With support for 
Keyword: NTS
Reverse Whois » KEYWORD [nts ] { 14,590 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | nts.gov.tr | - | 21 Nov 2008 | - | 20 Nov 2015 |
| 2 | nts.org.uk | - | 28 Apr 1998 | 19 May 2025 | 28 Apr 2026 |
| 3 | nts.edu | - | 6 Aug 2001 | 30 Jun 2015 | 31 Jul 2016 |
| 4 | nts.org.pk | - | 1 Jan 2002 | - | 1 Jan 2018 |
| 5 | nts.su | - | 8 Oct 2003 | - | 8 Oct 2026 |
| 6 | nts.ne.jp | - | - | - | - |
| 7 | nts.com.vn | - | - | - | - |
| 8 | nts.com | Network Solutions, LLC | 13 Jun 1996 | 24 Jul 2022 | 12 Jun 2027 |
| 9 | nts.org | GoDaddy.com, LLC | 25 Apr 2002 | 5 Sep 2024 | 25 Apr 2031 |
| 10 | nts.support | GMO Internet Inc. | 2 Jul 2014 | 21 Jun 2025 | 2 Jul 2026 |
| 11 | nts.company | GMO Internet Inc. | 1 Jul 2014 | 16 Jun 2025 | - |
| 12 | nts.works | GMO Internet Inc. | 1 Jul 2014 | 16 Jun 2023 | - |
| 13 | nts.services | Mesh Digital Limited | 11 Mar 2022 | 14 Feb 2025 | 11 Mar 2026 |
| 14 | nts.international | GoDaddy.com, LLC | 11 Oct 2017 | 25 Nov 2025 | 11 Oct 2026 |
| 15 | nts.photo | GMO Internet Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 16 | nts.education | Tucows Domains Inc. | 27 Apr 2023 | 29 Mar 2025 | - |
| 17 | nts.red | GMO Internet Inc. | 17 Nov 2014 | 14 Nov 2017 | 17 Nov 2018 |
| 18 | nts.tax | register.com, Inc. | 2 Aug 2018 | 18 May 2023 | 1 Aug 2028 |
| 19 | nts.help | Reserved for non-billable transactions where Regis… | 15 May 2025 | - | 15 May 2026 |
| 20 | nts.xn--ses554g | - | 5 Dec 2014 | 5 Dec 2014 | 5 May 2017 |
| 21 | nts.tokyo | GMO Internet Inc. | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 22 | nts.scot | Tucows Domains Inc. | 17 Dec 2014 | 21 Dec 2022 | 17 Dec 2022 |
| 23 | nts.solutions | - | 10 Aug 2021 | 5 Aug 2024 | - |
| 24 | nts.network | Gandi SAS | 12 Aug 2015 | 14 Jul 2024 | 12 Aug 2025 |
| 25 | nts.media | Gandi SAS | 12 Aug 2015 | 14 Jul 2024 | 12 Aug 2025 |
| 26 | nts.life | Gandi SAS | 12 Aug 2015 | - | - |
| 27 | nts.hosting | Vautron Rechenzentrum AG | 28 Feb 2019 | 5 Mar 2019 | 28 Feb 2020 |
| 28 | nts.today | - | 1 Aug 2025 | - | 1 Aug 2026 |
| 29 | nts.sydney | Crazy Domains FZ-LLC | 18 Feb 2015 | 24 Feb 2021 | 18 Feb 2021 |
| 30 | nts.club | Crazy Domains FZ-LLC | 21 Dec 2023 | 21 Oct 2025 | 21 Dec 2033 |
| 31 | nts.link | Uniregistrar Corp | 18 Mar 2015 | 23 Feb 2017 | 18 Mar 2018 |
| 32 | nts.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 May 2015 | 4 Jun 2021 | 17 May 2026 |
| 33 | nts.party | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Oct 2016 | 28 Jun 2017 | 13 Oct 2018 |
| 34 | nts.center | Regional Network Information Center, JSC dba RU-CE… | 29 May 2015 | 1 Jun 2025 | 29 May 2026 |
| 35 | nts.world | 1&1 Internet AG | 7 Jun 2015 | 22 Jul 2025 | 7 Jun 2026 |
| 36 | nts.fitness | Crazy Domains FZ-LLC | 12 Jul 2015 | 12 Jul 2017 | 12 Jul 2018 |
| 37 | nts.care | NameCheap, Inc. | 14 Sep 2020 | 15 Aug 2025 | - |
| 38 | nts.buzz | 1&1 Internet AG | 7 Sep 2015 | 27 Sep 2025 | 6 Sep 2026 |
| 39 | nts.online | GoDaddy.com, LLC | 16 Sep 2015 | 20 Nov 2025 | 16 Sep 2026 |
| 40 | nts.biz | Dynadot, LLC | 27 Aug 2019 | 24 Oct 2025 | 27 Aug 2026 |
| 41 | nts.name | Gabia, Inc. | - | - | - |
| 42 | nts.one | One.com A/S | 5 Oct 2015 | 15 Oct 2025 | 5 Oct 2026 |
| 43 | nts.site | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Oct 2015 | 22 Jul 2017 | 13 Oct 2018 |
| 44 | nts.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Oct 2015 | - | 14 Oct 2016 |
| 45 | nts.net | eNom, Inc. | 6 Nov 1995 | 7 Oct 2025 | 5 Nov 2026 |
| 46 | nts.live | Gandi SAS | 28 Oct 2015 | - | - |
| 47 | nts.asia | Key-Systems GmbH | 12 Apr 2024 | 25 May 2025 | 12 Apr 2025 |
| 48 | nts.co.uk | - | - | 28 Apr 2025 | 27 Apr 2026 |
| 49 | nts.mobi | Beijing Lanhai Jiye Technology Co., Ltd | 6 Aug 2025 | 11 Aug 2025 | 6 Aug 2026 |
| 50 | nts.kim | West263 International Limited | 11 Nov 2015 | - | 11 Nov 2016 |
| 51 | nts.tech | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Nov 2015 | 3 Dec 2025 | 30 Nov 2026 |
| 52 | nts.news | Namesilo, LLC | 10 Jun 2024 | 10 Jun 2025 | 10 Jun 2026 |
| 53 | nts.lol | - | 9 Dec 2025 | 6 Jan 2026 | 9 Dec 2026 |
| 54 | nts.space | DOTSERVE INC. | 21 Aug 2020 | 27 Sep 2023 | 21 Aug 2023 |
| 55 | nts.camp | GoDaddy.com, LLC | 13 Jan 2016 | 19 Jan 2026 | 13 Jan 2028 |
| 56 | nts.moscow | CJSC Registrar R01 | 22 Jan 2016 | 23 Jan 2016 | 22 Jan 2017 |
| 57 | nts.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Feb 2016 | 27 Jan 2017 | 3 Feb 2018 |
| 58 | nts.cloud | Tucows Domains Inc. | 16 Feb 2016 | 14 Feb 2025 | 16 Feb 2026 |
| 59 | nts.blue | GMO Internet Inc. | 14 Sep 2017 | 20 Aug 2024 | 14 Sep 2025 |
| 60 | nts.black | West263 International Limited | 19 Feb 2016 | - | 19 Feb 2017 |
| 61 | nts.pink | West263 International Limited | 29 Feb 2016 | - | 28 Feb 2017 |
| 62 | nts.gift | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Mar 2016 | 16 Mar 2017 | 1 Mar 2017 |
| 63 | nts.swiss | HOSTPOINT AG | 18 Feb 2016 | 25 Aug 2025 | 18 Feb 2026 |
| 64 | nts.ink | GoDaddy.com, LLC | 4 May 2021 | 20 Oct 2025 | 4 May 2027 |
| 65 | nts.co | GoDaddy.com, LLC | 29 Sep 2011 | 14 Sep 2024 | 28 Sep 2025 |
| 66 | nts.rocks | Wild West Domains, LLC | 6 Oct 2023 | 18 Oct 2025 | 6 Oct 2026 |
| 67 | nts.press | - | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 68 | nts.audio | 1&1 Internet AG | 4 Jun 2016 | 4 Jun 2016 | 4 Jun 2017 |
| 69 | nts.uk.net | Webfusion Ltd. | 18 Dec 2003 | 19 Dec 2025 | 18 Dec 2026 |
| 70 | nts.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jun 2016 | 31 Aug 2023 | 19 Jun 2026 |
| 71 | nts.win | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 17 Jun 2016 | 12 Nov 2021 | 16 Jun 2022 |
| 72 | nts.in | - | 12 Mar 2005 | 2 Aug 2025 | 12 Mar 2027 |
| 73 | nts.guru | - | 6 Oct 2023 | 18 Dec 2024 | 6 Oct 2024 |
| 74 | nts.science | Alpnames Limited | 25 Feb 2015 | 21 May 2016 | 24 Feb 2017 |
| 75 | nts.systems | Cronon AG | 2 Apr 2014 | 17 May 2025 | 2 Apr 2026 |
| 76 | nts.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Jul 2014 | 1 Jul 2021 | 1 Jul 2022 |
| 77 | nts.design | eNom, Inc. | 31 May 2020 | 13 Jul 2023 | 31 May 2023 |
| 78 | nts.vip | Hangzhou AiMing Network Co., LTD | 29 Aug 2016 | 16 Oct 2025 | 29 Aug 2026 |
| 79 | nts.info | Moniker Online Services LLC | 26 Jul 2001 | 29 Nov 2025 | 26 Jul 2026 |
| 80 | nts.foundation | PSI-USA, Inc. dba Domain Robot | 22 Oct 2016 | 22 Oct 2024 | 22 Oct 2025 |
| 81 | nts.us | EPAG Domainservices GmbH | 3 Jul 2008 | 3 Sep 2025 | 2 Jul 2026 |
| 82 | nts.xyz | GMO Internet Inc. | 2 Jul 2014 | 22 Apr 2024 | 2 Jul 2026 |
| 83 | nts.bz | Gandi SAS | 9 Apr 2008 | 24 Mar 2025 | 9 Apr 2026 |
| 84 | nts.ch | - | - | - | - |
| 85 | nts.cc | Bizcn.com, Inc. | 17 Mar 2018 | 14 Mar 2025 | 17 Mar 2026 |
| 86 | nts.ca | Namespro Solutions Inc. | 5 Mar 2005 | 17 Nov 2025 | 5 Mar 2026 |
| 87 | nts.de | - | - | 2 Sep 2019 | - |
| 88 | nts.fr | OVH sas | 22 Jul 2008 | 1 Sep 2024 | 21 Jul 2027 |
| 89 | nts.kr | - | 21 Nov 2009 | 17 Oct 2017 | 21 Nov 2018 |
| 90 | nts.it | - | 20 Aug 2009 | 20 Sep 2025 | 4 Sep 2026 |
| 91 | nts.me | Dynadot, LLC | 12 Apr 2019 | 18 Dec 2025 | 12 Apr 2027 |
| 92 | nts.pl | - | 9 Aug 2010 | 8 May 2025 | 9 Aug 2026 |
| 93 | nts.tv | Dynadot, LLC | 12 Aug 2015 | 11 Sep 2025 | 12 Aug 2026 |
| 94 | nts.wtf | NameCheap, Inc. | 6 Jul 2020 | 8 Jun 2025 | - |
| 95 | nts.ae | - | - | - | - |
| 96 | nts.sale | NameCheap, Inc. | 25 Feb 2023 | 7 May 2024 | 25 Feb 2024 |
| 97 | nts.team | Google, Inc. | 6 Jul 2019 | 3 Jun 2025 | 6 Jul 2029 |
| 98 | nts.events | Gandi SAS | 11 Aug 2017 | 13 Jul 2024 | 11 Aug 2025 |
| 99 | nts.show | Tucows Domains Inc. | 6 Sep 2017 | 5 Sep 2025 | - |
| 100 | nts.ltd | Mesh Digital Limited | 20 May 2019 | 18 May 2020 | 20 May 2021 |
| 101 | nts.energy | GoDaddy.com, LLC | 27 May 2022 | 11 Jul 2025 | 27 May 2026 |
| 102 | nts.directory | Wild West Domains, LLC | 10 Nov 2017 | 10 Nov 2017 | 10 Nov 2018 |
| 103 | nts.me.uk | - | 25 Sep 2013 | 25 Sep 2013 | 25 Sep 2018 |
| 104 | nts.marketing | NameCheap, Inc. | 28 Feb 2018 | 28 Feb 2025 | - |
| 105 | nts.com.co | CommuniGal Communication Ltd. | 11 Apr 2025 | 16 Apr 2025 | 11 Apr 2026 |
| 106 | nts.taxi | NameCheap, Inc. | 15 Mar 2018 | 13 Feb 2025 | - |
| 107 | nts.tattoo | Soluciones Corporativas IP, SLU | 2 May 2018 | - | 2 May 2019 |
| 108 | nts.coffee | GoDaddy.com, LLC | 4 Jul 2018 | 5 Jul 2020 | 4 Jul 2021 |
| 109 | nts.group | GoDaddy.com, LLC | 19 Sep 2023 | 30 Nov 2025 | 19 Sep 2025 |
| 110 | nts.tienda | Soluciones Corporativas IP, SLU | 9 Oct 2018 | 11 Sep 2025 | 9 Oct 2026 |
| 111 | nts.direct | NameCheap, Inc. | 5 Nov 2018 | 5 Nov 2018 | 5 Nov 2019 |
| 112 | nts.gmbh | Vautron Rechenzentrum AG | 28 Feb 2019 | 1 Mar 2025 | 28 Feb 2026 |
| 113 | nts.farm | Vautron Rechenzentrum AG | 28 Feb 2019 | 1 Mar 2025 | 28 Feb 2026 |
| 114 | nts.expert | Vautron Rechenzentrum AG | 28 Feb 2019 | 1 Mar 2025 | 28 Feb 2026 |
| 115 | nts.dev | Namesilo, LLC | 25 Jun 2025 | 19 Dec 2025 | - |
| 116 | nts.email | GoDaddy.com, LLC | 18 Dec 2021 | 19 Dec 2025 | 18 Dec 2026 |
| 117 | nts.ventures | register.com, Inc. | 5 Apr 2019 | 3 Jun 2025 | 5 Apr 2026 |
| 118 | nts.cool | GoDaddy.com, LLC | 27 Apr 2019 | 27 Apr 2019 | 27 Apr 2020 |
| 119 | nts.photography | Porkbun, LLC | 10 Sep 2019 | 12 Mar 2022 | 10 Sep 2022 |
| 120 | nts.digital | - | 12 Nov 2024 | 17 Dec 2025 | 12 Nov 2025 |
| 121 | nts.fund | - | 1 May 2025 | - | 1 May 2026 |
| 122 | nts.technology | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 18 Aug 2023 | 17 Sep 2024 | 18 Aug 2024 |
| 123 | nts.travel | Hostinger, UAB | 17 Jul 2025 | - | - |
| 124 | nts.wiki | NameCheap, Inc. | 16 Jul 2025 | 21 Jul 2025 | 16 Jul 2026 |
| 125 | nts.city | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Nov 2020 | 27 Nov 2020 | 27 Nov 2021 |
| 126 | nts.realty | Epik Inc. | 27 Nov 2020 | 27 Nov 2020 | 27 Nov 2021 |
| 127 | nts.plus | Chengdu West Dimension Digital Technology Co., Ltd… | 28 Nov 2020 | 28 Nov 2020 | 28 Nov 2022 |
| 128 | nts.agency | Porkbun, LLC | 12 Jul 2023 | 11 Jul 2025 | 12 Jul 2026 |
| 129 | nts.training | Google, Inc. | 6 Oct 2021 | 6 Oct 2025 | 6 Oct 2026 |
| 130 | nts.realestate | Wild West Domains, LLC | 16 Nov 2021 | 16 Nov 2022 | 16 Nov 2023 |
| 131 | nts.co.kr | - | 29 Jan 2000 | 13 Dec 2019 | 29 Jan 2023 |
| 132 | nts.zone | Xin Net Technology Corporation | - | 21 Mar 2025 | 20 Feb 2026 |
| 133 | nts.co.id | - | 20 Dec 2018 | 3 Feb 2022 | 20 Dec 2022 |
| 134 | nts.ma | - | 10 Apr 2025 | 26 Jun 2025 | 10 Apr 2026 |
| 135 | nts.eu.com | NameCheap, Inc. | 14 May 2025 | 1 Jun 2025 | 14 May 2026 |
| 136 | nts.or.kr | - | 9 Sep 2005 | 18 Apr 2020 | 9 Sep 2022 |
| 137 | nts.ru.com | NameKing.com Inc. | 9 Dec 2025 | 9 Dec 2025 | 9 Dec 2026 |
