With support for 
Keyword: OAKLEY
Reverse Whois » KEYWORD [oakley ] { 9,351 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | oakley.com | Register.it SPA | 22 Mar 2017 | 21 Feb 2025 | 19 Jan 2026 |
| 2 | oakley.com.br | - | 20 Mar 1998 | 16 Apr 2021 | 20 Mar 2026 |
| 3 | oakley.co.kr | - | 31 Jan 2000 | 15 Jul 2022 | 31 Jan 2024 |
| 4 | oakley.com.cn | - | 3 Feb 2019 | - | 3 Feb 2029 |
| 5 | oakley.bz | - | - | - | - |
| 6 | oakley.tips | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jul 2014 | 1 Jul 2014 | 1 Jul 2015 |
| 7 | oakley.wang | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 11 Apr 2017 | - | 11 Apr 2018 |
| 8 | oakley.pub | GoDaddy.com, LLC | 7 Aug 2014 | 21 Sep 2024 | 7 Aug 2025 |
| 9 | oakley.limited | 1&1 Internet AG | 6 Aug 2014 | 6 Aug 2014 | 6 Aug 2015 |
| 10 | oakley.company | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 11 | oakley.church | GoDaddy.com, LLC | 26 Nov 2018 | 1 Dec 2018 | 26 Nov 2020 |
| 12 | oakley.blackfriday | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 13 | oakley.consulting | GoDaddy.com, LLC | 11 Nov 2014 | 26 Dec 2017 | 11 Nov 2018 |
| 14 | oakley.website | Hostinger, UAB | 15 Jan 2023 | 30 Mar 2025 | 15 Jan 2025 |
| 15 | oakley.social | Name.com, Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 16 | oakley.webcam | Alpnames Limited | 27 Nov 2014 | 27 Nov 2014 | 26 Nov 2015 |
| 17 | oakley.moscow | Regional Network Information Center, JSC dba RU-CE… | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 18 | oakley.center | Google, Inc. | 11 Dec 2014 | 9 Dec 2019 | 11 Dec 2020 |
| 19 | oakley.click | 1API GmbH | 19 Jan 2015 | 7 Nov 2016 | 19 Jan 2018 |
| 20 | oakley.world | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 21 | oakley.farm | GoDaddy.com, LLC | 29 Jan 2015 | 15 Mar 2025 | 29 Jan 2026 |
| 22 | oakley.capital | GoDaddy.com, LLC | 3 Feb 2015 | 20 Mar 2025 | 3 Feb 2026 |
| 23 | oakley.black | 1API GmbH | 30 Jan 2015 | - | 30 Jan 2016 |
| 24 | oakley.rentals | GoDaddy.com, LLC | 3 Feb 2015 | 20 Mar 2025 | 3 Feb 2026 |
| 25 | oakley.blue | 1API GmbH | 5 Mar 2015 | - | 5 Mar 2016 |
| 26 | oakley.red | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 14 Dec 2017 | 15 Dec 2017 | 14 Dec 2018 |
| 27 | oakley.pink | 1API GmbH | 5 Mar 2015 | - | 5 Mar 2016 |
| 28 | oakley.science | Alpnames Limited | 24 Feb 2015 | 26 Apr 2015 | 23 Feb 2016 |
| 29 | oakley.plumbing | GoDaddy.com, LLC | 29 May 2015 | 13 Jul 2017 | 29 May 2018 |
| 30 | oakley.sucks | united-domains AG | 21 Jun 2015 | - | 21 Jun 2016 |
| 31 | oakley.email | GoDaddy.com, LLC | 28 Aug 2016 | 24 Jun 2020 | 28 Aug 2020 |
| 32 | oakley.rocks | Blacknight Internet Solutions Ltd. | 2 Jul 2015 | 9 Jul 2017 | 2 Jul 2018 |
| 33 | oakley.house | eNom, Inc. | 16 Aug 2015 | 28 Jun 2017 | 16 Aug 2018 |
| 34 | oakley.golf | GoDaddy.com, LLC | 8 Feb 2018 | 8 Feb 2018 | 8 Feb 2019 |
| 35 | oakley.trade | Regional Network Information Center, JSC dba RU-CE… | 8 Aug 2014 | 10 Aug 2015 | 7 Aug 2015 |
| 36 | oakley.dog | Name.com, Inc. | 26 Aug 2015 | 1 Feb 2017 | 26 Aug 2017 |
| 37 | oakley.clothing | eNom, Inc. | 5 Jan 2017 | 10 Jan 2017 | 5 Jan 2018 |
| 38 | oakley.photo | Tucows Domains Inc. | 2 Sep 2015 | 19 Mar 2017 | 2 Sep 2017 |
| 39 | oakley.host | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jun 2015 | 17 Sep 2015 | 16 Jun 2016 |
| 40 | oakley.fishing | Uniregistrar Corp | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 41 | oakley.country | Uniregistrar Corp | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 42 | oakley.online | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Jul 2019 | 17 Sep 2024 | 18 Jul 2024 |
| 43 | oakley.mobi | GoDaddy.com, LLC | 24 Dec 2019 | 7 Feb 2025 | 24 Dec 2025 |
| 44 | oakley.one | - | 2 Apr 2025 | 7 Apr 2025 | 2 Apr 2026 |
| 45 | oakley.joburg | Tucows Domains Inc. | 12 Nov 2014 | 16 Nov 2015 | 12 Nov 2016 |
| 46 | oakley.durban | Tucows Domains Inc. | 12 Nov 2014 | 16 Nov 2015 | 12 Nov 2016 |
| 47 | oakley.capetown | Tucows Domains Inc. | 12 Nov 2014 | 16 Nov 2015 | 12 Nov 2016 |
| 48 | oakley.design | Gandi SAS | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 49 | oakley.miami | GoDaddy.com, LLC | 3 Dec 2015 | 3 Dec 2015 | 3 Dec 2017 |
| 50 | oakley.ca | - | 27 Oct 2000 | 16 May 2025 | 16 May 2026 |
| 51 | oakley.space | Chengdu West Dimension Digital Technology Co., Ltd… | 6 Jan 2016 | - | 6 Jan 2017 |
| 52 | oakley.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 6 Jan 2016 | - | 6 Jan 2017 |
| 53 | oakley.wales | Tucows Domains Inc. | 23 Jan 2016 | 23 Jan 2016 | 23 Jan 2017 |
| 54 | oakley.city | Epik Inc. | 16 Feb 2016 | 6 Jan 2017 | 16 Feb 2018 |
| 55 | oakley.xin | - | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 56 | oakley.vip | Go China Domains, LLC | 21 Jun 2022 | 5 Jul 2024 | 21 Jun 2025 |
| 57 | oakley.mom | Uniregistrar Corp | 4 May 2016 | 29 Mar 2017 | 4 May 2017 |
| 58 | oakley.site | NameCheap, Inc. | 7 Nov 2017 | 7 Nov 2017 | 7 Nov 2018 |
| 59 | oakley.store | NameCheap, Inc. | 28 Sep 2017 | 28 Sep 2017 | 28 Sep 2018 |
| 60 | oakley.salon | GoDaddy.com, LLC | 15 Jun 2016 | 30 Jul 2024 | 15 Jun 2025 |
| 61 | oakley.equipment | united-domains AG | 12 Feb 2014 | 28 Mar 2016 | 12 Feb 2017 |
| 62 | oakley.ninja | Google, Inc. | 9 Jun 2014 | 3 Jun 2025 | 9 Jun 2026 |
| 63 | oakley.solar | Gandi SAS | 10 Apr 2014 | 31 Mar 2016 | 10 Apr 2017 |
| 64 | oakley.jobs | GoDaddy.com, LLC | 24 Sep 2009 | 30 Sep 2016 | 24 Sep 2017 |
| 65 | oakley.today | GoDaddy.com, LLC | 11 May 2014 | 25 Jun 2016 | 11 May 2017 |
| 66 | oakley.events | Uniregistrar Corp | 12 Jun 2014 | 3 Dec 2018 | 12 Jun 2020 |
| 67 | oakley.biz | Dynadot, LLC | 11 Aug 2024 | 16 Aug 2024 | 11 Aug 2025 |
| 68 | oakley.live | Crazy Domains FZ-LLC | 20 Jul 2016 | 25 Jul 2016 | 20 Jul 2017 |
| 69 | oakley.feedback | TLD Registrar Solutions Ltd. | 27 Jul 2016 | 27 Jul 2016 | 27 Jul 2017 |
| 70 | oakley.photography | eNom, Inc. | 16 Sep 2016 | 21 Sep 2019 | 16 Sep 2020 |
| 71 | oakley.info | Dynadot, LLC | 7 Dec 2020 | 7 Dec 2020 | 7 Dec 2021 |
| 72 | oakley.net | Tucows Domains Inc. | 26 Apr 1997 | 29 Mar 2025 | 27 Apr 2026 |
| 73 | oakley.legal | register.com, Inc. | 17 Oct 2016 | 1 Dec 2017 | 17 Oct 2018 |
| 74 | oakley.tech | GoDaddy.com, LLC | 30 Oct 2018 | 30 Oct 2018 | 30 Oct 2019 |
| 75 | oakley.org | Register.it SPA | 8 Jun 2007 | 8 Jun 2025 | 8 Jun 2026 |
| 76 | oakley.us | Tucows Domains Inc. | 19 Apr 2002 | 14 Apr 2025 | 18 Apr 2026 |
| 77 | oakley.xxx | - | 1 Dec 2011 | 30 Jan 2012 | 1 Dec 2021 |
| 78 | oakley.xyz | Gandi SAS | 30 Jun 2014 | 14 Apr 2025 | 30 Jun 2025 |
| 79 | oakley.quebec | GoDaddy.com, LLC | 21 Nov 2014 | 5 Jan 2017 | 21 Nov 2017 |
| 80 | oakley.pro | Edomains LLC | 27 Dec 2020 | 27 Jan 2023 | 27 Dec 2023 |
| 81 | oakley.co.uk | - | - | 7 Oct 2024 | 8 Oct 2025 |
| 82 | oakley.expert | Epik Inc. | 3 Nov 2016 | 13 Nov 2017 | 3 Nov 2018 |
| 83 | oakley.cloud | GoDaddy.com, LLC | 1 Feb 2017 | 8 Jun 2024 | 1 Feb 2026 |
| 84 | oakley.press | Regional Network Information Center, JSC dba RU-CE… | 7 Jun 2023 | 12 Jul 2024 | 7 Jun 2024 |
| 85 | oakley.nom.co | Dynadot, LLC | 21 Apr 2023 | 26 Apr 2025 | 21 Apr 2025 |
| 86 | oakley.my | - | 20 Aug 2015 | 8 Sep 2015 | 20 Aug 2017 |
| 87 | oakley.life | NameCheap, Inc. | 25 Apr 2017 | 29 Sep 2017 | 25 Apr 2018 |
| 88 | oakley.codes | NameCheap, Inc. | 25 Apr 2017 | 6 Jun 2023 | 25 Apr 2023 |
| 89 | oakley.partners | Google, Inc. | 17 May 2017 | 29 Sep 2017 | 17 May 2018 |
| 90 | oakley.men | Gandi SAS | 8 Jun 2017 | 6 Aug 2024 | 8 Jun 2027 |
| 91 | oakley.agency | GoDaddy.com, LLC | 28 Jul 2017 | 28 Jul 2017 | 28 Jul 2018 |
| 92 | oakley.cc | Mesh Digital Limited | 23 Aug 2018 | 5 Dec 2024 | 23 Aug 2025 |
| 93 | oakley.media | NameCheap, Inc. | 15 Sep 2017 | 15 Sep 2017 | 15 Sep 2018 |
| 94 | oakley.digital | NameCheap, Inc. | 15 Sep 2017 | 15 Sep 2017 | 15 Sep 2018 |
| 95 | oakley.ink | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 4 Nov 2017 | 27 Dec 2017 | 4 Nov 2020 |
| 96 | oakley.com.de | - | - | 23 May 2025 | - |
| 97 | oakley.ltd | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Nov 2017 | 28 Nov 2017 | 28 Nov 2018 |
| 98 | oakley.coffee | Tucows Domains Inc. | 2 Dec 2017 | 6 Dec 2021 | 2 Dec 2022 |
| 99 | oakley.org.uk | - | 30 Apr 2015 | 31 Mar 2025 | 30 Apr 2026 |
| 100 | oakley.me.uk | - | 31 Aug 2010 | 29 Jul 2024 | 31 Aug 2027 |
| 101 | oakley.gold | Chengdu West Dimension Digital Technology Co., Ltd… | 8 Feb 2018 | 12 Feb 2018 | 8 Feb 2019 |
| 102 | oakley.network | CloudFlare, Inc. | 22 Feb 2018 | 28 Jan 2025 | 22 Feb 2026 |
| 103 | oakley.guide | Uniregistrar Corp | 19 Mar 2018 | 19 Mar 2018 | 19 Mar 2019 |
| 104 | oakley.solutions | Gandi SAS | 19 May 2018 | 19 Apr 2025 | 19 May 2026 |
| 105 | oakley.marketing | GoDaddy.com, LLC | 29 Sep 2018 | 10 Dec 2024 | 29 Sep 2024 |
| 106 | oakley.cheap | GoDaddy.com, LLC | 28 Sep 2018 | 28 Sep 2018 | 28 Sep 2019 |
| 107 | oakley.vision | GoDaddy.com, LLC | 5 Oct 2018 | 9 Oct 2024 | 5 Oct 2025 |
| 108 | oakley.dev | GoDaddy.com, LLC | 2 Nov 2024 | 7 Nov 2024 | 2 Nov 2025 |
| 109 | oakley.realestate | Name Share, Inc. | 18 Sep 2018 | 31 Aug 2023 | 18 Sep 2025 |
| 110 | oakley.realty | Epik Inc. | 27 Sep 2020 | 14 Nov 2021 | 27 Sep 2022 |
| 111 | oakley.asia | Dynadot, LLC | 1 Jan 2023 | 11 Mar 2024 | 1 Jan 2024 |
| 112 | oakley.club | GoDaddy.com, LLC | 14 Feb 2021 | 27 Mar 2024 | 14 Feb 2024 |
| 113 | oakley.my.id | - | 31 Dec 2022 | - | 31 Dec 2023 |
| 114 | oakley.wiki | Porkbun, LLC | 29 Dec 2021 | 8 Feb 2023 | 29 Dec 2022 |
| 115 | oakley.com.au | - | - | 1 Apr 2025 | - |
| 116 | oakley.uk | - | 4 Jul 2019 | 19 Apr 2025 | 4 Jul 2026 |
| 117 | oakley.cn | - | 14 May 2009 | - | 14 May 2026 |
| 118 | oakley.co.jp | - | 12 Aug 2004 | 1 Sep 2024 | - |
| 119 | oakley.it | - | 2 Aug 2001 | 18 Aug 2024 | 2 Aug 2025 |
| 120 | oakley.jp | - | 31 Aug 2005 | 14 Oct 2024 | 31 Aug 2025 |
| 121 | oakley.app | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 May 2018 | 3 Mar 2023 | 5 May 2026 |
| 122 | oakley.be | - | 16 Mar 2011 | - | - |
| 123 | oakley.fit | GoDaddy.com, LLC | 17 Dec 2019 | 23 Dec 2024 | 17 Dec 2025 |
| 124 | oakley.au | - | - | 7 Sep 2024 | - |
| 125 | oakley.net.nz | - | 27 Jan 2023 | 2 Jan 2025 | - |
| 126 | oakley.pt | - | - | - | - |
| 127 | oakley.co | SafeNames Ltd. | 2 Jul 2010 | 22 Jan 2025 | 1 Jul 2025 |
| 128 | oakley.london | Mesh Digital Limited | 16 Mar 2023 | 27 Apr 2024 | 16 Mar 2024 |
| 129 | oakley.earth | GoDaddy.com, LLC | 17 Apr 2022 | 29 May 2024 | 17 Apr 2024 |
| 130 | oakley.family | Google, Inc. | 23 Feb 2019 | 13 Feb 2025 | 23 Feb 2026 |
| 131 | oakley.homes | Global Domains International, Inc. DBA DomainCostC… | 23 Aug 2019 | 4 Nov 2024 | 23 Aug 2025 |
| 132 | oakley.in | Dynadot, LLC | 5 May 2020 | 2 May 2024 | 5 May 2026 |
| 133 | oakley.link | Namesilo, LLC | 1 Sep 2021 | 1 Sep 2023 | 1 Sep 2024 |
| 134 | oakley.law | GoDaddy.com, LLC | 2 Sep 2020 | 8 Sep 2024 | 2 Sep 2025 |
| 135 | oakley.co.nz | - | 13 Aug 1998 | 7 Sep 2024 | - |
| 136 | oakley.uno | Hosting Ukraine LLC | 1 May 2023 | 13 Jun 2024 | 1 May 2024 |
| 137 | oakley.in.th | - | 27 Aug 2014 | 26 Sep 2023 | 26 Aug 2023 |
| 138 | oakley.io | 1API GmbH | 24 May 2013 | 24 May 2025 | 24 May 2026 |
| 139 | oakley.cm | - | 22 Jan 2020 | 23 Jan 2025 | 22 Jan 2026 |
| 140 | oakley.pe | - | - | - | - |
| 141 | oakley.ski | Gandi SAS | 15 Feb 2018 | 30 Apr 2025 | 15 Feb 2025 |
| 142 | oakley.work | GoDaddy.com, LLC | 9 May 2021 | 10 May 2025 | 9 May 2027 |
| 143 | oakley.sexy | NameCheap, Inc. | 29 Aug 2020 | 4 Aug 2024 | 29 Aug 2025 |
| 144 | oakley.gb.net | Ligne Web Services SARL | 15 Apr 2010 | 16 Apr 2025 | 15 Apr 2026 |
| 145 | oakley.uk.net | - | 19 Nov 2003 | 16 Dec 2024 | 19 Nov 2025 |
| 146 | oakley.onl | NameCheap, Inc. | 21 Dec 2023 | 1 Feb 2025 | 21 Dec 2024 |
| 147 | oakley.realtor | Name Share, Inc. | 24 Mar 2023 | 23 Apr 2024 | 24 Mar 2025 |
| 148 | oakley.nl | - | 10 Jan 2000 | 9 Dec 2024 | - |
| 149 | oakley.gdn | Intracom Middle East FZE | 7 Mar 2016 | 7 Mar 2025 | 7 Mar 2026 |
| 150 | oakley.sk | - | 21 Apr 2004 | 17 Apr 2025 | 21 Apr 2026 |
| 151 | oakley.se | - | 1 Dec 2006 | 22 Oct 2024 | 1 Dec 2025 |
| 152 | oakley.fr | SafeNames Ltd. | 12 Aug 2001 | 4 Mar 2025 | 12 Aug 2025 |
| 153 | oakley.dk | - | 28 Aug 2023 | - | 27 Aug 2025 |
| 154 | oakley.de | - | - | 12 Mar 2021 | - |
| 155 | oakley.eu | - | - | - | - |
| 156 | oakley.com.co | Register.it SPA | 25 Apr 2001 | 25 Mar 2025 | 26 Apr 2026 |
| 157 | oakley.cz | - | 26 Oct 2016 | 13 Jan 2025 | 26 Oct 2025 |
| 158 | oakley.net.co | Dynadot, LLC | 13 Nov 2024 | 18 Nov 2024 | 13 Nov 2025 |
| 159 | oakley.co.in | Dynadot, LLC | 31 Dec 2021 | 1 Jan 2025 | 31 Dec 2024 |
| 160 | oakley.me | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Oct 2019 | 3 Aug 2024 | 8 Oct 2025 |
| 161 | oakley.best | Dynadot, LLC | 16 Feb 2025 | 19 Mar 2025 | 16 Feb 2026 |
| 162 | oakley.us.org | NameCheap, Inc. | 15 May 2025 | 15 May 2025 | 15 May 2026 |
| 163 | oakley.co.at | - | - | 4 Jun 2025 | - |
| 164 | oakley.wedding | GoDaddy.com, LLC | 10 Jun 2025 | 10 Jun 2025 | 10 Jun 2026 |
| 165 | oakleysfakes.com | Realtime Register B.V. | 14 Oct 2024 | 13 Dec 2024 | 14 Oct 2025 |
| 166 | oakleyvault.com | Register.it SPA | 22 Mar 2017 | 30 May 2025 | 27 Apr 2026 |
| 167 | oakleymise.com | Name.com, Inc. | 19 Oct 2012 | 19 Oct 2012 | 19 Oct 2013 |
| 168 | oakleymainiti.com | - | 15 Oct 2016 | 15 Oct 2016 | 15 Oct 2017 |
| 169 | oakleysign.com | TierraNet Inc. d/b/a DomainDiscover | 20 Oct 1999 | 2 Nov 2023 | 20 Oct 2030 |
| 170 | oakleycoupon.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 22 Oct 2021 | 23 Oct 2021 | 22 Oct 2022 |
| 171 | oakleyglasseshut.com | GoDaddy.com, LLC | 15 Aug 2019 | 15 Aug 2019 | 15 Aug 2020 |
| 172 | oakleypbc.com | - | 21 May 2022 | 22 May 2023 | 21 May 2024 |
| 173 | oakleys-fake.org | ZNet Technologies Pvt Ltd. | 7 Nov 2016 | 7 Jan 2017 | 7 Nov 2017 |
| 174 | oakleyprojunior.com | Amazon Registrar, Inc. | 10 Nov 2006 | 6 Oct 2024 | 10 Nov 2025 |
| 175 | oakleyjponline.com | Domainshop LLC | 2 Nov 2018 | 3 Nov 2018 | 2 Nov 2019 |
| 176 | oakleyvinylsign.com | DreamHost, LLC | 17 Oct 2011 | 16 Sep 2024 | 18 Oct 2025 |
| 177 | oakleyamp-dev.co | Register.it SPA | 23 Nov 2014 | 25 Mar 2025 | 22 Nov 2025 |
| 178 | oakleyamp.co | Register.it SPA | 27 Nov 2013 | 25 Mar 2025 | 26 Nov 2025 |
| 179 | oakleyforum.com | NameCheap, Inc. | 5 Jan 2011 | 6 Dec 2024 | 5 Jan 2026 |
| 180 | oakleyglass.us.com | 1API GmbH | 6 Feb 2015 | 10 Apr 2017 | 6 Feb 2018 |
| 181 | oakleysi.com | Register.it SPA | 22 Mar 2017 | 4 Apr 2025 | 2 Mar 2026 |
| 182 | oakleytypeo.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 19 Jan 2025 | 8 Feb 2025 | 19 Jan 2026 |
| 183 | oakleysunglassyle.com | GoDaddy.com, LLC | 12 Apr 2022 | 24 May 2023 | 12 Apr 2023 |
| 184 | oakleyorchard.com | Tucows Domains Inc. | 22 Oct 2014 | 22 Sep 2024 | 22 Oct 2025 |
| 185 | oakleygallery.net | GMO Internet Inc. | 22 Oct 2014 | 22 Aug 2017 | 21 Oct 2018 |
| 186 | oakleyes.info | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 187 | oakleytopsales.com | Key-Systems GmbH | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 188 | oakleynursery.com | Tucows Domains Inc. | 26 Jun 2014 | 14 Aug 2023 | 26 Jun 2025 |
| 189 | oakleycoolshop.com | Register.it SPA | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 190 | oakleycoolmall.com | Register.it SPA | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 191 | oakleysunglassesstoress.net | Register.it SPA | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 192 | oakleysunglasseoutlet.net | Register.it SPA | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 193 | oakleyglasses.us.com | 1API GmbH | 3 Sep 2014 | 13 Oct 2014 | 3 Sep 2015 |
| 194 | oakleynotax.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Oct 2013 | 24 Oct 2014 | 21 Oct 2015 |
| 195 | oakleygoodsonline.com | Register.it SPA | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 196 | oakleysunglasses.us.com | 1API GmbH | 10 Mar 2014 | 4 Mar 2015 | 10 Mar 2016 |
| 197 | oakleysun.ru | - | - | - | - |
| 198 | oakleysunglasses.com.co | GoDaddy.com, LLC | 24 Jul 2021 | 30 Jul 2024 | 24 Jul 2025 |
| 199 | oakleyincsale.com | Bizcn.com, Inc. | 2 May 2015 | 2 May 2015 | 2 May 2016 |
| 200 | oakley-sydney.com | Register.it SPA | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 201 | oakleyshopping-usa.org | GoDaddy.com, LLC | 29 May 2014 | 10 Jun 2015 | 29 May 2016 |
| 202 | oakleysunglasseswholesale.biz | NameCheap, Inc. | 7 May 2018 | 10 May 2018 | 7 May 2019 |
| 203 | oakleysunglasses.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Sep 2019 | 18 Sep 2019 | 13 Sep 2020 |
| 204 | oakleysau.com | GMO Internet Inc. | 16 Jan 2018 | - | 16 Jan 2019 |
| 205 | oakleyexecutivetransfers.com | NameCheap, Inc. | 26 Oct 2018 | - | 26 Oct 2018 |
| 206 | oakleyerpanicbuy.com | GoDaddy.com, LLC | 5 Jun 2013 | 5 Jun 2015 | 5 Jun 2016 |
| 207 | oakleysunglasseoutlets.com | HiChina Zhicheng Technology Limited | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 208 | oakleyscanineculture.com | - | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2017 |
| 209 | oakleyjames.com | Porkbun, LLC | 6 Mar 2020 | 5 Mar 2025 | 6 Mar 2026 |
| 210 | oakleysau.net | Register.it SPA | 18 Jan 2018 | 18 Jan 2018 | 18 Jan 2019 |
| 211 | oakleys2014.com | TurnCommerce, Inc. DBA NameBright.com | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 212 | oakleyprostores.com | GoDaddy.com, LLC | 28 Oct 2014 | 31 Oct 2016 | 28 Oct 2017 |
| 213 | oakleylove-au.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 214 | oakley-sunglasses-outlet-sale.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 215 | oakleysunglassestore.net | HiChina Zhicheng Technology Limited | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 216 | oakleyconcrete.com | Network Solutions, LLC | 12 Apr 2025 | 12 Apr 2025 | 12 Apr 2026 |
| 217 | oakley-showy.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 29 Oct 2014 | 1 Nov 2015 | 29 Oct 2016 |
| 218 | oakley-ng.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 219 | oakleyroadministries.org | GoDaddy.com, LLC | 12 Jul 2007 | 13 May 2015 | 12 Jul 2015 |
| 220 | oakleysgarage.com | GoDaddy.com, LLC | 14 Jun 2024 | 14 Jun 2024 | 14 Jun 2027 |
| 221 | oakleycaregroup.com | GoDaddy.com, LLC | 15 Apr 2024 | 15 Apr 2024 | 15 Apr 2027 |
| 222 | oakleycare.com | 1&1 Internet AG | 25 Sep 2023 | 5 Dec 2023 | 25 Sep 2025 |
| 223 | oakleyconcrete.net | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2017 |
| 224 | oakley-sells.com | Register.it SPA | 22 Jan 2018 | 22 Jan 2018 | 22 Jan 2019 |
| 225 | oakleypresent.com | Foshan YiDong Network Co., LTD | 21 May 2014 | 2 Jul 2015 | 21 May 2015 |
| 226 | oakleysunglasses.info | Dynadot, LLC | 9 May 2018 | 10 May 2020 | 9 May 2021 |
| 227 | oakleyking.com | - | - | - | - |
| 228 | oakleysgrille.com | NameCheap, Inc. | 15 Apr 2011 | 7 Apr 2024 | 15 Apr 2026 |
| 229 | oakley-shoppe.us | GoDaddy.com, LLC | 27 Jul 2014 | 31 Jul 2015 | 26 Jul 2016 |
| 230 | oakley82.com | GoDaddy.com, LLC | 10 Aug 2012 | 12 Sep 2022 | 10 Aug 2027 |
| 231 | oakley-showy.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 232 | oakleyfortune.com | - | - | - | - |
| 233 | oakleypleasant.com | Xin Net Technology Corporation | 14 May 2014 | 13 Jun 2015 | 14 May 2015 |
| 234 | oakleysplendid.com | Foshan YiDong Network Co., LTD | 21 May 2014 | 2 Jul 2015 | 21 May 2015 |
| 235 | oakleycountry.com | Above.com Pty Ltd. | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2016 |
| 236 | oakleyscoupon.com | GoDaddy.com, LLC | 17 May 2014 | 29 May 2015 | 17 May 2016 |
| 237 | oakleykingdom.com | Foshan YiDong Network Co., LTD | 13 May 2014 | 24 Jun 2015 | 13 May 2015 |
| 238 | oakleygorgeous.com | Foshan YiDong Network Co., LTD | 12 May 2014 | 23 Jun 2015 | 12 May 2015 |
| 239 | oakleyend.com | Foshan YiDong Network Co., LTD | 7 May 2014 | 19 Jun 2015 | 7 May 2015 |
| 240 | oakleywoods.com | Wild West Domains, LLC | 9 Sep 1997 | 25 Jun 2024 | 8 Sep 2025 |
| 241 | oakleyideal.com | - | - | - | - |
| 242 | oakleyctr.com | Webfusion Ltd. | 27 Jun 2013 | 14 Jul 2015 | 27 Jun 2016 |
| 243 | oakleybeat.net | Tucows Domains Inc. | 31 Oct 2014 | 11 Jan 2024 | 31 Oct 2023 |
| 244 | oakley-vogue.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 245 | oakley-sells.net | Register.it SPA | 22 Jan 2018 | 22 Jan 2018 | 22 Jan 2019 |
| 246 | oakleysunglassesby.com | Dynadot12 LLC | 8 Aug 2022 | 18 Oct 2023 | 8 Aug 2023 |
| 247 | oakleynycstore.com | Bizcn.com, Inc. | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 248 | oakleycybermondaydeals2014.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 2 Nov 2014 | 6 Nov 2015 | 2 Nov 2016 |
| 249 | oakleycybermondayblackfriday2014.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 2 Nov 2014 | 6 Nov 2015 | 2 Nov 2016 |
| 250 | oakleyblackfridaysales2014.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 2 Nov 2014 | 6 Nov 2015 | 2 Nov 2016 |
| 251 | oakleyblackfridaycybermonday2014.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 252 | oakleylovely.com | GoDaddy.com, LLC | 6 Jun 2013 | 7 Jun 2015 | 6 Jun 2016 |
| 253 | oakleypoint.com | Foshan YiDong Network Co., LTD | 21 May 2014 | 2 Jul 2015 | 21 May 2015 |
| 254 | oakleybigbass.com | GoDaddy.com, LLC | 19 Oct 2009 | 20 Oct 2024 | 19 Oct 2025 |
| 255 | oakleyjoy.com | GoDaddy.com, LLC | 6 Jun 2013 | 5 Jun 2014 | 6 Jun 2015 |
| 256 | oakley-sells.us | Tucows Domains Inc. | 22 Jan 2018 | 17 Jan 2022 | 22 Jan 2023 |
| 257 | oakleysunglasses-wholesales.com | NameCheap, Inc. | 2 Nov 2020 | 6 Nov 2024 | 2 Nov 2025 |
| 258 | oakleyoutletsonsales.com | GMO Internet Inc. | 9 Jun 2020 | 9 Jun 2020 | 9 Jun 2021 |
| 259 | oakleyoutlet-discount.com | NameCheap, Inc. | 20 Jan 2025 | 20 Jan 2025 | 20 Jan 2026 |
| 260 | oakleyfavor.com | CommuniGal Communication Ltd. | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 261 | oakleyhope.com | CommuniGal Communication Ltd. | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 262 | oakleygrace.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 27 Nov 2018 | 28 Nov 2018 | 27 Nov 2019 |
| 263 | oakley-hungary.org | GoDaddy.com, LLC | 2 Nov 2014 | 31 Oct 2016 | 2 Nov 2017 |
| 264 | oakley-aol.com | GoDaddy.com, LLC | 6 Aug 2014 | 20 Apr 2015 | 6 Aug 2015 |
| 265 | oakleyperfect.com | Xin Net Technology Corporation | 14 May 2014 | 13 Jun 2015 | 14 May 2015 |
| 266 | oakleychic.com | - | - | - | - |
| 267 | oakleyspring.com | Xin Net Technology Corporation | 4 Jun 2014 | 4 Jul 2015 | 4 Jun 2015 |
| 268 | oakleycircle.com | - | - | - | - |
| 269 | oakleycustomer.com | NamePal.com, LLC | 26 Jul 2015 | 26 Jul 2015 | 26 Jul 2016 |
| 270 | oakleys-official.com | Register.it SPA | 23 Jan 2018 | 23 Jan 2018 | 23 Jan 2019 |
| 271 | oakleyresidental.com | eNom, Inc. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 272 | oakleypure.com | GoDaddy.com, LLC | 31 Mar 2021 | 11 Jun 2025 | 31 Mar 2025 |
| 273 | oakley-eyewear.us | GoDaddy.com, LLC | 29 Jun 2014 | 10 Jul 2017 | 28 Jun 2017 |
| 274 | oakleybuynow.com | Xin Net Technology Corporation | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 275 | oakleynice1.com | Xin Net Technology Corporation | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 276 | oakleysport-uk.net | GoDaddy.com, LLC | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 277 | oakleysport-uk.org | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Aug 2014 | - | 17 Aug 2015 |
| 278 | oakleystore1.com | DropCatch.com 911 LLC | 4 Nov 2016 | 14 Dec 2017 | 4 Nov 2017 |
| 279 | oakleysunglasess.com | Xin Net Technology Corporation | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 280 | oakleyemeab2b.com | Network Solutions, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 281 | oakley-eshop.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Aug 2014 | 18 Aug 2014 | 17 Aug 2015 |
| 282 | oakleyeyewear-uscoupon.com | Foshan YiDong Network Co., LTD | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 283 | oakleyeyewearfactory.com | Foshan YiDong Network Co., LTD | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 284 | oakleyeyewearmarket.com | GoDaddy.com, LLC | 21 Jan 2019 | 21 Jan 2019 | 21 Jan 2020 |
| 285 | oakleyeyewearshop-us.com | GoDaddy.com, LLC | 8 Mar 2019 | 8 Mar 2019 | 8 Mar 2020 |
| 286 | oakleyeyewearshop-usa.com | Foshan YiDong Network Co., LTD | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 287 | oakleyno1-us.com | Xin Net Technology Corporation | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 288 | oakleyno98-us.com | Xin Net Technology Corporation | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 289 | oakleys-uk.org | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 290 | oakleysmile.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 291 | oakleyst.com | NameCheap, Inc. | 25 Sep 2024 | 25 Sep 2024 | 25 Sep 2028 |
| 292 | oakleystore1-us.com | Xin Net Technology Corporation | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 293 | oakleywink.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 294 | oakleytv.com | GoDaddy.com, LLC | 31 Dec 2014 | 2 Jul 2015 | 31 Dec 2015 |
| 295 | oakley-king.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 296 | oakley-storm.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 297 | oakley-storms.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 298 | oakleycheap-espana.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 299 | oakleyempire.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 22 Aug 2015 | 19 Aug 2016 |
| 300 | oakleying-au.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 301 | oakleyliveshop.com | eNom, Inc. | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 302 | oakleyoutlet-styles.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 22 Aug 2015 | 19 Aug 2016 |
| 303 | oakleyoutlet-vip.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 304 | oakleyoutlet-vips.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 305 | oakleyrecycles.com | GoDaddy.com, LLC | 19 Aug 2014 | 8 Jun 2017 | 19 Aug 2019 |
| 306 | oakleyrecycles.org | GoDaddy.com, LLC | 19 Aug 2014 | 8 Jun 2017 | 19 Aug 2019 |
| 307 | oakleysale-espana.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 308 | oakleysalon.com | Google, Inc. | 20 Aug 2014 | 5 Aug 2024 | 20 Aug 2025 |
| 309 | oakleys-official.org | Register.it SPA | 22 Jan 2018 | - | 22 Jan 2019 |
| 310 | oakleys-official.net | Register.it SPA | 23 Jan 2018 | 23 Jan 2018 | 23 Jan 2019 |
| 311 | oakley-endsville.us | Internet.bs Corp. | 4 Nov 2014 | 4 Nov 2014 | 3 Nov 2015 |
| 312 | oakleyostentacao.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 313 | oakleysunglassescheap90off.com | - | 26 Sep 2016 | 26 Sep 2016 | 26 Sep 2017 |
| 314 | oakley--vault.com | OnlineNIC, Inc. | 7 Nov 2015 | 25 Oct 2016 | 7 Nov 2017 |
| 315 | oakley-global.com | GoDaddy.com, LLC | 21 Aug 2014 | 1 Sep 2016 | 21 Aug 2017 |
| 316 | oakleys-global.com | GoDaddy.com, LLC | 21 Aug 2014 | 1 Sep 2016 | 21 Aug 2017 |
| 317 | oakleysale-brazil.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 20 Aug 2014 | 24 Aug 2015 | 20 Aug 2016 |
| 318 | oakleysale-global.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 319 | oakleysale-poland.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 20 Aug 2014 | 24 Aug 2015 | 20 Aug 2016 |
| 320 | oakleysaleonlinestore.us | GoDaddy.com, LLC | 20 Aug 2014 | 27 Apr 2015 | 19 Aug 2015 |
| 321 | oakleyshop-global.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 24 Aug 2015 | 21 Aug 2016 |
| 322 | oakleystore-global.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 323 | oakleywebonline.com | GoDaddy.com, LLC | 20 Aug 2014 | 1 Sep 2016 | 20 Aug 2017 |
| 324 | oakleylocks.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2016 |
| 325 | oakleylawschool.com | eNom, Inc. | 3 Feb 2017 | 3 Feb 2017 | 3 Feb 2022 |
| 326 | oakley-european.com | Register.it SPA | 26 Jan 2018 | 26 Jan 2018 | 26 Jan 2019 |
| 327 | oakley-center.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 328 | oakley-cheapper.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 329 | oakleyfashion.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 330 | oakleysalesonline.com | Shanghai Meicheng Technology Information Co., Ltd | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 331 | oakleytrade.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 332 | oakley-globalshop.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 333 | oakley-hungary.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 12 Oct 2023 | 13 Oct 2024 | 12 Oct 2025 |
| 334 | oakleybuy-hungary.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 335 | oakleyhut-hungary.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 336 | oakleying-hungary.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 337 | oakleyonlinevip.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 338 | oakleysale-chile.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 339 | oakleysale-dk.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 340 | oakleysale-hungary.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 341 | oakleyshop-chile.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 342 | oakleyshoppe-dk.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 343 | oakleystore-dk.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 344 | oakleystore-hungary.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 345 | oakleyitied.com | HiChina Zhicheng Technology Limited | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 346 | oakleyoutletstore.us | Tucows Domains Inc. | 22 Jan 2018 | 17 Jan 2022 | 22 Jan 2023 |
| 347 | oakleyonline.us | Tucows Domains Inc. | 22 Jan 2018 | 17 Jan 2022 | 22 Jan 2023 |
| 348 | oakleyclearance.us | Tucows Domains Inc. | 22 Jan 2018 | 17 Jan 2022 | 22 Jan 2023 |
| 349 | oakley-europe.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 6 Nov 2014 | 9 Nov 2015 | 6 Nov 2016 |
| 350 | oakleysgroundcare.com | Beijing Lanhai Jiye Technology Co., Ltd | 14 May 2024 | 12 May 2025 | 14 May 2026 |
| 351 | oakley-bing.com | GoDaddy.com, LLC | 22 Aug 2014 | 1 Sep 2016 | 22 Aug 2017 |
| 352 | oakley-do.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 25 Aug 2015 | 22 Aug 2016 |
| 353 | oakley-keep.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 354 | oakley-luxury.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 355 | oakley-luxurys.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 356 | oakley-me.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 25 Aug 2015 | 22 Aug 2016 |
| 357 | oakley-nicecoupon.com | Foshan YiDong Network Co., LTD | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 358 | oakley-shoppings.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 359 | oakley-tops.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 360 | oakley-win.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 361 | oakley2014online.com | Xin Net Technology Corporation | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 362 | oakleybuy-global.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 363 | oakleyclearancesale.com | Xin Net Technology Corporation | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 364 | oakleycyclingglasses.com | Tucows Domains Inc. | 19 Aug 2013 | 23 Aug 2014 | 19 Aug 2015 |
| 365 | oakleyeyewear-ca.com | Foshan YiDong Network Co., LTD | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 366 | oakleyeyewear-usstore.com | Foshan YiDong Network Co., LTD | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 367 | oakleyfriday.com | GoDaddy.com, LLC | 22 Aug 2014 | 1 Sep 2016 | 22 Aug 2017 |
| 368 | oakleyonline-global.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 369 | oakleyoutet-global.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 370 | oakleysnowgoggles.com | Tucows Domains Inc. | 19 Aug 2013 | 23 Aug 2014 | 19 Aug 2015 |
| 371 | oakleyzones.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 372 | oakley-mode.com | Shanghai Meicheng Technology Information Co., Ltd | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 373 | oakley-style.com | Shanghai Meicheng Technology Information Co., Ltd | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 374 | oakleyoutletstores.com | NameCheap, Inc. | 15 Apr 2022 | 27 Jun 2024 | 15 Apr 2024 |
| 375 | oakleys-popular.com | Shanghai Meicheng Technology Information Co., Ltd | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 376 | oakleysunglassesoutletusa.com | 1API GmbH | 16 Apr 2019 | 16 Apr 2019 | 16 Apr 2020 |
| 377 | oakleyusedcars.com | GoDaddy.com, LLC | 28 Dec 2018 | 8 Feb 2025 | 28 Dec 2024 |
| 378 | oakley-find.com | GoDaddy.com, LLC | 23 Aug 2014 | 1 Sep 2016 | 23 Aug 2017 |
| 379 | oakley-great.com | GoDaddy.com, LLC | 23 Aug 2014 | 1 Sep 2016 | 23 Aug 2017 |
| 380 | oakley-rayban.com | GoDaddy.com, LLC | 10 Sep 2018 | 10 Sep 2018 | 10 Sep 2019 |
| 381 | oakley-web.com | GoDaddy.com, LLC | 23 Aug 2014 | 1 Sep 2016 | 23 Aug 2017 |
| 382 | oakleylove-hungary.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 383 | oakleysale-hu.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 384 | oakleystore-hu.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 385 | oakleytop-hungary.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 386 | oakleyuk-store.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Aug 2013 | 23 Aug 2014 | 19 Aug 2015 |
| 387 | oakleyvip-hungary.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 388 | oakleylawschool.net | Register.it SPA | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 389 | oakley-european.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 390 | oakley-europe.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 391 | oakley-es.info | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 392 | oakleysaleonlinestore.com | GoDaddy.com, LLC | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 393 | oakleyssunglassesmobo.com | eNom, Inc. | 15 Apr 2020 | 15 Apr 2020 | 15 Apr 2021 |
| 394 | oakleysunglass-outlet.com | eName Technology Co., Ltd. | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 395 | oakleysunglasses2014.net | Shanghai Meicheng Technology Information Co., Ltd | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 396 | oakleysupers.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 397 | oakleybla-uk.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 398 | oakleyvip-dk.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 399 | oakleyvip-hu.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 400 | oakleyvip-it.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 401 | oakleyvip-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 402 | oakley-europeans.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 8 Nov 2014 | 11 Nov 2015 | 8 Nov 2016 |
| 403 | oakleyschool.org | Register.it SPA | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 404 | oakleylawschool.org | Register.it SPA | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 405 | oakley-european.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 406 | oakleybrand-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 407 | oakleybuy-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 408 | oakleycheap.us | - | 5 Sep 2016 | 5 Sep 2016 | 4 Sep 2017 |
| 409 | oakleyconstructionltd.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Jun 2017 | 24 Jun 2024 | 27 Jun 2025 |
| 410 | oakleyeyeglass.org | HiChina Zhicheng Technology Limited | 13 Aug 2014 | - | 13 Aug 2015 |
| 411 | oakleyfashion-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 412 | oakleyhot2014.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 413 | oakleyhut-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 414 | oakleyofficialsite.us | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 12 Aug 2015 |
| 415 | oakleyonline-australia.com | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 416 | oakleyonline-australia.net | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 417 | oakleyonline-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 418 | oakleys-cheap.us | Internet.bs Corp. | 13 Aug 2014 | 13 Aug 2014 | 12 Aug 2015 |
| 419 | oakleys-store.info | GMO Internet Inc. | 12 Aug 2014 | - | 12 Aug 2015 |
| 420 | oakleys2alls.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 421 | oakleysale-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 17 Aug 2015 | 14 Aug 2016 |
| 422 | oakleysave.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 423 | oakleysca.net | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 424 | oakleysca.org | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 425 | oakleyshop-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 426 | oakleyshoppe-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 427 | oakleyshopping-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 428 | oakleystore-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 429 | oakleystores-au.com | Name.com, Inc. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 430 | oakleysunglassesmaba.com | - | 12 Dec 2024 | 12 Dec 2024 | 12 Dec 2025 |
| 431 | oakleysunglassessus.com | Xin Net Technology Corporation | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 432 | oakleysunglassinsc.com | Webfusion Ltd. | 17 Jan 2022 | 18 Jan 2022 | 17 Jan 2023 |
| 433 | oakleyedm.com | Moniker Online Services LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 434 | oakley-finlands.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 23 Aug 2013 | 26 Aug 2014 | 23 Aug 2015 |
| 435 | oakley-new.com | Bizcn.com, Inc. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 436 | oakleybuying-dk.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 437 | oakleylive-spain.com | eNom, Inc. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 438 | oakleylivemall.com | GoDaddy.com, LLC | 26 Aug 2014 | 1 Sep 2016 | 26 Aug 2017 |
| 439 | oakleylivestore.com | GoDaddy.com, LLC | 26 Aug 2014 | 1 Sep 2016 | 26 Aug 2017 |
| 440 | oakley-europeans.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 8 Nov 2014 | 11 Nov 2015 | 8 Nov 2016 |
| 441 | oakley-europeans.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 8 Nov 2014 | 11 Nov 2015 | 8 Nov 2016 |
| 442 | oakley-brandmall.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 443 | oakley-buying.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 444 | oakley-buying.us | Internet.bs Corp. | 14 Aug 2014 | 14 Aug 2014 | 13 Aug 2015 |
| 445 | oakley-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 446 | oakley-outletmall.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 447 | oakleybrandmall.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 18 Aug 2015 | 14 Aug 2016 |
| 448 | oakleyfashionshop.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jan 2018 | 25 Jan 2018 | 25 Jan 2019 |
| 449 | oakleyfashionshoppe.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 450 | oakleyhotsale-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 451 | oakleying-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 452 | oakleying.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 453 | oakleylove-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 454 | oakleymall-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 455 | oakleymore-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 456 | oakleyonline-australia.org | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 457 | oakleyonline-eu.net | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 458 | oakleyonline-eu.org | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 459 | oakleys-brandmall.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 460 | oakleys-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 461 | oakleys-outletmall.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 462 | oakleyshopjp.com | Hangzhou AiMing Network Co., LTD | 19 Jan 2021 | 19 Jan 2021 | 19 Jan 2022 |
| 463 | oakleyssunglassoutlet.net | GoDaddy.com, LLC | 17 Mar 2017 | 17 Mar 2017 | 17 Mar 2018 |
| 464 | oakleystore-au.org | Name.com, Inc. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 465 | oakleytop-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 466 | oakley-cluster.net | Register.it SPA | 28 Jan 2018 | 28 Jan 2018 | 28 Jan 2019 |
| 467 | oakley-mycamall.com | Bizcn.com, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 468 | oakley-mycaoutlet.com | Bizcn.com, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 469 | oakley-mycastore.com | Bizcn.com, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 470 | oakley-mymall.com | Bizcn.com, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 471 | oakley-mystore.com | Bizcn.com, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 472 | oakley-mystyle.com | Bizcn.com, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 473 | oakley-onlinestores.com | Shanghai Meicheng Technology Information Co., Ltd | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 474 | oakleysfriday.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2016 | 28 Aug 2017 |
| 475 | oakleystyles.com | Annulet LLC | 10 Feb 2016 | 28 Mar 2017 | 10 Feb 2018 |
| 476 | oakleyinternational.com | NameKing.com Inc. | 2 Aug 2024 | 3 Mar 2025 | 2 Aug 2025 |
| 477 | oakley-joy.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 478 | oakley-modern.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 479 | oakley-offer.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 480 | oakley-offers.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 18 Aug 2015 | 15 Aug 2016 |
| 481 | oakley-officials.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 18 Aug 2015 | 15 Aug 2016 |
| 482 | oakleyexpress-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 483 | oakleyeyewear-usastore.com | Foshan YiDong Network Co., LTD | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 484 | oakleyhot-israel.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Aug 2014 | 19 Aug 2015 | 16 Aug 2016 |
| 485 | oakleyonline-japan.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 12 Aug 2013 | 15 Aug 2014 | 12 Aug 2015 |
| 486 | oakleypop-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 487 | oakleypurchase-no.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 488 | oakleys-israel.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 489 | oakleysale-israel.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 490 | oakleystore-israel.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 491 | oakley-aus.com | GoDaddy.com, LLC | 28 Aug 2014 | 29 Aug 2016 | 28 Aug 2017 |
| 492 | oakley-elove.com | - | 11 Jan 2022 | 12 Jan 2022 | 11 Jan 2023 |
| 493 | oakleyplan.com | GoDaddy.com, LLC | 29 Aug 2014 | 1 Sep 2016 | 29 Aug 2017 |
| 494 | oakleystoresale.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 495 | oakleyus-store.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 496 | oakleyusa-shop.com | DOMAIN NAME NETWORK PTY LTD | 4 Aug 2021 | 4 Aug 2021 | 4 Aug 2022 |
| 497 | oakley-eshop.net | 35 Technology Co., Ltd. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 498 | oakley-outdoors.com | GoDaddy.com, LLC | 24 Dec 2023 | 3 Feb 2025 | 24 Dec 2024 |
| 499 | oakleydiscountsunglass2013.org | GMO Internet Inc. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 500 | oakleyjpmart.com | eNom, Inc. | 16 Aug 2014 | 17 Aug 2014 | 16 Aug 2015 |
| 501 | oakleys-online.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 502 | oakleysunglasses9k.com | GMO Internet Inc. | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 503 | oakleyconsulting.net | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2016 | 11 Nov 2017 |
| 504 | oakley-cluster.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 505 | oakley-sunglasses.info | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 2 Jun 2024 | 4 Jun 2025 | 2 Jun 2026 |
| 506 | oakleycybermondaydeal.net | Register.it SPA | 30 Jan 2018 | 4 Mar 2021 | 30 Jan 2022 |
| 507 | oakley-onlinesales.com | GoDaddy.com, LLC | 11 Sep 2014 | 1 Sep 2016 | 11 Sep 2017 |
| 508 | oakley-salesmall.com | Bizcn.com, Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 509 | oakley-salesonline.com | Bizcn.com, Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 510 | oakleynum100.com | GoDaddy.com, LLC | 11 Sep 2014 | 1 Sep 2016 | 11 Sep 2017 |
| 511 | oakleyshop100.com | GoDaddy.com, LLC | 11 Sep 2014 | 1 Sep 2016 | 11 Sep 2017 |
| 512 | oakleyvaleprimary.org | CSC Corporate Domains, Inc. | 11 Sep 2014 | 18 Mar 2025 | 11 Sep 2025 |
| 513 | oakleystorejapan.com | GMO Internet Inc. | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 514 | oakleycheapsjp.com | Register.it SPA | 1 Feb 2018 | 6 Mar 2021 | 1 Feb 2022 |
| 515 | oakley-saleshopping.com | Bizcn.com, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 516 | oakley-salesshop.com | Bizcn.com, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 517 | oakley-shopsales.com | GoDaddy.com, LLC | 29 Aug 2014 | 1 Sep 2016 | 29 Aug 2017 |
| 518 | oakleyasonnenbrille1912.info | Dynadot, LLC | 10 Apr 2019 | 11 Apr 2020 | 10 Apr 2021 |
| 519 | oakleyhomechurch.com | Launchpad, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 520 | oakleyhomechurch.org | Launchpad, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 521 | oakleysale-australia.com | eNom, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 522 | oakleysunglassesmall-australia.com | eNom, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 523 | oakley-sunglasses-shop.com | enom439, Incorporated | 21 Jul 2019 | 22 Jul 2019 | 21 Jul 2020 |
| 524 | oakleyeyewearcoupon-us.com | 35 Technology Co., Ltd. | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 525 | oakleyeyewearcoupon-usa.com | GoDaddy.com, LLC | 13 Sep 2014 | 30 Sep 2016 | 13 Sep 2017 |
| 526 | oakleysalesus.com | GoDaddy.com, LLC | 12 Sep 2014 | 1 Sep 2016 | 12 Sep 2017 |
| 527 | oakleysunglassales.com | GoDaddy.com, LLC | 17 Dec 2021 | 17 Dec 2021 | 17 Dec 2022 |
| 528 | oakleysunglasseoutlet.com | GoDaddy.com, LLC | 13 Sep 2014 | 1 Sep 2016 | 13 Sep 2017 |
| 529 | oakleysunglassesstoress.com | GoDaddy.com, LLC | 13 Sep 2014 | 1 Sep 2016 | 13 Sep 2017 |
| 530 | oakleyeu.org | GoDaddy.com, LLC | 12 Sep 2014 | 8 Oct 2017 | 12 Sep 2018 |
| 531 | oakley-eyewears.us | GoDaddy.com, LLC | 11 Sep 2014 | 26 Oct 2024 | 10 Sep 2025 |
| 532 | oakleys-shoppe.us | GoDaddy.com, LLC | 11 Sep 2014 | 26 Oct 2024 | 10 Sep 2025 |
| 533 | oakley-malls.com | GoDaddy.com, LLC | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 534 | oakley-shoppingsale.com | GoDaddy.com, LLC | 13 Sep 2014 | 30 Sep 2016 | 13 Sep 2017 |
| 535 | oakleybla-fr.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 536 | oakleylineoutlet.com | HiChina Zhicheng Technology Limited | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 537 | oakleysale-ukr.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 538 | oakleysalefr.com | GoDaddy.com, LLC | 31 Aug 2014 | 1 Sep 2016 | 31 Aug 2017 |
| 539 | oakleyvip-fr.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 540 | oakley-australian.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 541 | oakley-cheaps.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 542 | oakley-euro.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 543 | oakleybuy.net | GoDaddy.com, LLC | 15 Sep 2014 | 1 Sep 2016 | 15 Sep 2017 |
| 544 | oakleybuying.net | GoDaddy.com, LLC | 15 Sep 2014 | 1 Sep 2016 | 15 Sep 2017 |
| 545 | oakleymore.net | GoDaddy.com, LLC | 15 Sep 2014 | 1 Sep 2016 | 15 Sep 2017 |
| 546 | oakleys-australia.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 547 | oakleys-global.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 548 | oakleys-ing.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 549 | oakleysales.net | GoDaddy.com, LLC | 15 Sep 2014 | 1 Sep 2016 | 15 Sep 2017 |
| 550 | oakley-spot.com | GoDaddy.com, LLC | 15 Sep 2014 | 30 Sep 2016 | 15 Sep 2017 |
| 551 | oakleyofsale.com | GoDaddy.com, LLC | 14 Sep 2014 | 1 Sep 2016 | 14 Sep 2017 |
| 552 | oakleys-spot.com | GoDaddy.com, LLC | 15 Sep 2014 | 30 Sep 2016 | 15 Sep 2017 |
| 553 | oakleysaleonlineshop.com | GoDaddy.com, LLC | 15 Sep 2014 | 1 Sep 2016 | 15 Sep 2017 |
| 554 | oakley-ita.com | 35 Technology Co., Ltd. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 555 | oakleyforus.com | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 556 | oakleyisunglassessale.com | HiChina Zhicheng Technology Limited | 9 Dec 2016 | 10 Dec 2017 | 9 Dec 2017 |
| 557 | oakleyonline-nz.com | 35 Technology Co., Ltd. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 558 | oakleyshop-ita.com | 35 Technology Co., Ltd. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 559 | oakleyshop-nz.com | 35 Technology Co., Ltd. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 560 | oakleyvip.com | PSI-USA, Inc. dba Domain Robot | 20 Nov 2023 | 19 Nov 2024 | 20 Nov 2024 |
| 561 | oakley-shoppe.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Sep 2014 | 20 Sep 2015 | 16 Sep 2016 |
| 562 | oakleysunshine.com | GoDaddy.com, LLC | 17 Sep 2014 | 30 Sep 2016 | 17 Sep 2017 |
| 563 | oakleychok.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 564 | oakleysunglassescheap.name | GoDaddy.com, LLC | - | - | - |
| 565 | oakleysunglassesby.net | eNom, Inc. | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 566 | oakleysunglasses-wholesale.net | Dynadot, LLC | 10 Dec 2024 | 19 Dec 2024 | 10 Dec 2025 |
| 567 | oakleysunglasses-outlet.name | NameCheap, Inc. | - | - | - |
| 568 | oakleyblackfriday2014.net | Jiangsu Bangning Science and technology Co. Ltd. | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 569 | oakley-globasale.com | GoDaddy.com, LLC | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 570 | oakley-hungary.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 571 | oakley-nicemode.com | 35 Technology Co., Ltd. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 572 | oakleyhutofficial.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 573 | oakleyitaly.us | GoDaddy.com, LLC | 2 Sep 2014 | 1 Sep 2017 | 1 Sep 2018 |
| 574 | oakleymouru.com | GoDaddy.com, LLC | 3 Sep 2014 | 1 Sep 2016 | 3 Sep 2017 |
| 575 | oakleyonline-nz.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 2 Sep 2014 | 5 Sep 2015 | 2 Sep 2016 |
| 576 | oakleyoutletofficial.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 577 | oakleyquickprofitsathome.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 578 | oakleysonlinesshop.com | GoDaddy.com, LLC | 3 Sep 2014 | 1 Sep 2016 | 3 Sep 2017 |
| 579 | oakleyspain.us | GoDaddy.com, LLC | 2 Sep 2014 | 1 Sep 2017 | 1 Sep 2018 |
| 580 | oakleysunglasses-wholesale.name | Dynadot, LLC | - | - | - |
| 581 | oakley-australian.com | GoDaddy.com, LLC | 16 Sep 2014 | 30 Sep 2016 | 16 Sep 2017 |
| 582 | oakley-sunglassoutlet.com | eNom, Inc. | 5 Dec 2017 | 4 Dec 2017 | 5 Dec 2018 |
| 583 | oakleyonlinestores.com | GoDaddy.com, LLC | 15 Sep 2014 | 1 Sep 2016 | 15 Sep 2017 |
| 584 | oakleysunrooms.com | HiChina Zhicheng Technology Limited | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2016 |
| 585 | oakleysunglassesoutlet.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Nov 2014 | 15 Nov 2014 | 14 Nov 2015 |
| 586 | oakleyssunglassoutlet.com | Cloud Yuqu LLC | 16 Mar 2021 | 16 Mar 2021 | 16 Mar 2022 |
| 587 | oakleycheapsaleonline.com | Register.it SPA | 3 Feb 2018 | 8 Mar 2021 | 3 Feb 2022 |
| 588 | oakleys-shopping.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 589 | oakley-euro.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 590 | oakley-hybris-emea.com | Network Solutions, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 591 | oakley-usonsales.com | Shanghai Meicheng Technology Information Co., Ltd | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 592 | oakleyaccod.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 593 | oakleyalmo.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 594 | oakleyangel.com | FastDomain Inc. | 21 Nov 2022 | 3 Feb 2024 | 21 Nov 2023 |
| 595 | oakleyasonnenbrille1911.info | Japan Registry Services Co., Ltd. | 3 Sep 2014 | 1 Aug 2017 | 3 Sep 2018 |
| 596 | oakleybear.com | GoDaddy.com, LLC | 25 May 2022 | 26 May 2025 | 25 May 2026 |
| 597 | oakleyblackfriday.com | GoDaddy.com, LLC | 25 Nov 2020 | 25 Nov 2020 | 25 Nov 2021 |
| 598 | oakleycere.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 599 | oakleyconstructiongroup.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2016 |
| 600 | oakleygard.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 601 | oakleylina.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 602 | oakleymom.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 603 | oakleyonline-hu.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 604 | oakleypax.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 605 | oakleyrole.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 606 | oakleyscustom.com | Launchpad, Inc. | 3 Sep 2014 | 19 Aug 2017 | 3 Sep 2018 |
| 607 | oakleyscustomwoodworks.com | Launchpad, Inc. | 3 Sep 2014 | 19 Aug 2017 | 3 Sep 2018 |
| 608 | oakleysunglassesmodo.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 11 Jul 2023 | 27 Jun 2024 | 11 Jul 2025 |
| 609 | oakleyswood.com | Launchpad, Inc. | 3 Sep 2014 | 19 Aug 2017 | 3 Sep 2018 |
| 610 | oakleyswoodworks.com | Launchpad, Inc. | 3 Sep 2014 | 19 Aug 2017 | 3 Sep 2018 |
| 611 | oakleysport-ca.net | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 612 | oakley-hun.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 17 Sep 2014 | 20 Sep 2015 | 17 Sep 2016 |
| 613 | oakleyradarpathsunglassesreview.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2016 | 18 Sep 2017 |
| 614 | oakleyhalfjacketsunglassesreview.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2016 | 18 Sep 2017 |
| 615 | oakleyshop.net | HiChina Zhicheng Technology Limited | 8 Dec 2018 | 8 Dec 2018 | 8 Dec 2019 |
| 616 | oakley-online2014.com | HiChina Zhicheng Technology Limited | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 617 | oakley-rambo.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 618 | oakleyoakleyoutlet.us | NameCheap, Inc. | 3 Dec 2016 | 3 Dec 2016 | 2 Dec 2017 |
| 619 | oakleysport-ca.com | GoDaddy.com, LLC | 17 Sep 2014 | 30 Sep 2016 | 17 Sep 2017 |
| 620 | oakleykambel.com | Wild West Domains, LLC | 4 Sep 2014 | 21 Aug 2016 | 4 Sep 2017 |
| 621 | oakleyoutlet-nz.com | 35 Technology Co., Ltd. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 622 | oakleyrealty.com | GoDaddy.com, LLC | 23 Jan 2016 | 24 Jan 2024 | 23 Jan 2026 |
| 623 | oakleysunglassesviews.com | NameCheap, Inc. | 29 Jul 2022 | 10 Sep 2023 | 29 Jul 2023 |
| 624 | oakleylove-uk.net | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 625 | oakleyofficialshops.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 626 | oakleyuk4u.com | GoDaddy.com, LLC | 2 Aug 2013 | 18 Sep 2014 | 2 Aug 2015 |
| 627 | oakleyleisure.com | Tucows Domains Inc. | 18 Sep 2014 | 29 Oct 2024 | 18 Sep 2024 |
| 628 | oakleylove-usa.org | GoDaddy.com, LLC | 18 Sep 2014 | 8 Oct 2017 | 18 Sep 2018 |
| 629 | oakley-blackfriday.com | GMO Internet Inc. | 29 May 2016 | 14 May 2017 | 29 May 2018 |
| 630 | oakley-chok.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 631 | oakley-new-york-store.com | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 632 | oakley-season.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 6 Sep 2014 | 9 Sep 2015 | 6 Sep 2016 |
| 633 | oakley-solo.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2015 |
| 634 | oakleysunglassesonsalecheap.com | Bizcn.com, Inc. | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 635 | oakley-free.com | GoDaddy.com, LLC | 19 Sep 2014 | 30 Sep 2016 | 19 Sep 2017 |
| 636 | oakleyhandyman.com | GoDaddy.com, LLC | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 637 | oakleysales-shop.com | GoDaddy.com, LLC | 19 Sep 2014 | 30 Sep 2016 | 19 Sep 2017 |
| 638 | oakley-goods.com | GoDaddy.com, LLC | 19 Sep 2014 | 30 Sep 2016 | 19 Sep 2017 |
| 639 | oakley-free.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 640 | oakleysale-shopping.com | GoDaddy.com, LLC | 19 Sep 2014 | 30 Sep 2016 | 19 Sep 2017 |
| 641 | oakleysunglassesblackfriday2014.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 642 | oakleyfhabuyers.com | DropCatch.com 1287 LLC | 4 Feb 2017 | 5 Feb 2017 | 4 Feb 2018 |
| 643 | oakleycheapsunglassesoutletsale.com | GoDaddy.com, LLC | 2 Nov 2018 | 2 Nov 2018 | 2 Nov 2019 |
| 644 | oakleyblackfridaydeals.com | Register.it SPA | 5 Feb 2018 | 10 Mar 2021 | 5 Feb 2022 |
| 645 | oakley-free.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 646 | oakleyfrsolde.com | Bizcn.com, Inc. | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2015 |
| 647 | oakleysale-uk.com | Xiamen ChinaSource Internet Service Co., Ltd. | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 648 | oakleyspain.com | DropCatch.com 372 LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 649 | oakleylove-nor.com | GoDaddy.com, LLC | 20 Sep 2014 | 30 Sep 2016 | 20 Sep 2017 |
| 650 | oakley-rose.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Sep 2014 | 7 Sep 2017 | 7 Sep 2018 |
| 651 | oakleyrose.com | Annulet LLC | 7 Sep 2014 | 25 Oct 2024 | 7 Sep 2025 |
| 652 | oakleydesign.us | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 15 Nov 2015 |
| 653 | oakleyfundraising.org | Mesh Digital Limited | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 654 | oakleyhauntedchurch.com | GoDaddy.com, LLC | 8 Sep 2014 | 5 Apr 2017 | 4 Apr 2018 |
| 655 | oakleyonline-shopping.com | GoDaddy.com, LLC | 12 Jun 2019 | 12 Jun 2019 | 12 Jun 2020 |
| 656 | oakleysaleshopping.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 May 2023 | 30 Apr 2025 | 11 May 2026 |
| 657 | oakleyshop-sales.com | eNom, Inc. | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 658 | oakleyshoponline.com | - | 5 Jun 2016 | 5 Jun 2016 | 5 Jun 2017 |
| 659 | oakleystore-hu.org | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 660 | oakleysunglassescheapi.com | Free Dive Domains, LLC | 19 Jul 2024 | 22 Jul 2024 | 19 Jul 2025 |
| 661 | oakleygoods2014online.com | Xin Net Technology Corporation | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 662 | oakleycheap-eu.com | GoDaddy.com, LLC | 30 Sep 2014 | 30 Sep 2016 | 30 Sep 2017 |
| 663 | oakleystock.com | GoDaddy.com, LLC | 30 Sep 2014 | 30 Sep 2016 | 30 Sep 2017 |
| 664 | oakleysunglasses-australia.com | 1API GmbH | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 665 | oakley-nl.com | GoDaddy.com, LLC | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 666 | oakleyoutletsunglassescheap.com | Xin Net Technology Corporation | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 667 | oakleysunglassesclearancesale.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 668 | oakleysunglassesvipsale.com | Bizcn.com, Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 669 | oakleyus-online.com | GoDaddy.com, LLC | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 670 | oakleyus-outlet.com | GoDaddy.com, LLC | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 671 | oakley-global.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 672 | oakleysunglassus.net | Xin Net Technology Corporation | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2015 |
| 673 | oakley-sunglass.net | GoDaddy.com, LLC | 3 Oct 2014 | 30 Sep 2016 | 3 Oct 2017 |
| 674 | oakleymy.com | eNom, Inc. | 3 Oct 2014 | 12 Oct 2015 | 3 Oct 2016 |
| 675 | oakleyblack.com | Dynadot, LLC | 8 Sep 2022 | 18 Nov 2023 | 8 Sep 2023 |
| 676 | oakleyapts.com | GoDaddy.com, LLC | 19 Nov 2014 | 20 Nov 2024 | 19 Nov 2025 |
| 677 | oakley-hutonline.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 678 | oakley-small.com | Bizcn.com, Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 679 | oakley-ukdesign.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 680 | oakleydesign-eu.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 681 | oakleydesign-uk.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 682 | oakleyhunter.com | GoDaddy.com, LLC | 10 Sep 2014 | 11 Sep 2021 | 10 Sep 2022 |
| 683 | oakleyhut-spain.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 684 | oakleylove-dk.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 685 | oakleyorg-eu.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 686 | oakleys-24hstore.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 687 | oakleys-love.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 688 | oakleysale-pop.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 689 | oakley-fashion.org | GoDaddy.com, LLC | 11 Sep 2014 | 1 Sep 2016 | 11 Sep 2017 |
| 690 | oakleybrandonline.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 691 | oakleyhutstore.org | GoDaddy.com, LLC | 10 Sep 2014 | 1 Sep 2016 | 10 Sep 2017 |
| 692 | oakleyofficialsale.org | GoDaddy.com, LLC | 10 Sep 2014 | 1 Sep 2016 | 10 Sep 2017 |
| 693 | oakleys-shoppe.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 694 | oakley-sunglasses-store.com | GoDaddy.com, LLC | 1 Oct 2014 | 30 Sep 2016 | 1 Oct 2017 |
| 695 | oakleysunglasses-hop.com | eNom, Inc. | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 696 | oakleyairsports.com | Tucows Domains Inc. | 28 Sep 2009 | 2 Oct 2014 | 28 Sep 2015 |
| 697 | oakleysalesshopping.com | Key-Systems GmbH | 1 Oct 2014 | 26 Nov 2014 | 1 Oct 2015 |
| 698 | oakleymadmar.com | GoDaddy.com, LLC | 19 Nov 2014 | 20 Nov 2024 | 19 Nov 2025 |
| 699 | oakley-ineurope.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 20 Nov 2014 | 23 Nov 2015 | 20 Nov 2016 |
| 700 | oakleyscouts.com | GoDaddy.com, LLC | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2015 |
| 701 | oakleyandoliviacentre.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 21 Sep 2014 | - | 21 Sep 2015 |
| 702 | oakleyoutlet-usa.com | GoDaddy.com, LLC | 22 Sep 2014 | 30 Sep 2016 | 22 Sep 2017 |
| 703 | oakley-new-zealand.com | GoDaddy.com, LLC | 22 Sep 2014 | 30 Sep 2016 | 22 Sep 2017 |
| 704 | oakley-sunglasses-australia.com | GoDaddy.com, LLC | 22 Sep 2014 | 30 Sep 2016 | 22 Sep 2017 |
| 705 | oakleysunglassesblackfriday2014.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 706 | oakleyblackfridaydeals.org | GoDaddy.com, LLC | 18 Nov 2014 | 1 Dec 2016 | 18 Nov 2017 |
| 707 | oakleyblackfriday2014.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 708 | oakley-proshop.com | GoDaddy.com, LLC | 3 Oct 2014 | 30 Sep 2016 | 3 Oct 2017 |
| 709 | oakleyfsp.com | Synergy Wholesale Pty Ltd | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 710 | oakleyhorseboxesbenelux.info | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 711 | oakley-stem.com | GoDaddy.com, LLC | 22 Sep 2014 | 30 Sep 2016 | 22 Sep 2017 |
| 712 | oakleymasquerade.com | GoDaddy.com, LLC | 22 Sep 2014 | 16 May 2025 | 4 Apr 2025 |
| 713 | oakley2013sunglassess.org | GMO Internet Inc. | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 714 | oakleyoff2015.com | Register.it SPA | 8 Feb 2018 | 13 Mar 2021 | 8 Feb 2022 |
| 715 | oakleygroupllc.com | 1&1 Internet AG | 3 Jun 2024 | 3 Jun 2024 | 3 Jun 2026 |
| 716 | oakleyforsaleus.com | Register.it SPA | 9 Feb 2018 | 14 Mar 2021 | 9 Feb 2022 |
| 717 | oakley-ineurope.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 20 Nov 2014 | 23 Nov 2015 | 20 Nov 2016 |
| 718 | oakley-aussies.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 20 Nov 2014 | 23 Nov 2015 | 20 Nov 2016 |
| 719 | oakley-sunglasses-usa.us | 1API GmbH | 22 Sep 2014 | 22 Sep 2014 | 21 Sep 2015 |
| 720 | oakleyoutlet-online.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Sep 2014 | 22 Sep 2014 | 21 Sep 2015 |
| 721 | oakley-seller.com | GoDaddy.com, LLC | 24 Sep 2014 | 30 Sep 2016 | 24 Sep 2017 |
| 722 | oakleyorginal-eu.com | GoDaddy.com, LLC | 23 Sep 2014 | 30 Sep 2016 | 23 Sep 2017 |
| 723 | oakley-seller.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 724 | oakley-shoppingonline.com | GoDaddy.com, LLC | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 725 | oakleysforless.com | eNom, Inc. | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 726 | oakleyssoutherndelights.com | GoDaddy.com, LLC | 7 Oct 2014 | 8 Oct 2024 | 7 Oct 2025 |
| 727 | oakley-eurostore.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 22 Nov 2014 | 25 Nov 2015 | 22 Nov 2016 |
| 728 | oakley-seller.org | GoDaddy.com, LLC | 24 Sep 2014 | 30 Sep 2016 | 24 Sep 2017 |
| 729 | oakleys-uk.net | HiChina Zhicheng Technology Limited | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 730 | oakleybestore.com | GoDaddy.com, LLC | 9 Oct 2014 | 30 Sep 2016 | 9 Oct 2017 |
| 731 | oakleysunglassesoutletcheap.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 732 | oakley-ineurope.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 20 Nov 2014 | 23 Nov 2015 | 20 Nov 2016 |
| 733 | oakleyinternet.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 734 | oakleyroadtheater.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 735 | oakleytokyoonline.com | TLD Registrar Solutions Ltd. | 25 Oct 2014 | 22 Nov 2014 | 25 Oct 2015 |
| 736 | oakleycool.com | Dynadot, LLC | 28 Nov 2018 | 29 Nov 2018 | 28 Nov 2019 |
| 737 | oakleychristopher.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2016 | 22 Nov 2017 |
| 738 | oakley-xmas.com | Register.it SPA | 12 Feb 2018 | 17 Mar 2025 | 12 Feb 2026 |
| 739 | oakleydesignworks.com | Netistrar Limited | 29 Sep 2014 | 9 Sep 2024 | 29 Sep 2027 |
| 740 | oakleypaschere.asia | GMO Internet Inc. | 28 Apr 2023 | 8 Jul 2024 | 28 Apr 2024 |
| 741 | oakleygardens.com | Tucows Domains Inc. | 12 Jan 2012 | 28 Dec 2024 | 12 Jan 2026 |
| 742 | oakleypascherfranch.com | GMO Internet Inc. | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 743 | oakleyglassesstore.com | GoDaddy.com, LLC | 11 Oct 2014 | 30 Sep 2016 | 11 Oct 2017 |
| 744 | oakleyhouse.org | Dynamic Network Services, Inc. | 10 Oct 2014 | 23 Sep 2024 | 10 Oct 2025 |
| 745 | oakleymanzoku.com | PSI-USA, Inc. dba Domain Robot | 13 Feb 2021 | 13 Feb 2021 | 13 Feb 2022 |
| 746 | oakleysunglasssale.com | GoDaddy.com, LLC | 11 Oct 2014 | 30 Sep 2016 | 11 Oct 2017 |
| 747 | oakleycpa.com | Wix.com Ltd. | 13 Jun 2021 | 21 Jun 2023 | 13 Jun 2027 |
| 748 | oakleyblackfriday2014deals.com | Bizcn.com, Inc. | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 749 | oakleyplace.com | Google, Inc. | 11 Oct 2014 | 27 Sep 2024 | 11 Oct 2025 |
| 750 | oakleys4u.com | GoDaddy.com, LLC | 11 Oct 2014 | 30 Sep 2016 | 11 Oct 2017 |
| 751 | oakleysshop.net | GoDaddy.com, LLC | 11 Oct 2014 | 30 Sep 2016 | 11 Oct 2017 |
| 752 | oakleybuys.com | 1API GmbH | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 753 | oakleyfinancialservices.com | Webfusion Ltd. | 22 Jul 2022 | 5 Oct 2023 | 22 Jul 2023 |
| 754 | oakleyindependentfinancialservices.com | Tucows Domains Inc. | 9 Oct 2012 | 13 Oct 2015 | 9 Oct 2016 |
| 755 | oakleyscafeandbistro.com | Tucows Domains Inc. | 8 Oct 2009 | 12 Oct 2014 | 8 Oct 2015 |
| 756 | oakleysunglassesdeals.com | - | 23 Apr 2022 | 24 Apr 2023 | 23 Apr 2024 |
| 757 | oakleysonsale.com | Register.it SPA | 13 Feb 2018 | 18 Mar 2021 | 13 Feb 2022 |
| 758 | oakleyphotos.com | GoDaddy.com, LLC | 10 May 2024 | 17 May 2024 | 10 May 2027 |
| 759 | oakleydesign-us.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 760 | oakleyinformer.com | Mesh Digital Limited | 13 Oct 2014 | 12 Sep 2024 | 13 Oct 2025 |
| 761 | oakleyplumbingandheating.com | NameCheap, Inc. | 5 Nov 2024 | 5 Nov 2024 | 5 Nov 2029 |
| 762 | oakleyvogue.com | GoDaddy.com, LLC | 17 Oct 2014 | 31 Oct 2016 | 17 Oct 2017 |
| 763 | oakleyvente.com | GoDaddy.com, LLC | 17 Oct 2014 | 31 Oct 2016 | 17 Oct 2017 |
| 764 | oakleyrate.com | GoDaddy.com, LLC | 17 Oct 2014 | 31 Oct 2016 | 17 Oct 2017 |
| 765 | oakleypalace.com | GoDaddy.com, LLC | 17 Oct 2014 | 31 Oct 2016 | 17 Oct 2017 |
| 766 | oakleyoptic.com | GoDaddy.com, LLC | 17 Oct 2014 | 31 Oct 2016 | 17 Oct 2017 |
| 767 | oakley-nor.net | GoDaddy.com, LLC | 14 Oct 2014 | 30 Sep 2016 | 14 Oct 2017 |
| 768 | oakley-nor.org | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Oct 2014 | 17 Oct 2015 | 14 Oct 2016 |
| 769 | oakley-stylish.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 770 | oakleynwoutlet.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 771 | oakleymwoutlet.com | GoDaddy.com, LLC | 18 Oct 2014 | 31 Oct 2016 | 18 Oct 2017 |
| 772 | oakleyewoutlet.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 773 | oakleycwoutlet.com | GoDaddy.com, LLC | 18 Oct 2014 | 31 Oct 2016 | 18 Oct 2017 |
| 774 | oakleyawoutlet.com | GoDaddy.com, LLC | 18 Oct 2014 | 31 Oct 2016 | 18 Oct 2017 |
| 775 | oakley-club.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 776 | oakley-aus.net | GoDaddy.com, LLC | 17 Oct 2014 | 31 Oct 2016 | 17 Oct 2017 |
| 777 | oakleysale2015.com | GoDaddy.com, LLC | 19 Oct 2014 | 20 Oct 2016 | 19 Oct 2017 |
| 778 | oakleys-australia-outlet.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 779 | oakley-webmall.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 780 | oakley-trade.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 781 | oakley-fashionest.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 782 | oakley-designer.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 783 | oakley-dealsale.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 784 | oakley-cheapest.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 785 | oakley-brandshops.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 786 | oakleyandirvine.com | Webfusion Ltd. | 15 Oct 2014 | 16 Oct 2024 | 15 Oct 2025 |
| 787 | oakleyhairbykimmi.com | Network Solutions, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 788 | oakleysunglasse.net | GoDaddy.com, LLC | 15 Oct 2014 | 31 Oct 2016 | 15 Oct 2017 |
| 789 | oakleysplace.com | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 790 | oakleyparkapts.com | Wild West Domains, LLC | 27 Nov 2014 | 28 Nov 2016 | 27 Nov 2017 |
| 791 | oakleysplace.info | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 792 | oakleysunglassesshops.com | Skykomishdomains.com LLC | 14 Feb 2019 | 29 Apr 2023 | 14 Feb 2023 |
| 793 | oakleyfrogskineyewear.com | GMO Internet Inc. | 27 Nov 2014 | 13 Oct 2016 | 27 Nov 2017 |
| 794 | oakleywebb.net | eNom, Inc. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 795 | oakleysplace.org | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 796 | oakleysplace.net | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 797 | oakleysonlinestore.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 798 | oakleyonlinesale.org | Register.it SPA | 14 Feb 2018 | - | 14 Feb 2019 |
| 799 | oakleyrader.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 25 Nov 2013 | 28 Nov 2014 | 25 Nov 2015 |
| 800 | oakleymax.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 25 Nov 2013 | 28 Nov 2014 | 25 Nov 2015 |
| 801 | oakleydc.com | GoDaddy.com, LLC | 20 Mar 2024 | 11 Jul 2024 | 20 Mar 2027 |
| 802 | oakleyboy.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 25 Nov 2013 | 28 Nov 2014 | 25 Nov 2015 |
| 803 | oakleybox.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 804 | oakley2014frpromo.com | Xin Net Technology Corporation | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 805 | oakleysunglassestyle.com | GoDaddy.com, LLC | 24 May 2022 | 29 May 2025 | 24 May 2026 |
| 806 | oakleysalest.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 807 | oakleymonday.com | Register.it SPA | 19 Feb 2018 | 24 Mar 2021 | 19 Feb 2022 |
| 808 | oakleyglobal.com | Tucows Domains Inc. | 5 Mar 2025 | 30 Apr 2025 | 5 Mar 2026 |
| 809 | oakleyfencecostillwaterok.com | Tucows Domains Inc. | 27 Nov 2012 | 1 Dec 2014 | 27 Nov 2015 |
| 810 | oakleyfriday.us | GoDaddy.com, LLC | 29 Nov 2014 | 29 Nov 2014 | 28 Nov 2015 |
| 811 | oakleygrain.com | Key-Systems GmbH | 20 Jul 2021 | 20 Jul 2021 | 20 Jul 2022 |
| 812 | oakleymonday.us | Tucows Domains Inc. | 19 Feb 2018 | 1 Apr 2023 | 19 Feb 2023 |
| 813 | oakleyca.us | united-domains AG | 30 Nov 2014 | - | 29 Nov 2015 |
| 814 | oakleysunglassesoutlet.info | NameCheap, Inc. | 11 Sep 2019 | 18 Apr 2020 | 11 Sep 2020 |
| 815 | oakleyniko.com | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 816 | oakleylawuk.com | Tucows Domains Inc. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2017 |
| 817 | oakley-dutyfree.com | Hefei Juming Network Technology Co., Ltd | 1 May 2022 | 3 Jul 2023 | 1 May 2023 |
| 818 | oakleysunglassestw.com | eName Technology Co., Ltd. | 29 Nov 2019 | 29 Nov 2019 | 29 Nov 2020 |
| 819 | oakleysunglassesfits.com | GMO Internet Inc. | 4 Dec 2014 | 11 Nov 2016 | 4 Dec 2017 |
| 820 | oakleyoutletonline.net | Jiangsu Bangning Science and technology Co. Ltd. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 821 | oakleymallonline.com | Register.it SPA | 24 Feb 2018 | 29 Mar 2021 | 24 Feb 2022 |
| 822 | oakleyhotsales.com | Register.it SPA | 24 Feb 2018 | 29 Mar 2021 | 24 Feb 2022 |
| 823 | oakley-vipmart.com | Register.it SPA | 24 Feb 2018 | 29 Mar 2021 | 24 Feb 2022 |
| 824 | oakley-usonsale.com | Register.it SPA | 24 Feb 2018 | 29 Mar 2021 | 24 Feb 2022 |
| 825 | oakleyparkapartment.com | Domain.com, LLC | 19 Mar 2018 | 19 Mar 2018 | 19 Mar 2019 |
| 826 | oakleyoutletsunglasses.net | Register.it SPA | 24 Feb 2018 | 29 Mar 2021 | 24 Feb 2022 |
| 827 | oakleymonuments.com | GoDaddy.com, LLC | 9 Dec 2014 | 10 Dec 2024 | 9 Dec 2025 |
| 828 | oakley-emea-news.com | Network Solutions, LLC | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 829 | oakleysunglasses-outletstore.us | GoDaddy.com, LLC | 10 Dec 2014 | 1 Dec 2016 | 9 Dec 2017 |
| 830 | oakleyfriday.net | Register.it SPA | 1 Mar 2018 | 3 Apr 2021 | 1 Mar 2022 |
| 831 | oakley3-d.com | Tucows Domains Inc. | 9 Dec 2010 | 13 Dec 2014 | 9 Dec 2015 |
| 832 | oakley-rayban-sunglasses-nz.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 833 | oakleyroad.info | 1&1 Internet AG | 15 Dec 2014 | - | 15 Dec 2015 |
| 834 | oakleyrocks.com | Tucows Domains Inc. | 29 Mar 2017 | 29 Mar 2017 | 29 Mar 2018 |
| 835 | oakleycheapsalejp.com | Xin Net Technology Corporation | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 836 | oakleyfrogskins34.com | Register.it SPA | 9 Mar 2018 | 11 Apr 2021 | 9 Mar 2022 |
| 837 | oakleystreetconsultingltd.com | GoDaddy.com, LLC | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2019 |
| 838 | oakleystreetconsulting.com | GoDaddy.com, LLC | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2019 |
| 839 | oakleyglassesoutlet.us | Tucows Domains Inc. | 13 Mar 2018 | 23 Apr 2023 | 13 Mar 2023 |
| 840 | oakleyaviators.us | Tucows Domains Inc. | 13 Mar 2018 | 23 Apr 2023 | 13 Mar 2023 |
| 841 | oakleyjpten.com | Register.it SPA | 16 Mar 2018 | 18 Apr 2021 | 16 Mar 2022 |
| 842 | oakley-rayban-store.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 843 | oakley-rayban-shop.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 844 | oakley-rayban-outlets.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 845 | oakley-rayban-outlet.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 846 | oakley-rayban-online.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 847 | oakleynewsunglasses.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Dec 2014 | 25 Dec 2014 | 24 Dec 2015 |
| 848 | oakleyglassesclub.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Dec 2014 | 25 Dec 2014 | 24 Dec 2015 |
| 849 | oakleysunglassescanadaonline.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 850 | oakleysoutlets.com | GoDaddy.com, LLC | 11 Nov 2019 | 11 Nov 2019 | 11 Nov 2020 |
| 851 | oakleymc.com | NameKing.com Inc. | 2 Feb 2024 | 18 Jan 2025 | 2 Feb 2026 |
| 852 | oakleyjapans.com | GMO Internet Inc. | 6 Dec 2019 | 7 Dec 2019 | 6 Dec 2020 |
| 853 | oakleyitaliaonline.com | OnlineNIC, Inc. | 17 Mar 2019 | 17 Mar 2019 | 17 Mar 2020 |
| 854 | oakleye.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Feb 2025 | 20 Feb 2025 | 20 Feb 2026 |
| 855 | oakleystoreoutlet.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Dec 2014 | 27 Dec 2014 | 26 Dec 2015 |
| 856 | oakleyclassicglasses.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Dec 2014 | 27 Dec 2014 | 26 Dec 2015 |
| 857 | oakleyvenda.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Dec 2014 | 29 Dec 2014 | 28 Dec 2015 |
| 858 | oakleyshopbr.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Dec 2014 | 29 Dec 2014 | 28 Dec 2015 |
| 859 | oakleyoutletbr.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Dec 2014 | 29 Dec 2014 | 28 Dec 2015 |
| 860 | oakleyoculos.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Dec 2014 | 29 Dec 2014 | 28 Dec 2015 |
| 861 | oakleyloja.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Dec 2014 | 29 Dec 2014 | 28 Dec 2015 |
| 862 | oakleycomprar.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Dec 2014 | 29 Dec 2014 | 28 Dec 2015 |
| 863 | oakleybrazil.biz | GoDaddy.com, LLC | 29 Dec 2014 | 9 Jan 2018 | 28 Dec 2017 |
| 864 | oakleyaliexpress.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Dec 2014 | 29 Dec 2014 | 28 Dec 2015 |
| 865 | oakleylumber.com | GoDaddy.com, LLC | 29 Dec 2014 | 2 Dec 2024 | 29 Dec 2033 |
| 866 | oakleyradarno.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 867 | oakleyjapann.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 868 | oakleygogglesdk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 869 | oakleylumber.net | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 870 | oakleyequestriancentre.com | Webfusion Ltd. | 31 Dec 2014 | 24 Dec 2016 | 31 Dec 2018 |
| 871 | oakleybrasils.com | Key-Systems GmbH | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 872 | oakleyonlinesale.us | GoDaddy.com, LLC | 30 Dec 2014 | 31 Dec 2016 | 29 Dec 2017 |
| 873 | oakleyworldmall.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 874 | oakleysportswear.com | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 875 | oakleyfaircrest.com | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 876 | oakley-enjoy.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 877 | oakleysportswear.us | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 2 Jan 2016 |
| 878 | oakleyphotography.xyz | Network Solutions, LLC | 22 Jul 2014 | 23 Jul 2014 | 22 Jul 2015 |
| 879 | oakleytransport.xyz | Network Solutions, LLC | 30 Jul 2014 | 31 Jul 2014 | 30 Jul 2015 |
| 880 | oakleycity.house | NameCheap, Inc. | 23 Aug 2014 | 29 Jul 2019 | 23 Aug 2020 |
| 881 | oakleyoutlet.xyz | MarkMonitor Inc. | 22 Oct 2014 | 23 Oct 2015 | 22 Oct 2016 |
| 882 | oakleysreplicasunglassess.com | Xiamen ChinaSource Internet Service Co., Ltd. | 12 Aug 2015 | 31 Aug 2015 | 12 Aug 2016 |
| 883 | oakleyhotsp.com | Shanghai Meicheng Technology Information Co., Ltd | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 884 | oakleybrown.org | GoDaddy.com, LLC | 11 Aug 2015 | 12 Aug 2016 | 11 Aug 2017 |
| 885 | oakleylawschool.london | eNom, Inc. | 7 Nov 2014 | - | 7 Nov 2015 |
| 886 | oakleymelvin.realtor | Name Share, Inc. | 31 May 2023 | 1 May 2024 | 31 May 2025 |
| 887 | oakleystore.xyz | Uniregistrar Corp | 3 Jun 2016 | 23 Sep 2016 | 3 Jun 2017 |
| 888 | oakleyssunglasses.xyz | Xiamen Nawang Technology Co., Ltd | 25 Dec 2014 | 31 Dec 2015 | 25 Dec 2016 |
| 889 | oakleystore.red | GMO Internet Inc. | 30 Dec 2014 | - | 30 Dec 2015 |
| 890 | oakley-store.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Nov 2016 | - | 25 Nov 2017 |
| 891 | oakley-online.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Jan 2015 | - | 5 Jan 2016 |
| 892 | oakley-fashion.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Jan 2015 | - | 5 Jan 2016 |
| 893 | oakleyblackfriday2014.com | eName Technology Co., Ltd. | 25 Apr 2019 | 25 Apr 2019 | 25 Apr 2020 |
| 894 | oakley-c.com | TurnCommerce, Inc. DBA NameBright.com | 22 Feb 2019 | 22 Feb 2019 | 22 Feb 2020 |
| 895 | oakley-sunglasses.xyz | GMO Internet Inc. | 24 Jan 2025 | 29 Jan 2025 | 24 Jan 2026 |
| 896 | oakleystudios.photography | Tucows Domains Inc. | 27 Feb 2014 | 3 Mar 2018 | 27 Feb 2019 |
| 897 | oakleysunglassstores.xyz | GMO Internet Inc. | 18 May 2017 | 23 May 2017 | 18 May 2018 |
| 898 | oakleysunglassesoutlet.xyz | GoDaddy.com, LLC | 1 Mar 2015 | 27 Jun 2016 | 1 Mar 2017 |
| 899 | oakleysunglassesoutlet.top | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 900 | oakleysunglasses.xyz | Dynadot, LLC | 17 Jan 2022 | 17 Jan 2022 | 17 Jan 2023 |
| 901 | oakleysunglasses.top | GoDaddy.com, LLC | 4 Jun 2025 | 5 Jun 2025 | 4 Jun 2026 |
| 902 | oakleysunglass.xyz | NameCheap, Inc. | 15 Apr 2022 | 12 May 2022 | 15 Apr 2024 |
| 903 | oakleysunglasses.click | 1API GmbH | 5 Mar 2015 | - | 5 Mar 2016 |
| 904 | oakleysunglasses.blue | 1API GmbH | 5 Mar 2015 | - | 5 Mar 2016 |
| 905 | oakleysunglasses.black | 1API GmbH | 5 Mar 2015 | - | 5 Mar 2016 |
| 906 | oakleysunglasses.red | 1API GmbH | 5 Mar 2015 | - | 5 Mar 2016 |
| 907 | oakleysunglasses.pink | 1API GmbH | 5 Mar 2015 | - | 5 Mar 2016 |
| 908 | oakleysunglasses.cheap | GoDaddy.com, LLC | 17 Mar 2015 | 1 May 2017 | 17 Mar 2018 |
| 909 | oakleysunglasseswholesale.xyz | Xiamen Nawang Technology Co., Ltd | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2017 |
| 910 | oakleysunglassessale.xyz | Xiamen Nawang Technology Co., Ltd | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2017 |
| 911 | oakleyoutlet.top | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Apr 2024 | 15 May 2025 | 1 Apr 2025 |
| 912 | oakleyshop-fr.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 10 Aug 2014 | 13 Aug 2015 | 10 Aug 2016 |
| 913 | oakleysconsultants.com | Key-Systems GmbH | 13 Aug 2015 | 17 Sep 2016 | 13 Aug 2017 |
| 914 | oakleyoutlet.biz | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 12 Aug 2016 |
| 915 | oakleygornto.com | GoDaddy.com, LLC | 11 Aug 2020 | 11 Aug 2024 | 11 Aug 2025 |
| 916 | oakleywomenssunglasses.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 917 | oakleysunglassessale.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 918 | oakleysunglassesoutlet.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 919 | oakleysunglassesdiscount.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 920 | oakleysunglassescheap.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 921 | oakleysunglasses.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 922 | oakleystore.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 923 | oakleyssunglasses.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 924 | oakleyshootingglasses.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 925 | oakleysafetyglasses.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 926 | oakleyprescriptionsunglasses.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 927 | oakleyprescriptionglasses.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 928 | oakleyprescription.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 929 | oakleyplaintiff.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 930 | oakleyoutlet.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 931 | oakleyholbrooksunglasses.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 932 | oakleyhalfjacket2.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 933 | oakleyglassesframes.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 934 | oakleyglasses.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 935 | oakleyframes.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 936 | oakleyflakjacket.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 937 | oakleyfivessquared.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 938 | oakleyeyeglasses.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 939 | oakleycrosshair2.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 940 | oakleycoupons.cricket | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 941 | oakleybaseballsunglasses.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 942 | oakleyrepairshop.com | Google, Inc. | 15 Jan 2020 | 15 Jan 2020 | 15 Jan 2021 |
| 943 | oakleyrakuten.com | eName Technology Co., Ltd. | 22 May 2019 | 22 May 2019 | 22 May 2020 |
| 944 | oakleyfarmcarriages.com | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2017 |
| 945 | oakleyvipsale.com | GMO Internet Inc. | 1 Oct 2021 | 1 Oct 2021 | 1 Oct 2022 |
| 946 | oakleynew2015.com | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 947 | oakleylovesdrivers.com | Network Solutions, LLC | 7 Jan 2015 | 8 Nov 2022 | 7 Jan 2026 |
| 948 | oakleyeducation.com | GoDaddy.com, LLC | 13 Feb 2023 | 13 Feb 2025 | 13 Feb 2026 |
| 949 | oakleycauchiwedding.com | eNom, Inc. | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 950 | oakleymore-italia.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 11 Aug 2014 | 14 Aug 2015 | 11 Aug 2016 |
| 951 | oakleymore-fr.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 11 Aug 2014 | 14 Aug 2015 | 11 Aug 2016 |
| 952 | oakleyhotsale.net | Xiamen Nawang Technology Co., Ltd | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 953 | oakleychic-ca.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 11 Aug 2014 | 14 Aug 2015 | 11 Aug 2016 |
| 954 | oakleysunglasses-saleshop.com | GMO Internet Inc. | 4 Jul 2022 | 14 Sep 2023 | 4 Jul 2023 |
| 955 | oakleyroad.com | Wild West Domains, LLC | 9 Jan 2015 | 10 Jan 2025 | 9 Jan 2026 |
| 956 | oakleylowerspro.com | Amazon Registrar, Inc. | 9 Jan 2015 | 6 Dec 2024 | 9 Jan 2026 |
| 957 | oakleyliving.com | Webnames.ca Inc. | 21 Feb 2018 | 19 Feb 2025 | 21 Feb 2026 |
| 958 | oakleyglasshop.com | Xin Net Technology Corporation | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 959 | oakley-deals.com | GoDaddy.com, LLC | 14 May 2025 | 14 May 2025 | 14 May 2026 |
| 960 | oakleyuksale.net | Century Oriental International Co., Ltd. | 7 Jan 2014 | 8 Jan 2015 | 7 Jan 2016 |
| 961 | oakleysunglassesp.org | - | 26 Mar 2016 | 26 Mar 2016 | 26 Mar 2017 |
| 962 | oakleysunglassessly.com | eName Technology Co., Ltd. | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 963 | oakleyestateagents.com | FastDomain Inc. | 13 Jan 2015 | 30 Dec 2024 | 13 Jan 2026 |
| 964 | oakleyjapan2015.com | Xin Net Technology Corporation | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 965 | oakleytselectric.com | PSI-USA, Inc. dba Domain Robot | 21 May 2025 | 23 May 2025 | 21 May 2026 |
| 966 | oakleysturfspecialist.com | GoDaddy.com, LLC | 16 Dec 2023 | 16 Dec 2024 | 16 Dec 2025 |
| 967 | oakleysshopjapan.biz | NameKing.com Inc. | 29 Apr 2021 | 29 Apr 2021 | 29 Apr 2022 |
| 968 | oakleys.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 May 2015 | 23 May 2015 | 23 May 2016 |
| 969 | oakleyonline.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2016 |
| 970 | oakleycleaning.xyz | GoDaddy.com, LLC | 6 Jun 2015 | 6 Jun 2015 | 6 Jun 2016 |
| 971 | oakley2015.sale | GoDaddy.com, LLC | 17 Jun 2015 | 17 Jun 2015 | 17 Jun 2016 |
| 972 | oakleyglasses.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Jun 2015 | - | 19 Jun 2016 |
| 973 | oakleysale.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 1 Jul 2015 | - | 1 Jul 2018 |
| 974 | oakleyhotels.review | Alpnames Limited | 5 Jul 2015 | - | 4 Jul 2016 |
| 975 | oakleyoffshore.com | GoDaddy.com, LLC | 16 Aug 2015 | 17 Aug 2024 | 16 Aug 2025 |
| 976 | oakleyshop.top | Namesilo, LLC | 10 Jan 2024 | 14 Feb 2025 | 10 Jan 2025 |
| 977 | oakleysunglasses.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jul 2015 | - | 12 Jul 2016 |
| 978 | oakleystore.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jul 2015 | - | 12 Jul 2016 |
| 979 | oakleyshop.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jul 2015 | - | 12 Jul 2016 |
| 980 | oakleys.top | West263 International Limited | 16 Jun 2025 | - | 16 Jun 2026 |
| 981 | oakleys.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jul 2015 | - | 12 Jul 2016 |
| 982 | oakleyoutlet.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jul 2015 | - | 12 Jul 2016 |
| 983 | oakleyglasses.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jul 2015 | - | 12 Jul 2016 |
| 984 | oakley2015.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jul 2015 | - | 12 Jul 2016 |
| 985 | oakleysoutlet.xyz | GoDaddy.com, LLC | 21 Jul 2015 | 1 Sep 2024 | 21 Jul 2024 |
| 986 | oakleyonsale.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 21 Jul 2015 | - | 21 Jul 2016 |
| 987 | oakleyonlineshop.xyz | GoDaddy.com, LLC | 21 Jul 2015 | 1 Sep 2024 | 21 Jul 2024 |
| 988 | oakleymall.xyz | GoDaddy.com, LLC | 21 Jul 2015 | 1 Sep 2024 | 21 Jul 2024 |
| 989 | oakleylaw.school | Mesh Digital Limited | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2016 |
| 990 | oakleylove.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 31 Jul 2015 | - | 31 Jul 2016 |
| 991 | oakleyuk.us | Above.com Pty Ltd. | 16 Jan 2015 | 16 Jan 2015 | 15 Jan 2016 |
| 992 | oakleyglasses.net | Google, Inc. | 18 Apr 2021 | 18 Apr 2021 | 18 Apr 2022 |
| 993 | oakleysunglassesstoreoutletonline.com | GMO Internet Inc. | 28 Apr 2017 | 5 May 2017 | 28 Apr 2018 |
| 994 | oakleysunglassesoutletstoresale.com | Xin Net Technology Corporation | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 995 | oakleysunglassesoutletonlinestore.com | Xin Net Technology Corporation | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 996 | oakleysunglassesoutletcalifornia.com | Xin Net Technology Corporation | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 997 | oakleysunglassesoutlet-online.com | Xin Net Technology Corporation | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 998 | oakleysunglassesonlinestoresale.com | Xin Net Technology Corporation | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 999 | oakleysunglassesonlineoutletusa.com | Xin Net Technology Corporation | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 1000 | oakleysunglassesfactoryoutletonlinesale.com | Xin Net Technology Corporation | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
Displaying 1,000 out of 9,351 domains starting with the keyword "OAKLEY". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=oakley
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |