With support for 
Keyword: NEWENGLANDTRAVEL
Reverse Whois » KEYWORD [newenglandtravel ] { 48 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | newenglandtravel.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 2 | newenglandtravel.news | eNom, Inc. | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 3 | newenglandtravel.guide | eNom, Inc. | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 4 | newenglandtravel.com | Moniker Online Services LLC | 17 Nov 1995 | 13 Jan 2025 | 16 Nov 2026 |
| 5 | newenglandtravel.info | Moniker Online Services LLC | 20 Jul 2006 | 3 Sep 2024 | 20 Jul 2025 |
| 6 | newenglandtravel.net | BigRock Solutions Ltd. | 15 Oct 2013 | 16 Oct 2016 | 15 Oct 2016 |
| 7 | newenglandtravel.vacations | Automattic Inc. | 15 Jul 2019 | 29 Jul 2019 | 15 Jul 2020 |
| 8 | newenglandtravel.com.au | - | - | 18 May 2025 | - |
| 9 | newenglandtravelplanner.com | eNom, Inc. | 5 Sep 2003 | 29 Jul 2024 | 5 Sep 2025 |
| 10 | newenglandtravelingmarketplace.com | GoDaddy.com, LLC | 3 Jun 2012 | 4 Jun 2015 | 3 Jun 2016 |
| 11 | newenglandtravelservice.com | eNom, Inc. | 17 Apr 2012 | 10 May 2017 | 17 Apr 2018 |
| 12 | newenglandtraveler.net | FastDomain Inc. | 13 Jan 2020 | 13 Jan 2020 | 13 Jan 2021 |
| 13 | newenglandtraveladventure.com | GoDaddy.com, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 14 | newenglandtravelshow.com | GoDaddy.com, LLC | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2018 |
| 15 | newenglandtravelmedia.com | GoDaddy.com, LLC | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2018 |
| 16 | newenglandtravelexpo.com | GoDaddy.com, LLC | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2018 |
| 17 | newenglandtravelandtourismshow.com | GoDaddy.com, LLC | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2018 |
| 18 | newenglandtravelandtourismexpo.com | GoDaddy.com, LLC | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2018 |
| 19 | newenglandtravelshowcase.com | NameCheap, Inc. | 8 Dec 2013 | 28 Nov 2021 | 8 Dec 2022 |
| 20 | newenglandtraveler.com | Webnames.ca Inc. | 22 Dec 2011 | 10 Mar 2025 | 22 Dec 2029 |
| 21 | newenglandtravelcompany.com | GoDaddy.com, LLC | 8 Jun 2014 | 9 Jun 2016 | 8 Jun 2017 |
| 22 | newenglandtravelguide.com | GoDaddy.com, LLC | 24 Aug 2003 | 5 Aug 2024 | 24 Aug 2025 |
| 23 | newenglandtraveling.com | NameCheap, Inc. | 25 Mar 2022 | - | 25 Mar 2023 |
| 24 | newenglandtravelmagazine.com | DreamHost, LLC | 29 Aug 2007 | 11 Oct 2017 | 29 Aug 2017 |
| 25 | newenglandtravelinformation.com | GoDaddy.com, LLC | 31 Aug 2012 | 15 Sep 2016 | 31 Aug 2017 |
| 26 | newenglandtravelsearch.com | GoDaddy.com, LLC | 7 Jan 2014 | 4 May 2015 | 7 Jan 2017 |
| 27 | newenglandtravelservices.com | GoDaddy.com, LLC | 18 Apr 2013 | 22 Feb 2016 | 18 Apr 2017 |
| 28 | newenglandtravels.com | DNC Holdings, Inc. | 23 Jan 2001 | 6 Mar 2025 | 23 Jan 2025 |
| 29 | newenglandtraveldestinations.com | GoDaddy.com, LLC | 31 Aug 2012 | 15 Sep 2016 | 31 Aug 2017 |
| 30 | newenglandtravelers.com | GoDaddy.com, LLC | 31 Mar 2023 | 13 Apr 2024 | 31 Mar 2025 |
| 31 | newenglandtravelassociate.com | GoDaddy.com, LLC | 5 May 2017 | 5 May 2017 | 5 May 2018 |
| 32 | newenglandtravelblog.com | NameCheap, Inc. | 23 Feb 2018 | 23 Feb 2018 | 23 Feb 2019 |
| 33 | newenglandtravelnetwork.com | eNom, Inc. | 2 Apr 2018 | 2 Apr 2018 | 2 Apr 2019 |
| 34 | newenglandtravellibrary.com | eNom, Inc. | 6 Apr 2018 | 6 Apr 2018 | 6 Apr 2019 |
| 35 | newenglandtravelco.com | Automattic Inc. | 2 May 2018 | 12 Apr 2025 | 2 May 2026 |
| 36 | newenglandtraveljournal.com | GoDaddy.com, LLC | 5 Sep 2018 | 6 Sep 2024 | 5 Sep 2025 |
| 37 | newenglandtravelnurses.com | GoDaddy.com, LLC | 3 Apr 2019 | 3 Apr 2019 | 3 Apr 2020 |
| 38 | newenglandtravelcollective.com | GoDaddy.com, LLC | 8 Apr 2020 | 9 Apr 2025 | 8 Apr 2026 |
| 39 | newenglandtravelchannel.com | GoDaddy.com, LLC | 11 Apr 2024 | 15 Apr 2025 | 11 Apr 2026 |
| 40 | newenglandtravelertv.com | 1&1 Internet AG | 26 Feb 2021 | 2 Mar 2021 | 26 Feb 2026 |
| 41 | newenglandtravelandlife.com | register.com, Inc. | 23 Apr 2022 | 24 Mar 2025 | 23 Apr 2026 |
| 42 | newenglandtraveltips.com | Register.it SPA | 24 Aug 2022 | 26 Sep 2023 | 24 Aug 2023 |
| 43 | newenglandtravelideas.com | Register.it SPA | 24 Aug 2022 | 26 Sep 2023 | 24 Aug 2023 |
| 44 | newenglandtravelclub.com | Wild West Domains, LLC | 3 Oct 2017 | 4 Oct 2024 | 3 Oct 2025 |
| 45 | newenglandtravelphotos.com | NameCheap, Inc. | 24 May 2020 | 25 May 2024 | 24 May 2025 |
| 46 | newenglandtravelog.com | GoDaddy.com, LLC | 29 May 2021 | 30 May 2024 | 29 May 2025 |
| 47 | newenglandtravelogue.com | GoDaddy.com, LLC | 29 May 2021 | 10 Aug 2023 | 29 May 2023 |
| 48 | newenglandtravelapp.com | Wix.com Ltd. | 27 Feb 2022 | 3 Mar 2025 | 27 Feb 2026 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=newenglandtravel
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |