mobiGoDaddy.com, LLC21 Oct 201516 Oct 201621 Oct 2017
40officecleaningserviceslondon.comGoDaddy.com, LLC30 Oct 201530 Oct 201530 Oct 2016
41officecleaningservicesmiami.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED22 Jan 202122 Jan 202122 Jan 2022
42officecleaningservicebrooklyn.com1&1 Internet AG5 Dec 20155 Dec 20155 Dec 2016
43officecleaningserviceburlington.comeNom, Inc.19 Jan 201619 Jan 201619 Jan 2017
44officecleaningservicesbrisbane.comCrazy Domains FZ-LLC12 Apr 201212 Apr 201212 Apr 2017
45officecleaningservicedetroit.comeNom, Inc.20 Jun 201620 Jun 201620 Jun 2017
46officecleaningservices.xyzGoDaddy.com, LLC21 Feb 202425 Mar 202421 Feb 2025
47officecleaningservicenewyork.comAbove.com Pty Ltd.4 Sep 20234 Sep 20234 Sep 2024
48officecleaningservicestowson.comTucows Domains Inc.11 Jul 201615 Jul 202111 Jul 2021
49officecleaningservices.londonMesh Digital Limited27 Aug 201420 Aug 201527 Aug 2016
50officecleaningserviceflatrockmi.comeNom, Inc.18 Aug 201630 Sep 201718 Aug 2017
51officecleaningservicecincinnati.comeNom, Inc.19 Aug 20161 Oct 201719 Aug 2017
52officecleaningservicesperth.comregister.com, Inc.1 Sep 201616 Aug 20171 Sep 2018
53officecleaningserviceschicago.comWild West Domains, LLC15 Sep 201616 Aug 202315 Sep 2024
54officecleaningservicesmaine.comeNom, Inc.15 Apr 200916 Feb 201715 Apr 2018
55officecleaningservicedenver.comGoDaddy.com, LLC5 Nov 20126 Nov 20235 Nov 2024
56officecleaningservicesftmyers.comGoDaddy.com, LLC22 Feb 20125 Sep 20153 Sep 2018
57officecleaningservicesfl.comTucows Domains Inc.17 Jan 201121 Jan 201717 Jan 2017
58officecleaningservicesinfortmyers.comGoDaddy.com, LLC28 Nov 201119 Nov 202328 Nov 2024
59officecleaningservicesboston.comGoDaddy.com, LLC23 Apr 201823 Apr 202423 Apr 2025
60officecleaningservicenashville.comeNom, Inc.5 Nov 201229 Oct 20175 Nov 2018
61officecleaningservicesinmaine.comeNom, Inc.15 Apr 200916 Feb 201715 Apr 2018
62officecleaningservices.comTucows Domains Inc.11 Nov 199912 Oct 202311 Nov 2024
63officecleaningservicelongisland.comGoDaddy.com, LLC26 Oct 201327 Oct 202326 Oct 2024
64officecleaningservicesnj.comGoDaddy.com, LLC11 Jul 200912 Jul 201611 Jul 2021
65officecleaningservicesfortlauderdale.comFastDomain Inc.7 Jun 20137 Jun 20177 Jun 2018
66officecleaningserviceslosangeles.comGoDaddy.com, LLC4 Sep 20135 Sep 20234 Sep 2024
67officecleaningservicesnewjersey.comeNom, Inc.27 Apr 201229 Mar 201527 Apr 2018
68officecleaningservicestlouis.comGoDaddy.com, LLC5 Nov 20126 Nov 20235 Nov 2024
69officecleaningservicesnyc.comGoDaddy.com, LLC24 Oct 201210 Jan 20249 Jan 2025
70officecleaningservicenorthpalmbeach.comTucows Domains Inc.4 Oct 20138 Oct 20184 Oct 2018
71officecleaningservicecoloradosprings.comGoDaddy.com, LLC10 Jun 20146 Jun 201610 Jun 2017
72officecleaningservicewestpalm.comTucows Domains Inc.10 Dec 200914 Dec 201610 Dec 2016
73officecleaningservicemaine.comeNom, Inc.15 Apr 200916 Feb 201715 Apr 2018
74officecleaningserviceil.comTucows Domains Inc.22 Feb 201126 Feb 201722 Feb 2017
75officecleaningservicenj.comGoDaddy.com, LLC11 Jul 200912 Jul 201611 Jul 2021
76officecleaningservicenyc.comWild West Domains, LLC20 Nov 201315 Nov 202320 Nov 2024
77officecleaningservices.infoVautron Rechenzentrum AG26 Jun 201410 Aug 202326 Jun 2024
78officecleaningservices.netGoDaddy.com, LLC26 Feb 20186 Feb 202426 Feb 2025
79officecleaningservicelondon.neteNom, Inc.1 May 20125 May 20171 May 2018
80officecleaningserviceslondon.neteNom, Inc.1 May 20125 May 20171 May 2018
81officecleaningservicesmontreal.comDomain.com, LLC17 Nov 201617 Nov 201617 Nov 2017
82officecleaningserviceslaval.comDomain.com, LLC17 Nov 201620 Nov 201717 Nov 2017
83officecleaningservicesottawa.comDomain.com, LLC17 Nov 201620 Nov 201717 Nov 2017
84officecleaningserviceslongueuil.comDomain.com, LLC17 Nov 201620 Nov 201717 Nov 2017
85officecleaningservicesoncall.comGoDaddy.com, LLC18 Nov 201618 Nov 201618 Nov 2019
86officecleaningservicepros.comGoDaddy.com, LLC30 Dec 201631 Dec 202330 Dec 2024
87officecleaningservicessutherlandshire.comGoDaddy.com, LLC5 Jan 20175 Jan 20175 Jan 2018
88officecleaningservicesraleighnc.comGoDaddy.com, LLC17 Jan 202017 Jan 202017 Jan 2021
89officecleaningservicenh.comGoogle, Inc.13 Sep 201713 Sep 201713 Sep 2018
90officecleaningserviceblog.infoGoDaddy.com, LLC12 Oct 201712 Oct 201712 Oct 2018
91officecleaningservicesottawa.ca-16 Nov 201631 Dec 201716 Nov 2018
92officecleaningservices.co.uk-16 Feb 200814 Feb 202416 Feb 2025
93officecleaningserviceslondon.org.ukHello Internet Corp.1 May 201229 Apr 20161 May 2018
94officecleaningservicekent.co.uk-19 Oct 201019 Oct 202319 Oct 2024
95officecleaningservicesinbirmingham.co.ukeNom, Inc.6 Aug 201531 Jul 20176 Aug 2018
96officecleaningservicesnearme.comCosmotown, Inc.27 Dec 202325 Feb 202427 Dec 2024
97officecleaningservicesjm.comGandi SAS30 Jan 201930 Dec 202330 Jan 2025
98officecleaningservicestampa.comGoDaddy.com, LLC18 Aug 202230 Oct 202318 Aug 2023
99officecleaningservicetampa.comGoDaddy.com, LLC18 Aug 202230 Oct 202318 Aug 2023
100officecleaningservicesydney.comNameCheap, Inc.14 Mar 201914 Mar 201914 Mar 2020
101officecleaningservicescalgary.comGoDaddy.com, LLC16 Nov 202016 Nov 202016 Nov 2021
102officecleaningservicesgreenville.comNameCheap, Inc.28 Aug 201729 Jul 202128 Aug 2022
103officecleaningservicesdetroit.comGoogle, Inc.9 Feb 20219 Feb 20219 Feb 2022
104officecleaningservicesinchicago.comGoDaddy.com, LLC27 Jan 20209 Apr 202427 Jan 2024
105officecleaningserviceshoustontx.comGoDaddy.com, LLC8 Apr 20209 Apr 20248 Apr 2025
106officecleaningserviceshouston.comGoDaddy.com, LLC8 Apr 20209 Apr 20248 Apr 2025
107officecleaningservicesydney.xyzNameCheap, Inc.3 Aug 201914 Aug 20193 Aug 2020
108officecleaningservices.proGoDaddy.com, LLC18 Aug 202018 Aug 202018 Aug 2021
109officecleaningservicesinfo.spaceDOTSERVE INC.26 Aug 202026 Aug 202026 Aug 2021
110officecleaningservicesonline.infoGoDaddy.com, LLC16 Sep 202031 Oct 202316 Sep 2024
111officecleaningservicessydney.xyzGMO Internet Inc.16 Nov 2020-16 Nov 2021
112officecleaningservices.siteDOTSERVE INC.7 Apr 20204 Apr 20247 Apr 2025
113officecleaningservices-au.siteDOTSERVE INC.28 Jul 202031 Aug 202328 Jul 2024
114officecleaningservices-uk.siteDOTSERVE INC.25 Aug 202031 Aug 202325 Aug 2024
115officecleaningservices.todayHosting Concepts B.V. dba Openprovider28 Dec 202028 Dec 202028 Dec 2021
116officecleaningservicesintampa.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED22 Jan 202122 Jan 202122 Jan 2022
117officecleaningservicessarasota.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED22 Jan 202122 Jan 202122 Jan 2022
118officecleaningserviceschicagoillinois.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED22 Jan 202122 Jan 202122 Jan 2022
119officecleaningserviceswheeling.comGoDaddy.com, LLC2 Nov 20232 Nov 20232 Nov 2024
120officecleaningserviceincanberra.comNameCheap, Inc.25 Sep 202126 Aug 202325 Sep 2024
121officecleaningservicesqueens.comGoDaddy.com, LLC17 Oct 202118 Oct 202317 Oct 2025
122officecleaningservicesbrickell.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
123officecleaningserviceswestpalmbeach.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
124officecleaningservices.spaceDOTSERVE INC.11 Nov 202111 Nov 202111 Nov 2022
125officecleaningservicesindiana.comGoDaddy.com, LLC15 Nov 202115 Nov 202115 Nov 2022
126officecleaningservicesil.comGoDaddy.com, LLC5 Oct 20226 Oct 20235 Oct 2024
127officecleaningservicesinfo.siteDOTSERVE INC.1 Nov 20221 Nov 20221 Nov 2023
128officecleaningservicesinsydney.com.au--20 Apr 2023-
129officecleaningservicesneartraversecity.comGoDaddy.com, LLC8 Feb 202321 Mar 20248 Feb 2024
130officecleaningserviceneartampa.comGoDaddy.com, LLC8 Feb 202321 Mar 20248 Feb 2024
131officecleaningservicesneartampa.comGoDaddy.com, LLC8 Feb 202321 Mar 20248 Feb 2024
132officecleaningserviceneartraversecity.comGoDaddy.com, LLC8 Feb 202321 Mar 20248 Feb 2024
133officecleaningservicesnearme.netGoDaddy.com, LLC8 Feb 202320 Feb 20248 Feb 2025
134officecleaningservicespro.netHostinger, UAB25 Feb 202325 Feb 202425 Feb 2025
135officecleaningservicespro.comHostinger, UAB16 Mar 202318 Feb 202416 Mar 2025
136officecleaningservices.storeDOTSERVE INC.27 Mar 202328 Mar 202427 Mar 2025
137officecleaningservicenearme.comNameCheap, Inc.28 Dec 202128 Nov 202328 Dec 2024
138officecleaningservicesnearme.co.uk-17 Aug 202017 Aug 202217 Aug 2023
139officecleaningservicesmaidenhead.co.uk-13 Jul 202219 Dec 202313 Jul 2024
140officecleaningservices-us.todayGoDaddy.com, LLC10 Aug 202315 Aug 202310 Aug 2024
141officecleaningservices.bondKey-Systems, LLC17 Aug 20239 Oct 202317 Aug 2024
142officecleaningserviceforyou.siteDOTSERVE INC.23 Aug 202328 Aug 202323 Aug 2024
143officecleaningservicesconcord.comGoDaddy.com, LLC15 Sep 202315 Sep 202315 Sep 2024
144officecleaningservicescharlotte.comNameCheap, Inc.23 Sep 202323 Sep 202323 Sep 2024
145officecleaningserviceselizabeth.comNameCheap, Inc.23 Sep 202323 Sep 202323 Sep 2024
146officecleaningserviceskansascity.comNameCheap, Inc.23 Sep 202323 Sep 202323 Sep 2024
147officecleaningservicesnearme.todayGoDaddy.com, LLC26 Sep 20231 Oct 202326 Sep 2024
148officecleaningservices.sbsNameCheap, Inc.20 Nov 20237 Dec 202320 Nov 2024
149officecleaningservicesus.bondKey-Systems, LLC22 Nov 20238 Feb 202422 Nov 2024
150officecleaningservices-uk.sbsNameCheap, Inc.13 Dec 202329 Dec 202313 Dec 2024
151officecleaningservices.cfdNameCheap, Inc.13 Dec 202329 Dec 202313 Dec 2024
152officecleaningservices-uk.lolNameCheap, Inc.13 Dec 202329 Dec 202313 Dec 2024
153officecleaningservicesnearbyme.todayGoDaddy.com, LLC18 Dec 202323 Dec 202318 Dec 2024
154officecleaningservices.uk-14 Feb 202414 Feb 202414 Feb 2025
155officecleaningservicesnearme.xyzGoDaddy.com, LLC21 Feb 202425 Mar 202421 Feb 2025
156officecleaningservices-info-au.todayGoDaddy.com, LLC14 Mar 202419 Mar 202414 Mar 2025
157officecleaningservices-info-us.todayGoDaddy.com, LLC14 Mar 202419 Mar 202414 Mar 2025
158officecleaningservicesnearyou.todayGoDaddy.com, LLC29 Mar 202429 Mar 202429 Mar 2025
159officecleaningservicesnearme.shopGoDaddy.com, LLC21 Feb 20247 Mar 202421 Feb 2025
160officecleaningservicecorporation.comregister.com, Inc.2 May 20242 May 20242 May 2025
161officecleaningservicesnearme123.todayGoDaddy.com, LLC5 May 20245 May 20245 May 2025

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=officecleaningservice

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now