| 138 | nts.ag | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Jul 2016 | 10 Jul 2021 | 10 Jul 2022 |
| 139 | nts.net.au | - | - | 7 Dec 2025 | - |
| 140 | nts.co.jp | - | 7 Feb 2007 | 1 Mar 2025 | - |
| 141 | nts.co.in | - | 1 Jun 2024 | 1 Aug 2025 | 1 Jun 2026 |
| 142 | nts.af | - | 26 Apr 2020 | 16 Oct 2023 | 26 Apr 2022 |
| 143 | nts.business | GoDaddy.com, LLC | 17 Oct 2022 | 1 Dec 2025 | 17 Oct 2026 |
| 144 | nts.co.nz | - | 19 Feb 2024 | 8 Jan 2026 | - |
| 145 | nts.com.pl | - | 14 Nov 2003 | 5 Nov 2025 | 14 Nov 2026 |
| 146 | nts.io | Gandi SAS | 31 Oct 2013 | 15 Dec 2025 | 31 Oct 2026 |
| 147 | nts.edu.pl | Namware.com, Inc. | 10 Jul 2020 | 3 Jul 2025 | 10 Jul 2026 |
| 148 | nts.bio | Name.com, Inc. | 24 Dec 2022 | 8 Dec 2025 | 24 Dec 2026 |
| 149 | nts.ai | NameCheap, Inc. | 8 Nov 2018 | 20 Nov 2025 | 8 Nov 2026 |
| 150 | nts.onl | NameCheap, Inc. | 13 Jan 2023 | 19 Dec 2025 | 13 Jan 2027 |
| 151 | nts.app | - | 15 Jul 2019 | 18 Aug 2025 | - |
| 152 | nts.auction | OVH sas | 15 Feb 2022 | 20 Feb 2022 | 15 Feb 2023 |
| 153 | nts.ps | - | 11 Jul 2007 | 25 May 2022 | 11 Jul 2024 |
| 154 | nts.gl | Key-Systems GmbH | 19 Dec 2013 | 5 Dec 2025 | 19 Dec 2026 |
| 155 | nts.co.th | - | 13 Dec 2012 | 21 Nov 2025 | 12 Dec 2034 |
| 156 | nts.co.ke | - | 22 Jul 2021 | 8 Dec 2025 | 22 Jul 2026 |
| 157 | nts.cat | 10dencehispahard, S.L. | 11 Jun 2012 | 28 May 2025 | 11 Jun 2026 |
| 158 | nts.org.cn | ???????????? | 1 Dec 2025 | - | 1 Dec 2026 |
| 159 | nts.hr | - | 17 Aug 2020 | 16 Jun 2025 | 17 Aug 2026 |
| 160 | nts.fyi | NameCheap, Inc. | 8 Feb 2026 | - | - |
| 161 | nts.org.nz | - | 2 Sep 2015 | 23 Jul 2025 | - |
| 162 | nts.earth | Vautron Rechenzentrum AG | 28 Feb 2019 | 14 Oct 2025 | 28 Feb 2026 |
| 163 | nts.monster | Megazone Corp., dba HOSTING.KR | 4 Apr 2023 | 16 May 2024 | 4 Apr 2024 |
| 164 | nts.llc | GoDaddy.com, LLC | 13 Nov 2019 | 28 Dec 2025 | 13 Nov 2026 |
| 165 | nts.consulting | GoDaddy.com, LLC | 18 Dec 2020 | 28 Feb 2025 | 18 Dec 2024 |
| 166 | nts.fit | GoDaddy.com, LLC | 17 Aug 2020 | 28 Sep 2024 | 17 Aug 2024 |
| 167 | nts.icu | NameCheap, Inc. | 7 Feb 2020 | 13 Feb 2025 | 7 Feb 2026 |
| 168 | nts.md | - | 21 May 2021 | - | 21 May 2026 |
| 169 | nts.nl | - | 5 Jan 1997 | 11 Jul 2025 | - |
| 170 | nts.ovh | OVH sas | 13 Apr 2022 | 6 Apr 2025 | 13 Apr 2026 |
| 171 | nts.pharmacy | EnCirca, Inc. | 15 Oct 2019 | 15 Oct 2024 | 15 Oct 2024 |
| 172 | nts.org.pl | Namware.com, Inc. | 29 Dec 2025 | 29 Dec 2025 | 29 Dec 2026 |
| 173 | nts.com.br | - | 18 Apr 2013 | 14 Apr 2023 | 18 Apr 2026 |
| 174 | nts.work | GMO Internet Inc. | 8 Aug 2019 | 15 Oct 2025 | 8 Aug 2025 |
| 175 | nts.cafe | NameCheap, Inc. | 16 May 2023 | 27 Jun 2024 | 16 May 2024 |
| 176 | nts.studio | NameCheap, Inc. | 9 Nov 2021 | 19 Oct 2024 | 9 Nov 2025 |
| 177 | nts.la | Reserved for non-billable transactions where Regis… | 22 Nov 2021 | 16 Nov 2025 | 22 Nov 2026 |
| 178 | nts.im | - | - | - | - |
| 179 | nts.au | - | - | 7 Mar 2024 | - |
| 180 | nts.store | DOTSERVE INC. | 21 Aug 2020 | 22 Aug 2025 | 21 Aug 2026 |
| 181 | nts.cash | Hostinger, UAB | 2 Jun 2023 | - | - |
| 182 | nts.com.au | - | - | 15 Jul 2025 | - |
| 183 | nts.uk | - | 4 Jul 2019 | 22 Jul 2025 | 4 Jul 2026 |
| 184 | nts.lt | INTERNEXT | 19 Jun 2020 | - | 20 Jun 2026 |
| 185 | nts.com.cn | - | 17 May 2000 | - | 17 Jun 2031 |
| 186 | nts.be | - | 3 Jun 2002 | - | - |
| 187 | nts.lat | Porkbun, LLC | 2 Aug 2023 | 14 Oct 2024 | 2 Aug 2024 |
| 188 | nts.pt | - | - | - | - |
| 189 | nts.management | - | 10 Jan 2025 | 11 Jun 2025 | 10 Jan 2026 |
| 190 | nts.tools | NameCheap, Inc. | 25 Oct 2023 | 24 Sep 2025 | - |
| 191 | nts.tours | Limited Liability Company "Registrar of domain nam… | 31 Oct 2023 | 16 Oct 2025 | 31 Oct 2026 |
| 192 | nts.social | NameCheap, Inc. | 1 Dec 2023 | 1 Nov 2024 | - |
| 193 | nts.software | NameCheap, Inc. | 14 Feb 2024 | 20 Jan 2025 | 14 Feb 2026 |
| 194 | nts.ie | - | 26 Jul 2006 | 5 Sep 2025 | 27 Jul 2027 |
| 195 | nts.wien | NETIM SARL | 15 Dec 2025 | 15 Dec 2025 | 15 Dec 2026 |
| 196 | nts.cl | - | 13 Sep 2011 | - | 9 Oct 2027 |
| 197 | nts.solar | OVH sas | 3 Apr 2024 | 18 May 2025 | 3 Apr 2026 |
| 198 | nts.moe | Porkbun, LLC | 6 Apr 2024 | 19 May 2025 | 6 Apr 2025 |
| 199 | nts.ro | - | 21 Dec 2018 | - | - |
| 200 | nts.ru | - | 22 Feb 1999 | - | 28 Feb 2026 |
| 201 | nts.sk | - | 22 Apr 2003 | 1 Apr 2025 | 18 Apr 2026 |
| 202 | nts.delivery | NameCheap, Inc. | 8 May 2024 | 8 May 2024 | 8 May 2025 |
| 203 | nts.se | - | 16 Nov 2011 | 14 Nov 2025 | 16 Nov 2026 |
| 204 | nts.so | - | 14 May 2024 | 1 Dec 2025 | 14 May 2025 |
| 205 | nts.eu | Vautron Rechenzentrum AG | - | - | - |
| 206 | nts.homes | - | 15 Aug 2025 | 4 Sep 2025 | 15 Aug 2026 |
| 207 | nts.bond | Dynadot, LLC | 24 Jun 2024 | 6 Aug 2024 | 24 Jun 2034 |
| 208 | nts.kiwi | GoDaddy.com, LLC | 9 Jul 2024 | 19 Sep 2025 | 9 Jul 2025 |
| 209 | nts.academy | Domain.com, LLC | 25 Jul 2024 | 29 Jul 2025 | 25 Jul 2026 |
| 210 | nts.dk | - | 15 Oct 1996 | - | 31 Dec 2026 |
| 211 | nts.hu | - | 30 May 2020 | - | - |
| 212 | nts.capital | - | 3 Jan 2026 | - | 3 Jan 2027 |
| 213 | nts.trading | NameCheap, Inc. | 4 Oct 2024 | - | - |
| 214 | nts.cm | - | 11 Nov 2024 | 14 Nov 2025 | 11 Nov 2026 |
| 215 | nts.sh | Gandi SAS | 9 Aug 2017 | 10 Jul 2025 | 9 Aug 2026 |
| 216 | nts.fun | NameCheap, Inc. | 27 Jan 2025 | 28 Jan 2026 | 27 Jan 2027 |
| 217 | nts.at | - | - | 22 Jun 2017 | - |
| 218 | nts.cz | - | 4 Aug 1998 | 26 Oct 2018 | 27 Oct 2026 |
| 219 | nts.jp | - | 1 Aug 2013 | 1 Sep 2025 | 31 Aug 2026 |
| 220 | nts.vc | Dynadot, LLC | 4 Mar 2025 | 9 Mar 2025 | 4 Mar 2026 |
| 221 | nts.cn | - | 31 Mar 2003 | - | 31 Mar 2026 |
| 222 | nts.by | - | 4 Oct 2016 | 7 Aug 2025 | 4 Oct 2027 |
| 223 | nts.mg | Lexsynergy Limited | 25 Apr 2013 | 15 Oct 2025 | 25 Apr 2026 |
| 224 | nts.uk.com | NameCheap, Inc. | 28 May 2025 | 1 Jul 2025 | 28 May 2026 |
| 225 | nts.com.lc | Tucows Domains Inc. | 23 Sep 2025 | 28 Sep 2025 | 23 Sep 2026 |
| 226 | nts.web.id | Reserved | 13 Dec 2024 | 15 Dec 2025 | 13 Dec 2026 |
| 227 | nts.in.net | NameKing.com Inc. | 24 Oct 2025 | 5 Nov 2025 | 24 Oct 2026 |
| 228 | nts.com.de | - | - | 4 Dec 2025 | - |
| 229 | nts.nz | - | 4 Nov 2025 | 20 Nov 2025 | - |
| 230 | nts.baby | NameCheap, Inc. | 21 Nov 2025 | 1 Dec 2025 | 21 Nov 2026 |
| 231 | nts.gb.net | Dynadot, LLC | 29 Oct 2025 | 26 Nov 2025 | 29 Oct 2026 |
| 232 | nts.my.id | Reserved | 10 Mar 2020 | 24 Apr 2025 | 10 Mar 2026 |
| 233 | nts-world.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Dec 2003 | 10 Dec 2025 | 3 Dec 2026 |
| 234 | ntslive.co.uk | - | 27 Jan 2011 | 23 Dec 2025 | 27 Jan 2027 |
| 235 | ntslibrary.com | Tucows Domains Inc. | 14 Nov 2005 | 16 Oct 2025 | 14 Nov 2026 |
| 236 | ntsa.us | Wild West Domains, LLC | 16 Jul 2003 | 16 Jul 2017 | 15 Jul 2018 |
| 237 | ntsdata.com | Network Solutions, LLC | 12 Dec 1996 | 31 Oct 2024 | 11 Dec 2029 |
| 238 | ntsupply.com | CloudFlare, Inc. | 29 Mar 2006 | 6 Mar 2025 | 29 Mar 2026 |
| 239 | ntsc-fr.com | Namesilo, LLC | 7 Dec 2005 | 29 Sep 2025 | 7 Dec 2026 |
| 240 | ntsoft.in | SiliconHouse.Net Pvt. Ltd. | 21 Nov 2008 | 5 Jan 2026 | 21 Nov 2026 |
| 241 | ntsrxdou.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 242 | nts85.com | Xiamen Nawang Technology Co., Ltd | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 243 | nts-corp.com | Gabia, Inc. | 8 Mar 2011 | 19 Feb 2025 | 8 Mar 2026 |
| 244 | ntsc.ac.cn | - | 7 Sep 2000 | - | 7 Sep 2030 |
| 245 | ntseafood.com | GoDaddy.com, LLC | 30 Aug 2021 | 11 Nov 2023 | 30 Aug 2023 |
| 246 | ntsehelpline.com | GoDaddy.com, LLC | 6 Aug 2013 | 23 Jul 2025 | 6 Aug 2030 |
| 247 | ntsen.com | DropCatch.com 1216 LLC | 27 Dec 2025 | 27 Dec 2025 | 27 Dec 2026 |
| 248 | ntsforums.com | Nordreg AB | 8 Oct 2025 | 7 Dec 2025 | 8 Oct 2026 |
| 249 | ntshy.com | TurnCommerce, Inc. DBA NameBright.com | 19 Feb 2021 | 27 Aug 2021 | 19 Feb 2026 |
| 250 | ntsi.com | GoDaddy.com, LLC | 17 Oct 1997 | 23 Jan 2024 | 3 Apr 2030 |
| 251 | ntspl.co.in | - | 28 Oct 2007 | 14 May 2023 | 28 Oct 2028 |
| 252 | ntst.com | NameCheap, Inc. | 18 May 2000 | 18 Apr 2025 | 18 May 2026 |
| 253 | ntsupdates.com | GoDaddy.com, LLC | 24 Jul 2025 | 24 Jul 2025 | 24 Jul 2026 |
| 254 | ntsb.gov | - | - | - | - |
| 255 | ntsk.ru | - | 20 Apr 2004 | - | 20 Apr 2026 |
| 256 | ntsms.tk | - | - | - | - |
| 257 | ntstur.ru | - | 28 Jan 2025 | - | 28 Jan 2027 |
| 258 | ntsecurity.nu | - | - | - | - |
| 259 | ntskeptics.org | Domain.com, LLC | 25 Jan 2000 | 10 Jan 2026 | 25 Jan 2027 |
| 260 | ntsj.js.cn | - | 17 Jun 2005 | - | 17 Jun 2026 |
| 261 | ntshtml.com | Extra Threads Corporation | 8 Dec 2022 | 21 Feb 2024 | 8 Dec 2023 |
| 262 | ntss.com.cn | ???????????? | 19 Apr 2025 | - | 19 Apr 2026 |
| 263 | ntsck.com | HiChina Zhicheng Technology Limited | 11 Feb 2020 | 12 Feb 2020 | 11 Feb 2021 |
| 264 | ntsadhg.com | Xin Net Technology Corporation | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 265 | ntsradio.co.uk | - | 14 Aug 2014 | 10 Jul 2025 | 14 Aug 2026 |
| 266 | ntsquiz.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2020 | 4 Nov 2020 | 4 Nov 2021 |
| 267 | ntsforum.info | UK-2 Limited | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 268 | ntschools.net | Melbourne IT, Ltd | 30 Jun 2006 | 17 Jun 2025 | 30 Jun 2030 |
| 269 | ntsionline.com | GoDaddy.com, LLC | 11 Mar 1998 | 4 Apr 2025 | 3 Apr 2026 |
| 270 | ntszy.com | eName Technology Co., Ltd. | 1 Dec 2024 | 26 Dec 2025 | 1 Dec 2026 |
| 271 | ntsoaki.biz | Tucows Domains Inc. | 21 Oct 2013 | 24 Oct 2014 | 20 Oct 2014 |
| 272 | ntsmallbusinessit.com | Domain.com, LLC | 25 Oct 2014 | 8 Jun 2016 | 25 Oct 2019 |
| 273 | ntsbit.com | 1API GmbH | 2 Apr 2021 | 3 Apr 2021 | 2 Apr 2022 |
| 274 | ntsoccer.com | Network Solutions, LLC | 24 Jan 1999 | 20 Nov 2025 | 24 Jan 2031 |
| 275 | nts-cze.com | TLD Registrar Solutions Ltd. | 17 May 2015 | 25 May 2015 | 17 May 2016 |
| 276 | ntsale.ru | - | 16 Dec 2023 | - | 16 Dec 2024 |
| 277 | ntslf.org | 1&1 Internet AG | 17 Mar 2008 | 9 Sep 2025 | 17 Mar 2033 |
| 278 | ntschool.ru | - | 16 Mar 2014 | - | 16 Mar 2026 |
| 279 | ntssds.com | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2017 |
| 280 | ntscoop.com | GMO Internet Inc. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 281 | ntsaorecords.us | GoDaddy.com, LLC | 31 May 2014 | 31 May 2014 | 30 May 2015 |
| 282 | ntshjx.net | Wild West Domains, LLC | 25 Oct 2014 | 26 Oct 2014 | 25 Oct 2015 |
| 283 | ntslzz.com | GMO Internet Inc. | 26 Jan 2023 | 7 Apr 2024 | 26 Jan 2024 |
| 284 | ntsareno.net | GoDaddy.com, LLC | 23 May 2012 | 24 May 2015 | 23 May 2016 |
| 285 | ntsareno.com | GoDaddy.com, LLC | 23 May 2012 | 24 May 2015 | 23 May 2016 |
| 286 | ntsvacd.com | GoDaddy.com, LLC | 28 Oct 2014 | 25 Mar 2016 | 28 Oct 2018 |
| 287 | ntslsj.com | Xin Net Technology Corporation | 17 Dec 2019 | 24 Nov 2025 | 17 Dec 2026 |
| 288 | ntseo.com | NamePal.com #8015 | 5 Jan 2026 | 7 Jan 2026 | 5 Jan 2027 |
| 289 | ntsvacd.net | GoDaddy.com, LLC | 28 Oct 2014 | 25 Mar 2016 | 28 Oct 2018 |
| 290 | ntsvacd.info | GoDaddy.com, LLC | 28 Oct 2014 | 25 Mar 2016 | 28 Oct 2018 |
| 291 | ntservice.com | eNom, Inc. | 1 Apr 2002 | 4 Dec 2025 | 1 Apr 2026 |
| 292 | ntserv.com | eNom, Inc. | 26 May 2010 | 10 Dec 2025 | 26 May 2026 |
| 293 | ntservis.com | Tucows Domains Inc. | 3 Nov 2023 | 3 Nov 2023 | 3 Nov 2033 |
| 294 | ntsummit.com | GoDaddy.com, LLC | 7 Dec 2021 | 15 Dec 2025 | 7 Dec 2026 |
| 295 | ntsevents.com | Amazon Registrar, Inc. | 11 Aug 2017 | 24 Oct 2024 | 11 Aug 2024 |
| 296 | ntspam.com | TurnCommerce, Inc. DBA NameBright.com | 4 May 2018 | 16 Jul 2024 | 4 May 2024 |
| 297 | ntspo365.com | TLDs LLC dba SRSplus | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 298 | ntsolutions.net | Wild West Domains, LLC | 28 Sep 2014 | 29 Sep 2025 | 28 Sep 2026 |
| 299 | ntstar.com | eNom, Inc. | 2 Jul 2011 | 11 Jul 2025 | 2 Jul 2026 |
| 300 | ntsvacd.org | GoDaddy.com, LLC | 28 Oct 2014 | 25 Mar 2016 | 28 Oct 2018 |
| 301 | ntscreenawards.com | GoDaddy.com, LLC | 20 Jun 2013 | 21 Jun 2015 | 20 Jun 2016 |
| 302 | ntswjd.com | Bizcn.com, Inc. | 29 Oct 2014 | 29 Oct 2025 | 29 Oct 2026 |
| 303 | ntsd.net | Fabulous.com Pty Ltd. | 24 Feb 2006 | 25 Feb 2025 | 24 Feb 2026 |
| 304 | ntszyf.com | Hello Internet Corp. | 6 Jun 2024 | 6 Jun 2025 | 6 Jun 2026 |
| 305 | ntshyl.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 306 | ntsenhu.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 30 Jan 2023 | 8 Mar 2024 | 30 Jan 2024 |
| 307 | ntsdlsz.com | Dynadot, LLC | 16 Dec 2020 | 25 Jan 2024 | 16 Dec 2023 |
| 308 | ntsansheng.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Jun 2017 | 26 Dec 2025 | 15 Jun 2026 |
| 309 | ntsts.com | Namesilo, LLC | 21 Jan 2026 | 22 Jan 2026 | 21 Jan 2027 |
| 310 | ntskckkr.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 311 | ntshelp.com | TurnCommerce, Inc. DBA NameBright.com | 28 May 2017 | 22 May 2020 | 28 May 2026 |
| 312 | ntscu.org | Tucows Domains Inc. | 14 Nov 2024 | 25 Dec 2025 | 14 Nov 2025 |
| 313 | ntsport.com | GoDaddy.com, LLC | 24 Mar 2011 | 23 Mar 2025 | 24 Mar 2026 |
| 314 | ntsettlement.com | GoDaddy.com, LLC | 12 Mar 2012 | 11 Dec 2025 | 1 Jan 2027 |
| 315 | ntscape.com | - | 10 Jul 1997 | 29 Apr 2024 | 9 Jul 2026 |
| 316 | ntsapartments.com | GoDaddy.com, LLC | 19 Nov 2002 | 20 Nov 2025 | 19 Nov 2026 |
| 317 | ntservices.com | Namesilo, LLC | 3 Dec 1996 | 4 Nov 2025 | 2 Dec 2026 |
| 318 | ntsjgs.com | Bizcn.com, Inc. | 8 Nov 2017 | 8 Nov 2017 | 8 Nov 2018 |
| 319 | ntsmediaonline.com | DropCatch.com 1114 LLC | 31 May 2022 | 8 Jun 2022 | 31 May 2026 |
| 320 | ntspend.com | GoDaddy.com, LLC | 27 Sep 2005 | 12 Nov 2025 | 27 Sep 2026 |
| 321 | ntsaainst.com | HiChina Zhicheng Technology Limited | 21 Apr 2018 | 21 Apr 2018 | 21 Apr 2019 |
| 322 | ntsbeeo.net | Network Solutions, LLC | 31 Oct 2014 | 1 Sep 2023 | 31 Oct 2026 |
| 323 | ntschool.com | GoDaddy.com, LLC | 29 Mar 1998 | 3 May 2025 | 23 May 2026 |
| 324 | ntspzu.com | Network Solutions, LLC | 2 Jun 2014 | 4 Jun 2015 | 2 Jun 2016 |
| 325 | ntsolutions-eg.com | Tucows Domains Inc. | 14 Aug 2024 | 18 Aug 2025 | 14 Aug 2026 |
| 326 | ntsselfdefensehomesecurity.com | GoDaddy.com, LLC | 2 Nov 2014 | 8 Nov 2014 | 2 Nov 2019 |
| 327 | nts-krym.com | GoDaddy.com, LLC | 9 Jun 2014 | 10 Jun 2015 | 9 Jun 2016 |
| 328 | ntsfqb.com | GoDaddy.com, LLC | 8 Jun 2012 | 9 Jun 2015 | 8 Jun 2016 |
| 329 | ntsstaffing.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jun 2009 | 10 Nov 2025 | 11 Jun 2026 |
| 330 | ntsdreams.com | GoDaddy.com, LLC | 11 Jun 2014 | 12 Jun 2015 | 11 Jun 2016 |
| 331 | nts-pow.com | Network Solutions, LLC | 1 Jun 2012 | 17 Apr 2022 | 1 Jun 2027 |
| 332 | ntswest.org | Network Solutions, LLC | 15 Apr 2013 | 19 Feb 2025 | 15 Apr 2026 |
| 333 | ntschools.org | Network Solutions, LLC | 28 Jan 2004 | 2 Feb 2024 | 28 Jan 2034 |
| 334 | ntsoa.com | MarkMonitor Inc. | 10 Jan 2011 | 9 Dec 2025 | 10 Jan 2028 |
| 335 | nts-digital.net | eNom, Inc. | 9 Aug 2014 | 6 Aug 2025 | 9 Aug 2026 |
| 336 | ntshealth.com.au | - | - | 4 Jun 2025 | - |
| 337 | nts-unitek.com | register.com, Inc. | 14 Aug 2013 | 15 Jul 2024 | 14 Aug 2026 |
| 338 | ntsmotorsports.com | Domaininfo AB, aka domaininfo.com | 30 Sep 2017 | 17 Nov 2025 | 30 Sep 2026 |
| 339 | ntsusa.org | eNom, Inc. | 13 Nov 2003 | 13 Nov 2024 | 13 Nov 2027 |
| 340 | ntsunjoy.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Apr 2022 | 5 Jun 2023 | 24 Apr 2023 |
| 341 | ntsitsolutions.com | GoDaddy.com, LLC | 18 Sep 2020 | 19 Sep 2025 | 18 Sep 2026 |
| 342 | nts-info.com | Network Solutions, LLC | 8 Jul 1998 | 10 Jul 2025 | 7 Jul 2026 |
| 343 | ntsui.mobi | eNom, Inc. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 344 | ntstrading.com | NameCheap, Inc. | 5 Nov 2024 | 6 Oct 2025 | 5 Nov 2026 |
| 345 | ntsdesigns.com | Tucows Domains Inc. | 23 Aug 2018 | 8 Aug 2025 | 23 Aug 2026 |
| 346 | ntsryl.com | Key-Systems GmbH | 28 Apr 2023 | 11 Jun 2024 | 28 Apr 2024 |
| 347 | ntsushi.com | - | 27 Mar 2023 | 29 May 2024 | 27 Mar 2024 |
| 348 | ntsygs.com | Metaregistrar BV Applications | 13 Dec 2025 | 15 Dec 2025 | 13 Dec 2026 |
| 349 | ntsfibergig.com | GoDaddy.com, LLC | 19 Aug 2014 | 20 Aug 2025 | 19 Aug 2026 |
| 350 | ntsjjf.com | West263 International Limited | 30 Apr 2025 | 30 Apr 2025 | 30 Apr 2026 |
| 351 | ntsrkj.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jul 2025 | 19 Jul 2025 | 13 Jul 2026 |
| 352 | nts777.net | Dynadot, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 353 | nts43.com | GoDaddy.com, LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 354 | ntsjobs.com | GoDaddy.com, LLC | 9 Sep 2020 | 30 Sep 2025 | 9 Sep 2026 |
| 355 | ntsri.com | GoDaddy.com, LLC | 29 Apr 2014 | 30 Apr 2025 | 29 Apr 2026 |
| 356 | ntszx.com | DropCatch.com 1487 LLC | 16 Aug 2025 | 16 Aug 2025 | 16 Aug 2026 |
| 357 | ntswsjc.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Nov 2021 | 12 Nov 2023 | 11 Nov 2024 |
| 358 | ntshirui.com | Xin Net Technology Corporation | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 359 | ntsemi.com | eNom, Inc. | 6 Nov 2014 | 14 Mar 2017 | 6 Nov 2017 |
| 360 | nts77.com | eNom, Inc. | 12 Jun 2017 | 13 Aug 2025 | 12 Jun 2026 |
| 361 | nts-ky.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 362 | ntsfilemover.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2019 |
| 363 | ntsmby.com | - | 30 May 2022 | 1 Jul 2023 | 30 May 2023 |
| 364 | ntssdj.com | Xin Net Technology Corporation | 12 Mar 2018 | 4 Feb 2020 | 12 Mar 2021 |
| 365 | ntsweethome.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 366 | ntsente.com | DropCatch.com 418 LLC | 8 May 2022 | 19 Jul 2023 | 8 May 2023 |
| 367 | ntsggroup.com | Xiamen Nawang Technology Co., Ltd | 13 Jan 2015 | 14 Jan 2026 | 13 Jan 2026 |
| 368 | ntshusafari.com | NetEarth One Inc. d/b/a NetEarth | 15 Sep 2021 | 22 Sep 2025 | 15 Sep 2026 |
| 369 | ntsyt.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 Oct 2025 | 17 Oct 2025 | 17 Oct 2026 |
| 370 | ntsf-lab.com | Sksa Technology Co., Ltd | 16 Apr 2023 | 17 Apr 2024 | 16 Apr 2025 |
| 371 | ntshealthltd.com | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 372 | ntsmjj.com | - | 2 Oct 2022 | 3 Oct 2023 | 2 Oct 2024 |
| 373 | ntsrhb.com | GoDaddy.com, LLC | 5 Jun 2022 | 17 Jun 2024 | 5 Jun 2025 |
| 374 | nts-import.com | GoDaddy.com, LLC | 28 Feb 2015 | 1 Mar 2015 | 28 Feb 2016 |
| 375 | ntstechnicalgroup.com | Realtime Register B.V. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 376 | ntshifa.com | Beijing Lanhai Jiye Technology Co., Ltd | 14 Jan 2023 | 29 Dec 2025 | 14 Jan 2027 |
| 377 | ntsdjxc.com | Namesilo, LLC | 22 Dec 2017 | 20 Dec 2025 | 22 Dec 2026 |
| 378 | ntsktv.com | Jiangsu Bangning Science and technology Co. Ltd. | 26 Jan 2020 | 26 Jan 2020 | 26 Jan 2021 |
| 379 | ntsrcx.com | Xin Net Technology Corporation | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 380 | ntsvn.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 3 Dec 2024 | 11 Nov 2025 | 3 Dec 2026 |
| 381 | ntsystem.biz | CommuniGal Communication Ltd. | 6 Nov 2020 | 11 Nov 2020 | 6 Nov 2021 |
| 382 | ntstechnologysrl.com | GoDaddy.com, LLC | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 383 | ntsnooker.com | eNom, Inc. | 23 Aug 2014 | 18 Aug 2025 | 23 Aug 2026 |
| 384 | ntsgroup.org | NameKing.com Inc. | 5 Jul 2022 | 24 May 2025 | 5 Jul 2026 |
| 385 | nts77.net | Web Commerce Communications Limited dba WebNic.cc | 6 Nov 2014 | 7 Nov 2014 | 6 Nov 2015 |
| 386 | nts365.com | Namesilo, LLC | 9 Nov 2014 | 12 Jan 2026 | 9 Nov 2025 |
| 387 | ntscx1919.com | GoDaddy.com, LLC | 12 Aug 2014 | 13 Aug 2014 | 12 Aug 2015 |
| 388 | ntsijiazhentan.com | Hefei Juming Network Technology Co., Ltd | 12 Aug 2014 | 25 Dec 2025 | 12 Aug 2026 |
| 389 | ntsindu.com | GoDaddy.com, LLC | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 390 | ntszygbefgha-cbpab.org | GMO Internet Inc. | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 391 | nts-stampi.com | Register.it SPA | 15 Apr 2015 | 15 Apr 2015 | 15 Apr 2016 |
| 392 | ntsacc.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 25 Aug 2014 | 21 Sep 2023 | 25 Aug 2026 |
| 393 | nts4l.org | GoDaddy.com, LLC | 13 Aug 2014 | 14 Aug 2016 | 13 Aug 2018 |
| 394 | ntscyvs.com | Network Solutions, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 395 | ntsdfz.com | - | 12 Jun 2025 | 15 Jun 2025 | 12 Jun 2026 |
| 396 | ntsdhg.com | Cloud Yuqu LLC | 4 May 2021 | 4 May 2021 | 4 May 2022 |
| 397 | ntsamerica.net | Cosmotown, Inc. | 30 Mar 2023 | 1 Apr 2024 | 30 Mar 2024 |
| 398 | ntsbd.com | NameCheap, Inc. | 21 May 2022 | 21 May 2025 | 21 May 2026 |
| 399 | ntscvn.com | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 400 | ntsitcare.com | GoDaddy.com, LLC | 25 Aug 2014 | 6 Oct 2024 | 25 Aug 2024 |
| 401 | ntslqz.com | - | 17 Jan 2026 | 18 Jan 2026 | 17 Jan 2027 |
| 402 | ntsmweoa.com | Network Solutions, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 403 | ntssqd.com | - | 18 Dec 2021 | 18 Dec 2021 | 18 Dec 2022 |
| 404 | ntsuhang.com | EJEE Group Holdings Limited | 26 Aug 2014 | 16 Nov 2016 | 26 Aug 2019 |
| 405 | ntszgy3.com | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 406 | ntsradio.com | Gandi SAS | 14 Aug 2014 | 10 Jul 2025 | 14 Aug 2026 |
| 407 | ntsbzss.com | Network Solutions, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 408 | ntsdmeg.com | Xin Net Technology Corporation | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 409 | ntsgrading.com | Tucows Domains Inc. | 27 Aug 2014 | 31 Aug 2024 | 27 Aug 2025 |
| 410 | ntstat.com | DropCatch.com 1239 LLC | 28 Jan 2017 | 31 Jan 2026 | 28 Jan 2027 |
| 411 | ntseo110.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Jan 2021 | 1 Feb 2026 | 29 Jan 2027 |
| 412 | nts-sea.com | GMO Internet Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 413 | ntscorporate.com | TurnCommerce, Inc. DBA NameBright.com | 1 Nov 2022 | 12 Jan 2026 | 1 Nov 2025 |
| 414 | ntstaffingsolutions.com | GoDaddy.com, LLC | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2016 |
| 415 | ntstranscriptions.com | Amazon Registrar, Inc. | 26 Aug 2002 | 22 Jul 2025 | 26 Aug 2026 |
| 416 | ntsysn.com | Beijing Lanhai Jiye Technology Co., Ltd | 9 Nov 2021 | 30 Dec 2025 | 9 Nov 2026 |
| 417 | ntsbdiv.com | Network Solutions, LLC | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 418 | ntsec.org | Xin Net Technology Corporation | 5 Jun 2017 | 3 Oct 2017 | 5 Jun 2018 |
| 419 | ntsfz.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Aug 2014 | 26 Dec 2025 | 16 Aug 2026 |
| 420 | ntsky.net | Gabia, Inc. | 8 Feb 2024 | 7 Jan 2025 | 8 Feb 2026 |
| 421 | ntsyhs.com | GMO Internet Inc. | 26 Nov 2024 | 6 Jan 2026 | 26 Nov 2025 |
| 422 | ntsurveillance.com | FastDomain Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 423 | ntslearningfraud.com | register.com, Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 424 | ntsforex.info | OVH sas | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 425 | ntsl.org | GoDaddy.com, LLC | 3 Mar 2023 | 15 Nov 2025 | 3 Mar 2027 |
| 426 | ntsrefundapp.com | eNom, Inc. | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 427 | ntsfbd.com | - | 24 Jul 2022 | 25 Sep 2023 | 24 Jul 2023 |
| 428 | ntslnk.com | Network Solutions, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 429 | ntspbx.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 430 | nts-international.info | NameCheap, Inc. | 29 Aug 2014 | 6 Aug 2024 | 29 Aug 2025 |
| 431 | ntsanjiang.com | Bizcn.com, Inc. | 29 Aug 2014 | 6 Sep 2025 | 29 Aug 2026 |
| 432 | ntsc2video.info | GMO Internet Inc. | 29 Aug 2014 | 7 Jun 2019 | 29 Aug 2020 |
| 433 | ntscalestx.org | eNom, Inc. | 29 Aug 2014 | 11 Mar 2017 | 29 Aug 2017 |
| 434 | ntserralheriaartistica.com | eNom, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 435 | ntsgjzx.com | Xin Net Technology Corporation | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 436 | ntslv.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 29 Aug 2014 | 1 Sep 2015 | 29 Aug 2016 |
| 437 | ntsac.com | GoDaddy.com, LLC | 8 Aug 2017 | 19 Oct 2025 | 8 Aug 2025 |
| 438 | ntsconstruction.net | GoDaddy.com, LLC | 21 Jul 2022 | 25 Jul 2025 | 21 Jul 2026 |
| 439 | ntswitch.com | 1&1 Internet AG | 15 Nov 2020 | 15 Nov 2020 | 15 Nov 2021 |
| 440 | nts99.com | Gabia, Inc. | 4 Dec 2023 | 5 Jan 2026 | 4 Dec 2030 |
| 441 | ntsc2monitor.info | GMO Internet Inc. | 1 Sep 2014 | 7 Jun 2019 | 1 Sep 2020 |
| 442 | ntsunny.com | Key-Systems GmbH | 22 Nov 2024 | 6 Jan 2026 | 22 Nov 2025 |
| 443 | nts-travel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jul 2025 | 22 Sep 2025 | 23 Jul 2026 |
| 444 | ntskyclub.com | HiChina Zhicheng Technology Limited | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 445 | ntsmyn.com | Network Solutions, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 446 | ntsc-display2eia-hanger.biz | GMO Internet Inc. | 1 Sep 2014 | 12 Jun 2019 | 31 Aug 2020 |
| 447 | ntsddispensary.com | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 448 | ntshenj.com | Jiangsu Bangning Science and technology Co. Ltd. | 5 Nov 2019 | 5 Nov 2019 | 5 Nov 2020 |
| 449 | ntskvnnoq1.com | GMO Internet Inc. | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 450 | ntsclw.com | register.com, Inc. | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 451 | ntsulian.com | Name.com, Inc. | 9 Jun 2025 | 15 Dec 2025 | 9 Jun 2026 |
| 452 | ntskolkata.org | GoDaddy.com, LLC | 13 Nov 2014 | 14 Nov 2025 | 13 Nov 2026 |
| 453 | ntsavmuajroj.com | Tucows Domains Inc. | 2 Sep 2014 | 6 Sep 2017 | 2 Sep 2017 |
| 454 | ntsavqabzib.com | Marcaria.com International, Inc. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 455 | ntsavsiab.com | Marcaria.com International, Inc. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 456 | ntsky.com | TurnCommerce, Inc. DBA NameBright.com | 21 Nov 2018 | 27 Apr 2025 | 21 Nov 2026 |
| 457 | ntsnewsletter.com | Name.com, Inc. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 458 | ntsgjxc.com | Namesilo, LLC | 9 Oct 2019 | 10 Oct 2019 | 9 Oct 2020 |
| 459 | ntsjbim.com | - | 21 Sep 2023 | 22 Sep 2024 | 21 Sep 2025 |
| 460 | ntstitle.com | GoDaddy.com, LLC | 15 Sep 2014 | 16 Sep 2018 | 15 Sep 2019 |
| 461 | ntstitlegroup.com | GoDaddy.com, LLC | 15 Sep 2014 | 16 Sep 2016 | 15 Sep 2017 |
| 462 | ntsyhnq.com | Network Solutions, LLC | 15 Sep 2014 | 16 Sep 2014 | 15 Sep 2015 |
| 463 | ntsoftsystems.com | 1&1 Internet AG | 15 Nov 2014 | 16 Nov 2016 | 15 Nov 2017 |
| 464 | ntsch.com | TurnCommerce, Inc. DBA NameBright.com | 15 Nov 2014 | 9 Nov 2020 | 15 Nov 2026 |
| 465 | nts-reizou.com | GMO Internet Inc. | 4 Sep 2014 | 5 Aug 2016 | 4 Sep 2017 |
| 466 | ntsinconse.com | GMO Internet Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 467 | ntsj18.com | Beijing Lanhai Jiye Technology Co., Ltd | 23 Apr 2023 | 11 Jan 2026 | 23 Apr 2026 |
| 468 | ntsjzs.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Aug 2017 | 24 Dec 2025 | 2 Aug 2026 |
| 469 | ntstechnologypartners.com | 1&1 Internet AG | 3 Sep 2014 | 9 Sep 2016 | 3 Sep 2018 |
| 470 | ntswglove.com | HiChina Zhicheng Technology Limited | 3 Sep 2014 | 11 Oct 2025 | 3 Sep 2025 |
| 471 | ntsdi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 472 | ntslsp.com | Metaregistrar BV Applications | 6 Nov 2025 | 7 Nov 2025 | 6 Nov 2026 |
| 473 | ntsswaw.com | Network Solutions, LLC | 17 Sep 2014 | 18 Sep 2014 | 17 Sep 2015 |
| 474 | ntstower.com | Tucows Domains Inc. | 12 Nov 2012 | 17 Nov 2014 | 12 Nov 2015 |
| 475 | ntsfvgq.com | Xin Net Technology Corporation | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 476 | ntspmediaa.com | eNom, Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 477 | ntsendustriyel.com | Google, Inc. | 18 Sep 2014 | 30 Nov 2025 | 18 Sep 2025 |
| 478 | ntshunke.com | Tencent Cloud Computing (Beijing) Limited Liabilit… | 18 Sep 2014 | 16 May 2025 | 18 Sep 2028 |
| 479 | ntshunyu.com | Threadagent.com, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 480 | nts-uk.com | GoDaddy.com, LLC | 27 May 2021 | 8 Aug 2023 | 27 May 2023 |
| 481 | ntsjboli.com | enom411, Incorporated | 22 Apr 2022 | 6 Jul 2023 | 22 Apr 2023 |
| 482 | ntslbg.com | - | 19 Aug 2023 | 21 Sep 2024 | 19 Aug 2024 |
| 483 | ntszosh.com | Network Solutions, LLC | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 484 | ntssjj.net | HiChina Zhicheng Technology Limited | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 485 | ntsbreporter.us | Tucows Domains Inc. | 5 Sep 2014 | 10 Aug 2023 | 4 Sep 2026 |
| 486 | nts-team.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 11 May 2025 | 11 May 2025 | 11 May 2026 |
| 487 | ntsunz.com | Network Solutions, LLC | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 488 | ntsxtjy.com | Xin Net Technology Corporation | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 489 | ntstdl.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Nov 2016 | 27 Dec 2025 | 19 Nov 2026 |
| 490 | ntsdgak.com | Xin Net Technology Corporation | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 491 | nts33.com | NameKing.com Inc. | 18 Nov 2014 | 23 Oct 2017 | 18 Nov 2018 |
| 492 | nts-eg.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2019 | 11 Dec 2019 | 11 Dec 2020 |
| 493 | ntsijiazt.com | Key-Systems GmbH | 28 Aug 2025 | 29 Nov 2025 | 28 Aug 2026 |
| 494 | ntsuite.com | Domain Success LLC | 10 Jan 2024 | 26 Mar 2025 | 10 Jan 2025 |
| 495 | ntspf.com | DropCatch.com 1044 LLC | 4 May 2023 | 15 Jul 2024 | 4 May 2024 |
| 496 | ntsaiab.com | Metaregistrar BV Applications | 4 Feb 2025 | 5 Apr 2025 | 4 Feb 2026 |
| 497 | ntscan091.com | Marcaria.com International, Inc. | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 498 | ntsqwl.com | - | 20 Apr 2023 | 21 Apr 2024 | 20 Apr 2025 |
| 499 | ntsports.com | GoDaddy.com, LLC | 15 Nov 2014 | 27 Dec 2025 | 15 Nov 2027 |
| 500 | ntspiti.com | Crazy Domains FZ-LLC | 12 Sep 2017 | 23 Sep 2021 | 12 Sep 2021 |
| 501 | ntsjhg.com | Namesilo, LLC | 13 Jul 2016 | 1 Jan 2026 | 13 Jul 2026 |
| 502 | nts2014.com | GMO Internet Inc. | 18 Nov 2014 | 21 Oct 2016 | 18 Nov 2017 |
| 503 | ntsikimazwai.com | Tucows Domains Inc. | 7 Jul 2017 | 26 May 2025 | 7 Jul 2026 |
| 504 | ntsgraphics.com | GoDaddy.com, LLC | 8 May 2025 | 8 May 2025 | 8 May 2026 |
| 505 | ntsdigitalmedia.com | register.com, Inc. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2018 |
| 506 | ntsim.net | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 507 | nts-coop.com | TLDs LLC dba SRSplus | 3 Oct 2014 | 29 Sep 2025 | 3 Oct 2026 |
| 508 | ntsyzs.com | HiChina Zhicheng Technology Limited | 28 Dec 2016 | 28 Dec 2016 | 28 Dec 2026 |
| 509 | ntsdgdst.com | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 510 | ntssolar.com | GoDaddy.com, LLC | 8 Dec 2015 | 16 Dec 2025 | 8 Dec 2026 |
| 511 | ntshi.com | GoDaddy.com, LLC | 22 Dec 2023 | 22 Dec 2023 | 22 Dec 2024 |
| 512 | nts4crm.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2017 |
| 513 | ntsame.com | Metaregistrar BV Applications | 21 Jun 2018 | 22 Jun 2025 | 21 Jun 2026 |
| 514 | ntsproperties.com | DropCatch.com 483 LLC | 9 Dec 2020 | 7 Sep 2025 | 9 Dec 2026 |
| 515 | ntsr-spb.com | CJSC Registrar R01 | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2015 |
| 516 | ntsyamen.com | Tucows Domains Inc. | 21 Sep 2014 | 25 Sep 2015 | 21 Sep 2016 |
| 517 | ntsxhm.com | Xin Net Technology Corporation | 21 Sep 2014 | 26 Sep 2015 | 21 Sep 2016 |
| 518 | ntsdyc.com | Global Domain Name Trading Center Ltd | 17 Oct 2024 | 19 Dec 2025 | 17 Oct 2026 |
| 519 | ntsecurehost.net | Mesh Digital Limited | 4 Oct 2014 | 30 Sep 2015 | 4 Oct 2017 |
| 520 | ntsrdc.com | Tucows Domains Inc. | 4 Oct 2014 | 15 Dec 2025 | 4 Oct 2025 |
| 521 | ntsla.net | GoDaddy.com, LLC | 22 Sep 2014 | 23 Sep 2024 | 22 Sep 2029 |
| 522 | ntsuccess.com | Bizcn.com, Inc. | 14 Jun 2016 | 4 Jun 2025 | 14 Jun 2030 |
| 523 | nts-vc.com | Internet.bs Corp. | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 524 | ntshavqabzib.com | Tucows Domains Inc. | 5 Oct 2014 | 9 Oct 2017 | 5 Oct 2017 |
| 525 | ntshavmuajroj.com | Tucows Domains Inc. | 5 Oct 2014 | 9 Oct 2017 | 5 Oct 2017 |
| 526 | ntshavsiab.com | Tucows Domains Inc. | 5 Oct 2014 | 9 Oct 2017 | 5 Oct 2017 |
| 527 | ntsthvd.com | Network Solutions, LLC | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 528 | ntsxyy.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Nov 2014 | 9 Jan 2026 | 21 Nov 2026 |
| 529 | ntsudjini.org | Tucows Domains Inc. | 15 Nov 2009 | 19 Nov 2014 | 15 Nov 2015 |
| 530 | ntslabs.net | Gandi SAS | 19 Nov 2014 | 15 Oct 2025 | 19 Nov 2026 |
| 531 | ntskspx.com | GoDaddy.com, LLC | 8 Jul 2021 | 19 Sep 2023 | 8 Jul 2023 |
| 532 | ntsc88.com | - | 24 Apr 2016 | 24 Apr 2016 | 24 Apr 2017 |
| 533 | ntsngh.com | Beijing Lanhai Jiye Technology Co., Ltd | 1 Dec 2024 | 12 Jan 2026 | 1 Dec 2026 |
| 534 | ntsm1ae.net | GMO Internet Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 535 | ntscak.us | Network Solutions, LLC | 6 Oct 2014 | 7 Aug 2017 | 5 Oct 2020 |
| 536 | ntsrxq.com | Network Solutions, LLC | 6 Oct 2014 | 7 Oct 2014 | 6 Oct 2015 |
| 537 | ntswc.com | eName Technology Co., Ltd. | 12 Dec 2015 | 12 Dec 2015 | 12 Dec 2016 |
| 538 | ntscfs.com | GoDaddy.com, LLC | 7 Oct 2014 | 8 Oct 2014 | 7 Oct 2015 |
| 539 | ntsht.com | DreamHost, LLC | 25 Aug 2023 | 25 Jul 2025 | 25 Aug 2026 |
| 540 | ntsrylzg.mobi | GMO Internet Inc. | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 541 | ntsyzc.com | Chengdu West Dimension Digital Technology Co., Ltd… | 19 May 2019 | 19 May 2019 | 19 May 2020 |
| 542 | ntsxzs.com | - | 30 Mar 2025 | 30 Mar 2025 | 30 Mar 2026 |
| 543 | ntsquat.com | Network Solutions, LLC | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 544 | ntshuizi.com | 35 Technology Co., Ltd. | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 545 | ntspecialties.com | GoDaddy.com, LLC | 10 Aug 2010 | 11 Aug 2024 | 10 Aug 2026 |
| 546 | ntschl.com | Xin Net Technology Corporation | 20 Oct 2018 | 20 Oct 2018 | 20 Oct 2019 |
| 547 | ntsdmc.com | DropCatch.com 1508 LLC | 12 Dec 2018 | 12 Dec 2018 | 12 Dec 2019 |
| 548 | ntszzs.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Oct 2024 | 28 Dec 2025 | 12 Oct 2026 |
| 549 | ntshtc.com | DropCatch.com 1503 LLC | 17 Apr 2018 | 17 Apr 2018 | 17 Apr 2019 |
| 550 | ntsllz.com | HiChina Zhicheng Technology Limited | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 551 | ntsmtgw.com | Network Solutions, LLC | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 552 | ntsrtiz.com | Network Solutions, LLC | 28 Sep 2014 | 29 Sep 2014 | 28 Sep 2015 |
| 553 | ntsscdz.com | register.com, Inc. | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 554 | ntsldq.com | KQW, Inc. | 2 Mar 2020 | 3 Mar 2020 | 2 Mar 2021 |
| 555 | ntsrb.com | TurnCommerce, Inc. DBA NameBright.com | 2 Mar 2020 | 3 Apr 2024 | 2 Mar 2024 |
| 556 | ntstamp.com | Realtime Register B.V. | 4 Nov 2022 | 18 Dec 2023 | 4 Nov 2023 |
| 557 | ntstar.us | Advanced Internet Technologies, Inc. (AIT) | 29 Sep 2014 | 30 Aug 2017 | 28 Sep 2018 |
| 558 | ntsleds.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 559 | ntsian.com | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 560 | ntshunma.com | - | 27 Nov 2021 | 29 Dec 2023 | 27 Nov 2023 |
| 561 | ntswebsites.com | Network Solutions, LLC | 23 Aug 2024 | 8 Aug 2025 | 23 Aug 2026 |
| 562 | ntstowing.com | NameCheap, Inc. | 16 Oct 2014 | 13 Oct 2025 | 16 Oct 2026 |
| 563 | ntsqfj.com | HiChina Zhicheng Technology Limited | 16 Oct 2014 | 1 Oct 2024 | 16 Oct 2026 |
| 564 | ntsconsulting.info | 1&1 Internet AG | 8 Jul 2025 | 13 Jul 2025 | 8 Jul 2026 |
| 565 | ntsconsulting.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 566 | ntshitao.com | GoDaddy.com, LLC | 2 Feb 2021 | 14 Mar 2024 | 2 Feb 2024 |
| 567 | ntsijiazhentan8.com | Metaregistrar BV Applications | 19 Dec 2025 | 20 Dec 2025 | 19 Dec 2026 |
| 568 | ntspqu.com | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 569 | ntsafe.net | HiChina Zhicheng Technology Limited | 20 Apr 2020 | 1 Apr 2025 | 20 Apr 2030 |
| 570 | ntshhg.net | Beijing Lanhai Jiye Technology Co., Ltd | 15 Apr 2022 | 17 Jun 2025 | 15 Apr 2025 |
| 571 | ntstudy.com | TurnCommerce, Inc. DBA NameBright.com | 26 Jan 2021 | 7 Mar 2025 | 26 Jan 2025 |
| 572 | ntstexas.com | 1&1 Internet AG | 22 Sep 2007 | 1 Feb 2017 | 22 Sep 2026 |
| 573 | ntshuangyang.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 3 Dec 2024 | 4 Dec 2025 | 3 Dec 2025 |
| 574 | ntsayadori.com | GMO Internet Inc. | 27 Sep 2014 | 29 Jul 2016 | 27 Sep 2017 |
| 575 | ntshusafaris.com | Tucows Domains Inc. | 21 Nov 2013 | 25 Nov 2014 | 21 Nov 2015 |
| 576 | ntsvr4.com | Key-Systems GmbH | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 577 | ntsysy.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Aug 2022 | 14 Oct 2024 | 12 Aug 2024 |
| 578 | ntstorytime.com | Launchpad, Inc. | 17 Oct 2014 | 18 Oct 2014 | 17 Oct 2015 |
| 579 | nts769t04i.biz | GMO Internet Inc. | 14 Oct 2014 | - | 13 Oct 2015 |
| 580 | ntsanya.com | Dynadot16 LLC | 25 May 2022 | 5 Jul 2023 | 25 May 2023 |
| 581 | ntsdryerventcleaning.com | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2016 |
| 582 | ntshowfantasia.com | Network Solutions, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 583 | ntsoftdist.com | Metaregistrar BV Applications | 16 Nov 2025 | 15 Jan 2026 | 16 Nov 2026 |
| 584 | ntsvqjjlx.us | - | 14 Oct 2014 | - | 13 Oct 2015 |
| 585 | ntsycy.com | - | 26 Dec 2024 | 27 Dec 2025 | 26 Dec 2026 |
| 586 | ntsib.com | Regional Network Information Center, JSC dba RU-CE… | 8 Oct 2025 | 8 Oct 2025 | 7 Oct 2026 |
| 587 | ntsact2015.com | GoDaddy.com, LLC | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 588 | ntsyw.net | eName Technology Co., Ltd. | 15 Feb 2016 | 15 Feb 2016 | 15 Feb 2017 |
| 589 | ntsbyjennifer.net | NameCheap, Inc. | 25 Nov 2014 | 11 Jan 2018 | 25 Nov 2018 |
| 590 | ntscuhu.com | register.com, Inc. | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 591 | ntshjz.com | Free Spirit Domains, LLC | 4 Jun 2019 | 5 Jun 2019 | 4 Jun 2020 |
| 592 | ntsiokc.com | Network Solutions, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 593 | ntsjqdd.com | register.com, Inc. | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 594 | ntskwdd.com | register.com, Inc. | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 595 | ntshotel.com | Hosting Concepts B.V. dba Openprovider | 14 Feb 2021 | 14 Feb 2021 | 14 Feb 2022 |
| 596 | ntscjm.com | Bizcn.com, Inc. | 11 Jul 2021 | 10 Jul 2021 | 11 Jul 2022 |
| 597 | ntsbyjennifer.com | NameCheap, Inc. | 25 Nov 2014 | 10 Jan 2018 | 25 Nov 2018 |
| 598 | nts4california.com | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2016 |
| 599 | ntscp.net | Xin Net Technology Corporation | 12 May 2017 | 12 May 2017 | 12 May 2018 |
| 600 | ntspcl.com | Sksa Technology Co., Ltd | 23 Apr 2025 | 7 May 2025 | 23 Apr 2026 |
| 601 | ntslysj.com | Dynadot3 LLC | 16 Jun 2022 | 26 Aug 2023 | 16 Jun 2023 |
| 602 | ntshsw.com | Eranet International Limited | 1 Oct 2025 | 1 Oct 2025 | 1 Oct 2026 |
| 603 | ntsom.org | GoDaddy.com, LLC | 6 Jun 2017 | 6 Jun 2017 | 6 Jun 2018 |
| 604 | ntssogutma.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 605 | ntshuo.com | eName Technology Co., Ltd. | 15 May 2025 | 8 Nov 2025 | 15 May 2026 |
| 606 | ntscangrp.com | Marcaria.com International, Inc. | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 607 | ntscangr.com | Marcaria.com International, Inc. | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 608 | ntscangp.com | Marcaria.com International, Inc. | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 609 | ntsmediaonline.info | 1&1 Internet AG | 29 Nov 2014 | - | 29 Nov 2015 |
| 610 | ntscchem.com | Beijing Lanhai Jiye Technology Co., Ltd | 1 Dec 2014 | 4 Feb 2026 | 1 Dec 2026 |
| 611 | ntsvac.net | Eranet International Limited | 30 May 2025 | 26 Jul 2025 | 30 May 2026 |
| 612 | ntshcb.com | DNSPod, Inc. | 22 Jan 2026 | 22 Jan 2026 | 22 Jan 2031 |
| 613 | ntscgroup.com | DropCatch.com 1027 LLC | 4 Jul 2023 | 5 Jul 2023 | 4 Jul 2026 |
| 614 | nts-marine.com | 1&1 Internet AG | 18 Dec 2023 | 19 Dec 2025 | 18 Dec 2026 |
| 615 | nts-fe.com | Dynamic Network Services, Inc. | 1 Dec 2014 | 25 Oct 2017 | 1 Dec 2019 |
| 616 | ntsmediaonline.org | GMO Internet Inc. | 30 Nov 2014 | - | 30 Nov 2015 |
| 617 | ntspln.com | Hefei Juming Network Technology Co., Ltd | 2 Dec 2014 | 8 Jan 2026 | 2 Dec 2026 |
| 618 | ntsolve.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Nov 2013 | 27 Nov 2021 | 28 Nov 2026 |
| 619 | ntsnd.com | Domain.com, LLC | 29 Oct 2017 | 29 Oct 2017 | 29 Oct 2018 |
| 620 | ntshuqin.com | Xin Net Technology Corporation | 4 Jul 2019 | 5 Jul 2019 | 4 Jul 2020 |
| 621 | ntsdairy.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 622 | ntscommodities.com | Tucows Domains Inc. | 3 Dec 2014 | 7 Dec 2016 | 3 Dec 2016 |
| 623 | nts2.com | eNom, Inc. | 3 Dec 2014 | 4 Nov 2025 | 3 Dec 2026 |
| 624 | ntsmediaonline.net | GMO Internet Inc. | 11 Feb 2016 | 11 Feb 2016 | 11 Feb 2017 |
| 625 | ntscgroup.org | eNom, Inc. | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 626 | ntscgroup.net | Porkbun, LLC | 17 Apr 2020 | 28 Jun 2023 | 17 Apr 2023 |
| 627 | ntscctv.com | Dynadot6 LLC | 24 Jul 2022 | 3 Oct 2023 | 24 Jul 2023 |
| 628 | nts-fiesa.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 629 | ntsystemwork.com | Wild West Domains, LLC | 4 Dec 2014 | 5 Dec 2025 | 4 Dec 2026 |
| 630 | ntspray.com | TurnCommerce, Inc. DBA NameBright.com | 9 Jan 2018 | 3 Jan 2021 | 9 Jan 2026 |
| 631 | ntseg.com | TurnCommerce, Inc. DBA NameBright.com | 4 Dec 2014 | 13 Jan 2025 | 4 Dec 2024 |
| 632 | ntshnsh.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Feb 2019 | 25 Dec 2025 | 20 Feb 2026 |
| 633 | ntsbxv.com | Chengdu West Dimension Digital Technology Co., Ltd… | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 634 | ntsantas.com | Web Commerce Communications Limited dba WebNic.cc | 5 May 2023 | 15 Jul 2024 | 5 May 2024 |
| 635 | ntskala.com | 1&1 Internet AG | 3 Jan 2025 | 3 Jan 2025 | 3 Jan 2026 |
| 636 | ntsjjhg.com | Chengdu West Dimension Digital Technology Co., Ltd… | 3 Jul 2018 | 3 Jul 2018 | 3 Jul 2019 |
| 637 | ntsslidecar.com | GoDaddy.com, LLC | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 638 | ntsamexico.com | Tucows Domains Inc. | 4 Dec 2008 | 8 Dec 2014 | 4 Dec 2015 |
| 639 | ntsinc1.com | GoDaddy.com, LLC | 8 Dec 2014 | 1 Dec 2025 | 8 Dec 2026 |
| 640 | nts101.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 641 | ntsevidyabharati.org | GoDaddy.com, LLC | 7 Dec 2014 | 18 Dec 2016 | 7 Dec 2017 |
| 642 | ntszhotel.com | HiChina Zhicheng Technology Limited | 9 Dec 2014 | 9 Dec 2016 | 9 Dec 2017 |
| 643 | ntshchina.com | HiChina Zhicheng Technology Limited | 10 Dec 2014 | 9 Dec 2016 | 10 Dec 2017 |
| 644 | ntsppec.org | Name.com, Inc. | 9 Dec 2014 | 22 Nov 2025 | 9 Dec 2026 |
| 645 | ntspor.com | TurnCommerce, Inc. DBA NameBright.com | 20 Nov 2017 | 30 Dec 2024 | 20 Nov 2024 |
| 646 | ntsconference.com | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2025 | 10 Dec 2026 |
| 647 | ntsc-vn.com | P.A. Viet Nam Company Limited | 4 May 2020 | 27 Mar 2025 | 4 May 2026 |
| 648 | ntsphere.com | Whois Networks Co., Ltd. | 4 Dec 2019 | 4 Dec 2025 | 4 Dec 2026 |
| 649 | ntsakombhokota.com | Tucows Domains Inc. | 9 Dec 2013 | 13 Dec 2014 | 9 Dec 2015 |
| 650 | ntsphere.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 9 Dec 2009 | 27 Jul 2017 | 9 Dec 2017 |
| 651 | ntsldfj.com | Xin Net Technology Corporation | 10 Dec 2013 | 14 Dec 2014 | 10 Dec 2015 |
| 652 | ntsbusiness.com | GoDaddy.com, LLC | 14 Dec 2014 | 15 Dec 2025 | 14 Dec 2026 |
| 653 | ntsbb.com | HiChina Zhicheng Technology Limited | 16 Jun 2020 | 16 Jun 2020 | 16 Jun 2021 |
| 654 | nts522wzn.com | GMO Internet Inc. | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 655 | ntscamp.org | Tucows Domains Inc. | 13 Dec 2014 | 3 Dec 2025 | 13 Dec 2026 |
| 656 | ntsxcy.com | NamePal.com #8023 | 7 Jun 2019 | 8 Jun 2019 | 7 Jun 2020 |
| 657 | ntshyjx.com | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 658 | ntsrqiwuqmwblg.info | Reserved for non-billable transactions where Regis… | 15 Dec 2014 | 15 Dec 2020 | 15 Dec 2021 |
| 659 | ntsxxekny.com | GMO Internet Inc. | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 660 | ntsiparis.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 661 | ntseclasses.com | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 662 | ntsngd.com | Beijing Lanhai Jiye Technology Co., Ltd | 24 May 2020 | 25 Jun 2024 | 24 May 2024 |
| 663 | ntsands.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 664 | ntsdatagovernance.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2019 |
| 665 | ntsoft.org | Namesilo, LLC | 12 Dec 2024 | 12 Dec 2025 | 12 Dec 2026 |
| 666 | ntsika.info | GoDaddy.com, LLC | 13 Mar 2016 | 13 Mar 2016 | 13 Mar 2017 |
| 667 | ntsimiao.com | CyanDomains, Inc. | 26 May 2022 | 3 Jul 2023 | 26 May 2023 |
| 668 | ntszjsgc.com | Xin Net Technology Corporation | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 669 | ntspirits.com | Name.com, Inc. | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 670 | ntsbusinesspoint.com | HiChina Zhicheng Technology Limited | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2019 |
| 671 | nts899.com | GoDaddy.com, LLC | 21 Dec 2014 | 22 Dec 2014 | 21 Dec 2015 |
| 672 | ntsginnovation.net | Domainshype.com, Inc. | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 673 | ntsonev.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 674 | ntshyp.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Apr 2022 | 7 May 2024 | 5 Apr 2024 |
| 675 | ntsr.net | GoDaddy.com, LLC | 23 Dec 2014 | 29 Dec 2025 | 23 Dec 2026 |
| 676 | ntssoftwaredesign.com | DropCatch.com 1508 LLC | 11 May 2022 | 21 Jun 2023 | 11 May 2023 |
| 677 | ntsman.com | Nameling.com LLC | 24 Dec 2014 | 25 Dec 2016 | 24 Dec 2017 |
| 678 | ntsls.com | Network Solutions, LLC | 24 Dec 2014 | 26 Dec 2025 | 24 Dec 2026 |
| 679 | ntssoftwares.com | GoDaddy.com, LLC | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2016 |
| 680 | ntsmagazine.com | 1API GmbH | 21 Mar 2016 | 21 Mar 2016 | 21 Mar 2017 |
| 681 | ntsjyl.com | Domainplace LLC | 23 Mar 2022 | 26 Mar 2023 | 23 Mar 2024 |
| 682 | ntshenghe.com | - | 25 Sep 2025 | 27 Sep 2025 | 25 Sep 2026 |
| 683 | ntsoftdemo.net | P.A. Viet Nam Company Limited | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 684 | ntstst.com | MAFF Avenue, Inc | 3 Mar 2022 | 12 May 2023 | 3 Mar 2023 |
| 685 | ntsvietnam.org | P.A. Viet Nam Company Limited | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 686 | ntsnoticias.com | Wix.com Ltd. | 27 Dec 2014 | 10 Dec 2025 | 27 Dec 2026 |
| 687 | ntsmzh.com | HiChina Zhicheng Technology Limited | 27 Oct 2018 | 27 Oct 2018 | 27 Oct 2019 |
| 688 | ntsqo.org | Launchpad, Inc. | 26 Dec 2014 | 20 Dec 2016 | 26 Dec 2017 |
| 689 | ntsltd.com | TurnCommerce, Inc. DBA NameBright.com | 28 Dec 2014 | 22 Dec 2020 | 28 Dec 2025 |
| 690 | ntsilk.com | Hosting Concepts B.V. dba Openprovider | 5 Sep 2020 | 5 Sep 2020 | 5 Sep 2021 |
| 691 | ntshk.com | TurnCommerce, Inc. DBA NameBright.com | 3 Sep 2018 | 13 Nov 2024 | 3 Sep 2024 |
| 692 | ntshengjiu.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Oct 2023 | 29 Dec 2025 | 19 Oct 2026 |
| 693 | ntseverma.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 694 | nts-i.com | Tucows Domains Inc. | 28 Dec 2014 | 29 Nov 2016 | 28 Dec 2017 |
| 695 | ntsxedu.com | - | 8 Mar 2025 | 11 Mar 2025 | 8 Mar 2026 |
| 696 | ntsmaroc.com | OVH sas | 29 Dec 2014 | 15 Nov 2023 | 29 Dec 2026 |
| 697 | ntswxw.com | eName Technology Co., Ltd. | 8 Jun 2025 | 8 Jun 2025 | 8 Jun 2026 |
| 698 | ntsstudio.com | 1API GmbH | 22 Mar 2021 | 5 May 2023 | 22 Mar 2023 |
| 699 | ntshendu.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 28 Dec 2012 | 31 Dec 2014 | 28 Dec 2015 |
| 700 | ntshawls.com | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2016 |
| 701 | ntsl.us | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 8 Jul 2023 | 9 Jul 2024 | 8 Jul 2024 |
| 702 | ntsdcve.us | - | 31 Dec 2014 | - | 30 Dec 2015 |
| 703 | nts-ural.com | Network Solutions, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2017 |
| 704 | ntscgs.com | Meganames LLC | 11 Mar 2017 | 9 Nov 2017 | 11 Mar 2018 |
| 705 | ntswapda.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 706 | ntsd.xyz | GMO Internet Inc. | 3 Dec 2025 | 8 Dec 2025 | 3 Dec 2026 |
| 707 | ntsdevelopment.xyz | Network Solutions, LLC | 22 Jul 2014 | 22 Jul 2014 | 22 Jul 2015 |
| 708 | ntsolution.tokyo | GMO Internet Inc. | 22 Jul 2014 | 22 Jul 2014 | 22 Jul 2015 |
| 709 | ntsuk.services | Mesh Digital Limited | 27 Jul 2014 | 6 Jan 2017 | 27 Jul 2017 |
| 710 | ntsg.xyz | GMO Internet Inc. | 3 Dec 2025 | 8 Dec 2025 | 3 Dec 2026 |
| 711 | nts-edu.xyz | Network Solutions, LLC | 26 Jul 2014 | 26 Jul 2014 | 26 Jul 2015 |
| 712 | ntsl.xyz | - | 15 Sep 2025 | 3 Oct 2025 | 15 Sep 2026 |
| 713 | ntsjk.xyz | Xin Net Technology Corporation | 4 Sep 2014 | - | 4 Sep 2015 |
| 714 | ntsp.xyz | GMO Internet Inc. | 3 Dec 2025 | 8 Dec 2025 | 3 Dec 2026 |
| 715 | ntssbj.com | HiChina Zhicheng Technology Limited | 17 May 2018 | 25 May 2018 | 17 May 2019 |
| 716 | ntsnamibia.com | Paragon Internet Group Ltd t/a Paragon Names | 11 Aug 2015 | 15 Sep 2015 | 11 Aug 2017 |
| 717 | ntshealthcare.com | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2025 | 11 Aug 2028 |
| 718 | ntsbwsc.com | - | - | - | - |
| 719 | ntsbmhw.com | - | - | - | - |
| 720 | nts-export.com | Hetzner Online AG | 9 Feb 2023 | 25 Nov 2025 | 9 Feb 2026 |
| 721 | ntshhh.xyz | Todaynic.com Inc. | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 722 | ntsbwlw.xn--ses554g | Internet Domain Name System Beijing Engineering Re… | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 723 | ntsb.xyz | GMO Internet Inc. | 3 Dec 2025 | 8 Dec 2025 | 3 Dec 2026 |
| 724 | ntsofmoneyint.xyz | GMO Internet Inc. | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 725 | nts2.vacations | eNom, Inc. | 3 Dec 2014 | 9 Nov 2025 | - |
| 726 | ntsradio.net | Amazon Registrar, Inc. | 12 Aug 2015 | 8 Jul 2025 | 12 Aug 2026 |
| 727 | ntsradio.global | Mesh Digital Limited | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 728 | ntsradio.club | Gandi SAS | 12 Aug 2015 | 21 Oct 2025 | 11 Aug 2026 |
| 729 | ntshengjie.com | - | 25 Apr 2023 | 26 Apr 2024 | 25 Apr 2025 |
| 730 | ntshcwqxl.us | - | 12 Aug 2015 | - | 11 Aug 2016 |
| 731 | ntshamei.com | DropCatch.com 494 LLC | 9 Jan 2018 | 9 Jan 2018 | 9 Jan 2019 |
| 732 | ntsmapper.xyz | Super Registry Inc. | 28 Feb 2015 | 12 Jul 2015 | 28 Feb 2017 |
| 733 | ntsourcing.net | Tucows Domains Inc. | 13 Aug 2015 | 15 Jul 2025 | 13 Aug 2026 |
| 734 | nts2.website | NameCheap, Inc. | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 735 | ntsje.science | Alpnames Limited | 19 Apr 2015 | - | 18 Apr 2016 |
| 736 | ntsln.science | Alpnames Limited | 22 Apr 2015 | 22 Apr 2015 | 21 Apr 2016 |
| 737 | ntsmxc.science | Alpnames Limited | 23 Apr 2015 | - | 22 Apr 2016 |
| 738 | ntsn.science | Alpnames Limited | 28 Apr 2015 | 29 Apr 2015 | 27 Apr 2016 |
| 739 | ntsfa.science | Alpnames Limited | 27 Apr 2015 | - | 26 Apr 2016 |
| 740 | ntsqjj.science | Alpnames Limited | 29 Apr 2015 | - | 28 Apr 2016 |
| 741 | ntsgdh.science | Alpnames Limited | 5 May 2015 | - | 4 May 2016 |
| 742 | nts46y.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 May 2015 | - | 5 May 2016 |
| 743 | ntsystems.info | Dynadot, LLC | 9 Jul 2019 | 7 Sep 2019 | 9 Jul 2020 |
| 744 | ntstatic.com | Eranet International Limited | 10 May 2022 | 16 Jun 2023 | 10 May 2023 |
| 745 | ntsogou.com | HiChina Zhicheng Technology Limited | 4 Jun 2021 | 5 Jun 2025 | 4 Jun 2026 |
| 746 | ntshjy.com | HiChina Zhicheng Technology Limited | 5 Jun 2020 | 7 Jun 2020 | 5 Jun 2021 |
| 747 | ntshaykolo.com | Tucows Domains Inc. | 6 Jan 2015 | 10 Jan 2016 | 6 Jan 2017 |
| 748 | ntselectrical.com | TurnCommerce, Inc. DBA NameBright.com | 26 Mar 2017 | 27 Apr 2024 | 26 Mar 2024 |
| 749 | ntszlyy.net | Chengdu Fly-Digital Technology Co., Ltd | 5 Jan 2015 | 6 Jan 2026 | 5 Jan 2027 |
| 750 | ntsis.us | - | 6 Jan 2015 | - | 5 Jan 2016 |
| 751 | ntsaina.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Jun 2024 | 21 Dec 2025 | 4 Jun 2026 |
| 752 | ntsjdc.com | Xin Net Technology Corporation | 8 Jan 2015 | 14 Jan 2016 | 8 Jan 2017 |
| 753 | ntsinternational.com | Tucows Domains Inc. | 8 Jan 2015 | 1 Jan 2026 | 8 Jan 2027 |
| 754 | ntsyernen.com | Tucows Domains Inc. | 11 Aug 2014 | 15 Aug 2015 | 11 Aug 2016 |
| 755 | ntshur.com | Bizcn.com, Inc. | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 756 | ntshcm.com | Network Solutions, LLC | 17 Aug 2016 | 18 Jun 2025 | 17 Aug 2028 |
| 757 | ntsfdj.com | Bizcn.com, Inc. | 7 May 2017 | 7 May 2017 | 7 May 2018 |
| 758 | ntsyw.com | Realtime Register B.V. | 2 Nov 2024 | 17 Dec 2025 | 2 Nov 2025 |
| 759 | ntsguide.com | TurnCommerce, Inc. DBA NameBright.com | 11 Apr 2019 | 23 Jun 2024 | 11 Apr 2024 |
| 760 | ntsenfen.com | Xin Net Technology Corporation | 11 Jan 2015 | 12 May 2025 | 11 Jan 2030 |
| 761 | ntsdtyn.com | Key-Systems GmbH | 17 Dec 2024 | 18 Dec 2025 | 17 Dec 2026 |
| 762 | ntsbook.com | GoDaddy.com, LLC | 2 Oct 2025 | 3 Oct 2025 | 2 Oct 2028 |
| 763 | ntsoapworks.com | Domain.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 764 | ntspectacle.com | Online SAS | 13 Jan 2005 | 7 Jan 2026 | 13 Jan 2027 |
| 765 | ntsarn3.com | GoDaddy.com, LLC | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 766 | ntswjx.com | DropCatch.com 861 LLC | 7 Oct 2020 | 7 Oct 2020 | 7 Oct 2021 |
| 767 | ntsretreads.org | eNom, Inc. | 14 Jan 2015 | 11 Mar 2017 | 14 Jan 2018 |
| 768 | ntsretreads.net | eNom, Inc. | 14 Jan 2015 | 16 Dec 2016 | 14 Jan 2018 |
| 769 | ntsou.info | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 770 | ntstestmcqs.com | eNom, Inc. | 16 Jan 2015 | 2 Jan 2017 | 16 Jan 2018 |
| 771 | ntspa7t2h0.biz | GMO Internet Inc. | 16 Jan 2015 | - | 15 Jan 2016 |
| 772 | ntsmcqs.com | NameCheap, Inc. | 16 Jan 2015 | 3 Jan 2025 | 16 Jan 2026 |
| 773 | ntshconsulting.com | GoDaddy.com, LLC | 17 Jan 2015 | 19 Jan 2026 | 17 Jan 2027 |
| 774 | ntsgysxx.com | DropCatch.com 1537 LLC | 26 Aug 2025 | 26 Aug 2025 | 26 Aug 2026 |
| 775 | ntsaw.com | - | 1 Nov 2025 | 6 Nov 2025 | 1 Nov 2026 |
| 776 | ntsyc.uno | 1API GmbH | 15 Aug 2015 | 15 Aug 2015 | 14 Aug 2016 |
| 777 | ntsc.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 13 May 2015 | 19 May 2017 | 13 May 2018 |
| 778 | ntsqmn.party | Alpnames Limited | 15 May 2015 | 15 May 2015 | 14 May 2016 |
| 779 | ntsm.wang | eName Technology Co., Ltd. | 21 May 2015 | 9 Nov 2016 | 21 May 2018 |
| 780 | ntsb.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 25 May 2015 | 2 Jul 2017 | 25 May 2017 |
| 781 | ntsdqp3pg.party | Alpnames Limited | 23 May 2015 | 23 May 2015 | 22 May 2016 |
| 782 | ntsh.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 5 Dec 2016 | 5 Dec 2016 | 4 Dec 2017 |
| 783 | ntscqjkyij.click | GMO Internet Inc. | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 784 | ntsbmjgk.click | GMO Internet Inc. | 9 Jun 2015 | - | 9 Jun 2016 |
| 785 | ntsp.work | Minds + Machines Registrar Limited | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 786 | ntssjd.link | NameCheap, Inc. | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 787 | ntsce.work | Minds + Machines Registrar Limited | 21 Jun 2015 | 21 Jun 2015 | 21 Jun 2016 |
| 788 | ntsz.party | Alpnames Limited | 25 Jun 2015 | 25 Jun 2015 | 24 Jun 2016 |
| 789 | ntsj.wang | eName Technology Co., Ltd. | 30 Jun 2015 | 25 Apr 2017 | 30 Jun 2018 |
| 790 | ntsh.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Jun 2015 | 15 Nov 2016 | 30 Jun 2018 |
| 791 | ntsmz.work | Minds + Machines Registrar Limited | 11 Jun 2015 | 11 Jun 2015 | 11 Jun 2016 |
| 792 | ntswy3c39927.top | GMO Internet Inc. | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2016 |
| 793 | ntshengsheng.com | HiChina Zhicheng Technology Limited | 28 Sep 2017 | 12 Sep 2023 | 28 Sep 2028 |
| 794 | ntsc-pal.com | PSI-USA, Inc. dba Domain Robot | 15 Aug 2015 | 4 Oct 2025 | 29 Jul 2026 |
| 795 | ntst.click | Uniregistrar Corp | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 796 | ntsb.news | Name.com, Inc. | 15 Jul 2015 | 16 Jul 2015 | 15 Jul 2016 |
| 797 | ntsq.date | Alpnames Limited | 24 Jul 2015 | - | 23 Jul 2016 |
| 798 | ntswv.click | Uniregistrar Corp | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 799 | ntsn.click | Uniregistrar Corp | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 800 | ntshw.click | Uniregistrar Corp | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 801 | ntsfa.click | Uniregistrar Corp | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 802 | ntsdx.click | Uniregistrar Corp | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 803 | ntsfaq.date | Alpnames Limited | 3 Aug 2015 | - | 2 Aug 2016 |
| 804 | ntscg.date | Alpnames Limited | 8 Aug 2015 | - | 7 Aug 2016 |
| 805 | ntsbvo.cricket | Alpnames Limited | 8 Aug 2015 | - | 7 Aug 2016 |
| 806 | ntsynjf.com | DOMAIN NAME NETWORK PTY LTD | 6 Jan 2026 | 6 Jan 2026 | 6 Jan 2027 |
| 807 | ntswzwy.com | Xin Net Technology Corporation | 1 Apr 2018 | 1 Apr 2018 | 1 Apr 2019 |
| 808 | ntswtl.com | Tucows Domains Inc. | 15 Jan 2014 | 19 Jan 2016 | 15 Jan 2017 |
| 809 | ntshuhua.com | Xiamen Nawang Technology Co., Ltd | 4 Apr 2025 | 18 Jul 2025 | 4 Apr 2026 |
| 810 | ntseventstravel.com | Network Solutions, LLC | 19 Jan 2015 | 5 Mar 2017 | 19 Jan 2018 |
| 811 | nts0513-news.com | Xin Net Technology Corporation | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 812 | ntshentan.com | GoDaddy.com, LLC | 20 Jan 2015 | 21 Jan 2015 | 20 Jan 2016 |
| 813 | ntsdistributors.com | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 814 | ntswdz.com | Xin Net Technology Corporation | 10 Oct 2023 | 10 Oct 2023 | 10 Oct 2028 |
| 815 | ntsj-f.com | HiChina Zhicheng Technology Limited | 17 Aug 2015 | 17 Aug 2016 | 17 Aug 2017 |
| 816 | ntsdkb.com | Xiamen ChinaSource Internet Service Co., Ltd. | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 817 | ntsqdzmail.com | HiChina Zhicheng Technology Limited | 22 Jan 2015 | 6 Feb 2021 | 22 Jan 2030 |
| 818 | ntshl.com | GoDaddy.com, LLC | 13 Feb 2025 | 13 Feb 2025 | 13 Feb 2026 |
| 819 | ntscsupply.com | GoDaddy.com, LLC | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2017 |
| 820 | ntscorphousing.com | Network Solutions, LLC | 21 Jan 2015 | 23 Jan 2025 | 21 Jan 2027 |
| 821 | ntsclan.com | Jiangsu Bangning Science and technology Co. Ltd. | 13 Jun 2022 | 17 Aug 2024 | 13 Jun 2024 |
| 822 | ntsanheng.com | eName Technology Co., Ltd. | 6 Aug 2025 | 30 Aug 2025 | 6 Aug 2026 |
| 823 | ntscambodia.com | Tucows Domains Inc. | 19 Jan 2014 | 23 Jan 2015 | 19 Jan 2016 |
| 824 | ntsbfz.com | - | 31 Mar 2024 | 9 Jun 2025 | 31 Mar 2025 |
| 825 | ntsrecv.us | - | 21 Jan 2015 | - | 20 Jan 2016 |
| 826 | ntssgy.com | DropCatch.com 1118 LLC | 21 Feb 2022 | 22 Feb 2023 | 21 Feb 2023 |
| 827 | ntsbpo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 828 | ntsweety.com | GoDaddy.com, LLC | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 829 | ntsthg.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Aug 2024 | 8 Jan 2026 | 16 Aug 2026 |
| 830 | ntsdt.net | TurnCommerce, Inc. DBA NameBright.com | 26 Jan 2015 | 26 Jan 2015 | 26 Jan 2016 |
| 831 | ntsongcheng.com | 1API GmbH | 25 Dec 2020 | 25 Dec 2020 | 25 Dec 2021 |
| 832 | ntsdtoolszone.com | GoDaddy.com, LLC | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2016 |
| 833 | ntsstn5130.com | Wild West Domains, LLC | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 834 | ntsqfz.com | HiChina Zhicheng Technology Limited | 19 Aug 2015 | 4 Aug 2016 | 19 Aug 2017 |
| 835 | ntsnxy.date | Alpnames Limited | 18 Aug 2015 | - | 17 Aug 2016 |
| 836 | nts3653h.com | GoDaddy.com, LLC | 30 Nov 2019 | 30 Nov 2019 | 30 Nov 2020 |
| 837 | ntsljc.com | - | 30 Jan 2026 | 31 Jan 2026 | 30 Jan 2027 |
| 838 | ntsxd.com | HiChina Zhicheng Technology Limited | 26 Apr 2017 | 3 Jun 2024 | 26 Apr 2024 |
| 839 | ntsdfzp.com | - | 22 Jul 2022 | 23 Sep 2023 | 22 Jul 2023 |
| 840 | ntshunwei.com | Namesilo, LLC | 9 Nov 2021 | 12 Nov 2021 | 9 Nov 2022 |
| 841 | ntsconsultingltd.com | Google, Inc. | 21 Sep 2023 | 6 Sep 2025 | 21 Sep 2026 |
| 842 | ntscar.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 26 Jan 2005 | 9 Jun 2017 | 26 Jan 2018 |
| 843 | ntsa.science | Alpnames Limited | 6 May 2015 | - | 5 May 2016 |
| 844 | ntsuxb.science | Alpnames Limited | 7 May 2015 | 7 May 2015 | 6 May 2016 |
| 845 | ntsdbq.party | Alpnames Limited | 7 May 2015 | - | 6 May 2016 |
| 846 | ntsyso.science | Alpnames Limited | 11 May 2015 | - | 10 May 2016 |
| 847 | ntswzl.party | Alpnames Limited | 11 May 2015 | - | 10 May 2016 |
| 848 | ntscout.com | Wix.com Ltd. | 13 Aug 2025 | 14 Aug 2025 | 13 Aug 2026 |
| 849 | ntsqp8sf6a.net | GMO Internet Inc. | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 850 | ntsafe.org | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 851 | nts-europe.net | OVH sas | 29 Jan 2010 | 26 Jan 2017 | 29 Jan 2018 |
| 852 | ntskinbeautyclinic.com | Tucows Domains Inc. | 29 Jan 2014 | 2 Feb 2015 | 29 Jan 2016 |
| 853 | ntsharpe.com | WillametteNames.com LLC | 17 Dec 2020 | 18 Dec 2020 | 17 Dec 2021 |
| 854 | ntsarcherycoach.com | GoDaddy.com, LLC | 1 Feb 2015 | 1 Feb 2015 | 1 Feb 2017 |
| 855 | nts17.com | West263 International Limited | 28 Jun 2022 | 5 Sep 2023 | 28 Jun 2023 |
| 856 | ntspkf.date | Alpnames Limited | 19 Aug 2015 | - | 18 Aug 2016 |
| 857 | ntswadena.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 858 | ntshenghuo.com | Domainplace LLC | 27 Mar 2023 | 10 Jun 2024 | 27 Mar 2024 |
| 859 | ntscarrentservice.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 860 | nts-lubricant.com | GMO Internet Inc. | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 861 | ntsunyu.net | China Springboard, Inc. | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 862 | ntsyper.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Feb 2015 | 25 Dec 2025 | 4 Feb 2027 |
| 863 | ntsfs.com | Amazon Registrar, Inc. | 23 May 2025 | 23 May 2025 | 23 May 2026 |
| 864 | ntsapa.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Mar 2024 | 22 May 2025 | 20 Mar 2025 |
| 865 | ntsafetty.com | GoDaddy.com, LLC | 9 May 2017 | 9 May 2017 | 9 May 2018 |
| 866 | ntscolombia.com | GoDaddy.com, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 867 | ntsbahrain.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 May 2024 | 27 Jun 2025 | 16 May 2025 |
| 868 | ntsuda.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Dec 2024 | 22 Dec 2025 | 12 Dec 2026 |
| 869 | ntstrasporti.com | Tucows Domains Inc. | 4 Feb 2013 | 8 Feb 2015 | 4 Feb 2016 |
| 870 | ntsexport.com | TurnCommerce, Inc. DBA NameBright.com | 7 Feb 2015 | 21 Apr 2025 | 7 Feb 2025 |
| 871 | nts-nicetosee.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 7 Feb 2015 | 5 Feb 2018 | 7 Feb 2018 |
| 872 | ntserv07.com | GoDaddy.com, LLC | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 873 | ntsycw.com | Xiamen ChinaSource Internet Service Co., Ltd. | 21 Aug 2015 | 11 Jul 2023 | 21 Aug 2026 |
| 874 | ntsjcsyp.com | eNom652, Inc. | 17 Jan 2018 | 17 Jan 2018 | 17 Jan 2019 |
| 875 | ntscience.com | Hongkong Domain Name Information Management Co., L… | 25 Oct 2022 | 3 Dec 2023 | 25 Oct 2023 |
| 876 | ntsxh.com | Jiangsu Bangning Science and technology Co. Ltd. | 10 Feb 2015 | 2 Feb 2016 | 10 Feb 2018 |
| 877 | ntsuclothes.com | Tucows Domains Inc. | 30 Apr 2020 | 4 May 2021 | 30 Apr 2021 |
| 878 | ntsbproducts.com | Tucows Domains Inc. | 6 Feb 2005 | 10 Feb 2015 | 6 Feb 2016 |
| 879 | ntsjw.com | eName Technology Co., Ltd. | 13 Feb 2025 | 18 Aug 2025 | 13 Feb 2026 |
| 880 | ntshunye.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 7 Feb 2012 | 10 Feb 2015 | 7 Feb 2016 |
| 881 | ntsaxworkshop.com | Domain.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 882 | ntsqjx.com | - | 25 Feb 2025 | 27 Jun 2025 | 25 Feb 2026 |
| 883 | ntsckj.com | Bizcn.com, Inc. | 10 Mar 2020 | 10 Mar 2020 | 10 Mar 2021 |
| 884 | ntsoriente.com | Realtime Register B.V. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 885 | ntsoftvn.net | Tucows Domains Inc. | 11 Feb 2015 | 15 Feb 2016 | 11 Feb 2017 |
| 886 | ntsmarble.com | IHS Telekom, Inc. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 887 | ntsltss.com | Xin Net Technology Corporation | 21 Jul 2025 | 22 Aug 2025 | 21 Jul 2026 |
| 888 | ntshootingcenter.com | GoDaddy.com, LLC | 13 Feb 2015 | 14 Feb 2025 | 13 Feb 2026 |
| 889 | ntsxkj.com | Chengdu West Dimension Digital Technology Co., Ltd… | 8 Jul 2019 | 8 Jul 2019 | 8 Jul 2020 |
| 890 | ntsongon.com | Tucows Domains Inc. | 12 Feb 2014 | 16 Feb 2016 | 12 Feb 2017 |
| 891 | ntsxjs.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Sep 2019 | 20 Sep 2019 | 20 Sep 2020 |
| 892 | ntsflex.com | 1&1 Internet AG | 16 Feb 2015 | 17 Feb 2017 | 16 Feb 2018 |
| 893 | ntsummers.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 894 | ntsyzh.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 13 Mar 2023 | 14 Mar 2024 | 13 Mar 2025 |
| 895 | ntsdtoozone.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 896 | ntsdtolzone.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 897 | ntsc1.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Feb 2015 | 15 Feb 2025 | 18 Feb 2026 |
| 898 | ntsty.com | TurnCommerce, Inc. DBA NameBright.com | 5 May 2017 | 29 Apr 2021 | 5 May 2026 |
| 899 | ntsjtwl.com | GMO Internet Inc. | 29 May 2022 | 9 Aug 2023 | 29 May 2023 |
| 900 | ntshelter.org | Tucows Domains Inc. | 10 Dec 2021 | 14 Dec 2022 | 10 Dec 2023 |
| 901 | ntse2015.com | BigRock Solutions Ltd. | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 902 | ntsusa.info | Melbourne IT, Ltd | 20 Feb 2015 | - | 20 Feb 2016 |
| 903 | ntsty.org | Tucows Domains Inc. | 16 Feb 2014 | 20 Feb 2015 | 16 Feb 2016 |
| 904 | ntselectman.com | eNom, Inc. | 22 Feb 2015 | 22 Feb 2015 | 22 Feb 2016 |
| 905 | ntsyship.com | CyanDomains, Inc. | 22 Aug 2015 | 23 Aug 2015 | 22 Aug 2016 |
| 906 | ntsdms.us | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 21 Aug 2016 |
| 907 | ntsd-ms.us | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 21 Aug 2016 |
| 908 | ntsd-ms.org | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 909 | ntsd-ms.net | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 910 | ntsd-ms.com | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 911 | ntswj443.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 8 Dec 2020 | 8 Dec 2020 | 8 Dec 2021 |
| 912 | ntsakoholdings.com | Tucows Domains Inc. | 25 Feb 2015 | 8 May 2025 | 25 Feb 2025 |
| 913 | ntsmapper.com | DomainsAtCost Corporation | 28 Feb 2015 | 17 Jan 2017 | 28 Feb 2018 |
| 914 | ntsamidwest.com | eNom, Inc. | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 915 | ntselectricalservices.com | Squarespace Domains LLC | 17 Sep 2024 | 29 Nov 2025 | 17 Sep 2025 |
| 916 | ntsgstone.com | Reg2C.com Inc. | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 917 | ntsbrowserit.com | TLD Registrar Solutions Ltd. | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 918 | ntsms.net | Hostinger, UAB | 29 Jul 2024 | 29 Jul 2024 | 29 Jul 2026 |
| 919 | ntsindia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jan 2010 | 4 Jan 2025 | 19 Jan 2028 |
| 920 | ntshenlong.com | Namesilo, LLC | 1 Jan 2026 | 1 Jan 2026 | 1 Jan 2027 |
| 921 | ntsdistribution.com | TurnCommerce, Inc. DBA NameBright.com | 9 Aug 2019 | 23 Aug 2022 | 9 Aug 2026 |
| 922 | ntscottsman.com | Tucows Domains Inc. | 28 Feb 2013 | 4 Mar 2015 | 28 Feb 2016 |
| 923 | ntscotsman.com | Hongkong Domain Name Information Management Co., L… | 6 Nov 2022 | 16 Jan 2024 | 6 Nov 2023 |
| 924 | nts88.com | GoDaddy.com, LLC | 14 Dec 2016 | 14 Dec 2016 | 14 Dec 2017 |
| 925 | nts-realestate.com | IHS Telekom, Inc. | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 926 | ntsgstone.net | Reg2C.com Inc. | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 927 | ntstop5.com | Whois Networks Co., Ltd. | 5 Mar 2015 | 7 Mar 2016 | 5 Mar 2019 |
| 928 | ntslatam.com | Tucows Domains Inc. | 9 Jul 2024 | 19 Sep 2025 | 9 Jul 2025 |
| 929 | ntsinfotechfeedback.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Mar 2015 | 16 Feb 2017 | 4 Mar 2018 |
| 930 | nts-co.com | 1API GmbH | 9 Nov 2024 | 22 Dec 2025 | 9 Nov 2025 |
| 931 | ntsqqvn.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 932 | ntspmsadguruwamanbabamadhyamikvidyalayaghot.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 933 | ntspmnewenglishschoolvichumbe.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 934 | ntspmnewenglishschoolnere.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 935 | ntspmnewenglishschoolnavade.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 936 | ntspmnewenglishschoolkharghar.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 937 | ntspmnewenglishschoolchinchpada.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 938 | ntspmnamdevbuvakhutarikarvidyalaya.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 939 | ntspmmadhyamikvidyalayanitlas.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 940 | ntspmmadhyamikvidyalayakalamboli.com | BigRock Solutions Ltd. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 941 | ntspm.com | Xin Net Technology Corporation | 24 May 2017 | 26 May 2017 | 24 May 2018 |
| 942 | ntshhg.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 15 Feb 2023 | 23 Feb 2024 | 15 Feb 2024 |
| 943 | ntsany.com | eNom647, Inc. | 23 Oct 2018 | 24 Oct 2018 | 23 Oct 2019 |
| 944 | ntsnybkr.com | Network Solutions, LLC | 4 Mar 2014 | 6 Mar 2015 | 4 Mar 2016 |
| 945 | ntsym.com | EIMS (Shenzhen) Culture & Technology Co., Ltd | 15 Mar 2017 | 1 Jan 2018 | 15 Mar 2018 |
| 946 | ntstf.com | Eranet International Limited | 20 Jan 2026 | 21 Jan 2026 | 20 Jan 2027 |
| 947 | ntsjz.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 30 Jan 2023 | 8 Mar 2024 | 30 Jan 2024 |
| 948 | ntshavhenilodge.com | - | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2017 |
| 949 | nts-store.org | Cronon AG | 24 Aug 2015 | - | 24 Aug 2016 |
| 950 | nts-store.net | Cronon AG | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 951 | nts-store.info | Cronon AG | 24 Aug 2015 | - | 24 Aug 2016 |
| 952 | nts-store.com | Tucows Domains Inc. | 17 Feb 2023 | 16 May 2025 | 17 Feb 2026 |
| 953 | ntssxh.com | Foshan YiDong Network Co., LTD | 9 Mar 2015 | 27 Apr 2025 | 9 Mar 2026 |
| 954 | ntsxfood.com | HiChina Zhicheng Technology Limited | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 955 | ntsvfsm.com | Network Solutions, LLC | 8 Mar 2014 | 10 Mar 2015 | 8 Mar 2016 |
| 956 | ntstory.com | NameCheap, Inc. | 17 Apr 2023 | 29 Jun 2025 | 17 Apr 2025 |
| 957 | ntspmalmamaterpublicschool.com | BigRock Solutions Ltd. | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 958 | ntsjgm.com | Xiamen Nawang Technology Co., Ltd | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2017 |
| 959 | ntssitemiracle.us | eNom, Inc. | 10 Mar 2015 | 10 Mar 2015 | 9 Mar 2016 |
| 960 | ntsxt.com | Namecatch Zone LLC | 27 May 2017 | 5 Feb 2018 | 27 May 2018 |
| 961 | ntsunshare.com | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2026 |
| 962 | ntspam.mobi | GoDaddy.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 963 | nts997.com | Whois Networks Co., Ltd. | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 964 | ntspam.net | GoDaddy.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 965 | ntshomes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2020 | 8 Oct 2023 | 27 Aug 2023 |
| 966 | ntsafetysolutions.com | EPAG Domainservices GmbH | 13 Mar 2015 | 25 Jul 2025 | 13 Mar 2026 |
| 967 | ntservices.mobi | eNom, Inc. | 11 Mar 2014 | 12 Mar 2015 | 11 Mar 2016 |
| 968 | ntshljc.com | DROPCATCH.COM 821 LLC | 3 Apr 2019 | 3 Apr 2019 | 3 Apr 2020 |
| 969 | ntszjn.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2017 |
| 970 | ntscintl.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2025 | 16 Mar 2035 |
| 971 | ntssw.com | Sksa Technology Co., Ltd | 8 May 2025 | 9 May 2025 | 8 May 2026 |
| 972 | ntssupply.com | eNom, Inc. | 21 Feb 2017 | 14 Feb 2025 | 21 Feb 2026 |
| 973 | ntsiping.com | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Oct 2024 | 19 Oct 2024 | 19 Oct 2026 |
| 974 | ntshopping.com | TurnCommerce, Inc. DBA NameBright.com | 25 Oct 2018 | 5 Dec 2025 | 25 Oct 2025 |
| 975 | ntsts-ksa.com | TLD Registrar Solutions Ltd. | 23 Feb 2015 | 17 Mar 2015 | 23 Feb 2016 |
| 976 | ntspropertyservicesltd.com | eNom, Inc. | 17 Mar 2015 | 12 Jan 2016 | 17 Mar 2018 |
| 977 | ntstravelandtours.com | eNom, Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 978 | ntsgs.com | Namesilo, LLC | 8 Sep 2017 | 9 Sep 2017 | 8 Sep 2018 |
| 979 | ntsy.org | - | 11 Oct 2025 | 16 Oct 2025 | 11 Oct 2026 |
| 980 | ntsygw.com | Eranet International Limited | 11 Sep 2024 | 29 Oct 2025 | 11 Sep 2025 |
| 981 | ntsougou.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Feb 2017 | 27 Dec 2025 | 21 Feb 2026 |
| 982 | ntshide.com | - | 3 Jun 2025 | 9 Jun 2025 | 3 Jun 2026 |
| 983 | nts-cert.com | Network Solutions, LLC | 2 Jun 2023 | 20 Aug 2025 | 2 Jun 2026 |
| 984 | ntstgc.com | Dynadot9 LLC | 23 Oct 2020 | 23 Oct 2020 | 23 Oct 2021 |
| 985 | ntsbjf.com | HiChina Zhicheng Technology Limited | 20 Mar 2015 | 15 May 2025 | 20 Mar 2026 |
| 986 | ntse.online | Hostinger, UAB | 14 Mar 2022 | 20 May 2023 | 14 Mar 2023 |
| 987 | ntsalert.com | DomainContext, Inc. | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2016 |
| 988 | ntshhm.com | GoDaddy.com, LLC | 15 Aug 2021 | 26 Sep 2023 | 15 Aug 2023 |
| 989 | ntsports.org | GoDaddy.com, LLC | 21 Mar 2015 | 22 Mar 2017 | 21 Mar 2018 |
| 990 | ntsigs.com | GoDaddy.com, LLC | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 991 | ntsfrh.com | Network Solutions, LLC | 21 Mar 2014 | 23 Mar 2015 | 21 Mar 2016 |
| 992 | ntsc-llc.com | GoDaddy.com, LLC | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 993 | ntsgac.org | Key-Systems GmbH | 19 Mar 2009 | 20 Nov 2025 | 19 Mar 2026 |
| 994 | ntskymz.com | HiChina Zhicheng Technology Limited | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 995 | ntskycm.com | HiChina Zhicheng Technology Limited | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 996 | ntsky128.com | HiChina Zhicheng Technology Limited | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 997 | ntsindustriesllp.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Sep 2017 | 16 Sep 2017 | 16 Sep 2018 |
| 998 | ntscsm.com | Namesilo, LLC | 15 May 2019 | 16 May 2019 | 15 May 2020 |
| 999 | ntstudentstore-nwtc.com | FastDomain Inc. | 25 Mar 2015 | 7 May 2025 | 25 Mar 2025 |
| 1000 | ntssjy.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 Mar 2015 | 25 Dec 2025 | 25 Mar 2026 |
Displaying 1,000 out of 14,590 domains starting with the keyword "NTS". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=nts
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |