With support for 
Keyword: NEWENGLAND
Reverse Whois » KEYWORD [newengland ] { 19,737 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | newengland.co.uk | - | - | 10 Jan 2025 | 10 Jan 2026 |
| 2 | newengland.xyz | - | 6 Nov 2019 | 14 Feb 2025 | 6 Nov 2026 |
| 3 | newengland.pro | NameCheap, Inc. | 25 Jan 2023 | 30 Jan 2023 | 25 Jan 2033 |
| 4 | newengland.report | GoDaddy.com, LLC | 9 Jul 2014 | 9 Jul 2014 | 9 Jul 2015 |
| 5 | newengland.properties | GoDaddy.com, LLC | 29 Feb 2024 | 11 Apr 2025 | 28 Feb 2025 |
| 6 | newengland.fish | GoDaddy.com, LLC | 21 Jul 2014 | 6 Jan 2017 | 21 Jul 2017 |
| 7 | newengland.farm | GoDaddy.com, LLC | 24 Jul 2014 | 7 Sep 2024 | 24 Jul 2026 |
| 8 | newengland.photo | NameCheap, Inc. | 25 Nov 2016 | 10 Nov 2021 | 25 Nov 2023 |
| 9 | newengland.camp | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 10 | newengland.link | Name.com, Inc. | 2 Sep 2014 | 3 Sep 2017 | 2 Sep 2018 |
| 11 | newengland.christmas | eNom, Inc. | 22 Aug 2014 | 6 Oct 2017 | 22 Aug 2018 |
| 12 | newengland.graphics | 1&1 Internet AG | 20 Sep 2014 | 3 May 2017 | 20 Sep 2017 |
| 13 | newengland.nyc | GoDaddy.com, LLC | 11 Oct 2014 | 11 Oct 2014 | 10 Oct 2019 |
| 14 | newengland.pics | 1API GmbH | 21 Oct 2014 | 27 Jan 2025 | 21 Oct 2025 |
| 15 | newengland.kitchen | NameCheap, Inc. | 3 Apr 2019 | 3 Apr 2019 | 3 Apr 2020 |
| 16 | newengland.tax | GoDaddy.com, LLC | 11 Nov 2014 | 26 Dec 2019 | 11 Nov 2020 |
| 17 | newengland.works | GoDaddy.com, LLC | 15 Jun 2017 | 30 Jul 2019 | 15 Jun 2020 |
| 18 | newengland.website | Global Domains International, Inc. DBA DomainCostC… | 17 Nov 2022 | 18 Nov 2023 | 17 Nov 2024 |
| 19 | newengland.ninja | Name.com, Inc. | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 20 | newengland.bid | NameCheap, Inc. | 23 May 2017 | 28 May 2017 | 23 May 2018 |
| 21 | newengland.direct | Network Solutions, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 22 | newengland.onl | Crazy Domains FZ-LLC | 15 Jan 2015 | 14 Feb 2017 | 15 Jan 2018 |
| 23 | newengland.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 24 | newengland.physio | eNom, Inc. | 8 Dec 2014 | 1 Feb 2015 | 8 Dec 2015 |
| 25 | newengland.life | Google, Inc. | 1 Feb 2019 | 3 Jun 2025 | 1 Feb 2026 |
| 26 | newengland.work | GoDaddy.com, LLC | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 27 | newengland.click | NameCheap, Inc. | 5 Aug 2022 | 16 Oct 2024 | 5 Aug 2024 |
| 28 | newengland.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 29 | newengland.poker | 1API GmbH | 21 Apr 2015 | 21 Apr 2025 | 21 Apr 2026 |
| 30 | newengland.estate | Global Domains International, Inc. DBA DomainCostC… | 21 Nov 2022 | 21 Nov 2023 | 21 Nov 2024 |
| 31 | newengland.college | NameCheap, Inc. | 26 Apr 2021 | 1 May 2025 | 26 Apr 2026 |
| 32 | newengland.apartments | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 33 | newengland.football | Global Domains International, Inc. DBA DomainCostC… | 17 Nov 2022 | 1 Jan 2025 | 17 Nov 2025 |
| 34 | newengland.partners | Key-Systems, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 35 | newengland.rocks | Uniregistrar Corp | 18 Jul 2015 | 18 Jul 2015 | 18 Jul 2016 |
| 36 | newengland.one | Dynadot, LLC | 8 Feb 2022 | 19 Jan 2025 | 8 Feb 2026 |
| 37 | newengland.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 38 | newengland.party | NameCheap, Inc. | 12 Nov 2017 | 19 Dec 2024 | 12 Nov 2027 |
| 39 | newengland.design | GoDaddy.com, LLC | 12 May 2015 | 18 May 2025 | 12 May 2026 |
| 40 | newengland.run | Wild West Domains, LLC | 19 Aug 2015 | 3 Oct 2024 | 19 Aug 2025 |
| 41 | newengland.photos | Porkbun, LLC | 23 Oct 2021 | 3 Nov 2023 | 23 Oct 2024 |
| 42 | newengland.ski | Name.com, Inc. | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 43 | newengland.wedding | GoDaddy.com, LLC | 22 Sep 2015 | 28 Sep 2024 | 22 Sep 2025 |
| 44 | newengland.us | GoDaddy.com, LLC | 11 Jul 2015 | 22 Jul 2017 | 10 Jul 2017 |
| 45 | newengland.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2024 | 15 Oct 2025 |
| 46 | newengland.church | GoDaddy.com, LLC | 21 Oct 2015 | 12 Jul 2024 | 21 Oct 2025 |
| 47 | newengland.team | Xiamen ChinaSource Internet Service Co., Ltd. | 18 May 2020 | 18 May 2023 | 18 May 2024 |
| 48 | newengland.science | NameCheap, Inc. | 23 May 2017 | 28 May 2017 | 23 May 2018 |
| 49 | newengland.golf | GoDaddy.com, LLC | 27 Jan 2016 | 13 Mar 2025 | 27 Jan 2026 |
| 50 | newengland.beer | Uniregistrar Corp | 30 Jan 2016 | 30 Jan 2016 | 30 Jan 2017 |
| 51 | newengland.top | Namesilo, LLC | 18 Apr 2023 | 22 May 2024 | 18 Apr 2024 |
| 52 | newengland.rent | Dynadot, LLC | 17 Nov 2022 | 18 Nov 2023 | 17 Nov 2024 |
| 53 | newengland.press | NameCheap, Inc. | 23 May 2017 | 9 Jun 2017 | 23 May 2018 |
| 54 | newengland.fashion | GoDaddy.com, LLC | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 55 | newengland.clothing | Global Domains International, Inc. DBA DomainCostC… | 18 Jan 2023 | 4 Mar 2025 | 18 Jan 2026 |
| 56 | newengland.builders | GoDaddy.com, LLC | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 57 | newengland.condos | GoDaddy.com, LLC | 16 May 2016 | 30 Jun 2020 | 16 May 2021 |
| 58 | newengland.mom | Dynadot, LLC | 26 Sep 2023 | 27 Sep 2024 | 26 Sep 2025 |
| 59 | newengland.soccer | Network Solutions, LLC | 16 Jun 2016 | 21 Jun 2016 | 16 Jun 2017 |
| 60 | newengland.singles | GoDaddy.com, LLC | 26 Feb 2014 | 12 Apr 2017 | 26 Feb 2018 |
| 61 | newengland.gallery | GoDaddy.com, LLC | 11 Sep 2018 | 26 Oct 2019 | 11 Sep 2020 |
| 62 | newengland.guru | GoDaddy.com, LLC | 5 Feb 2014 | 21 Mar 2016 | 5 Feb 2017 |
| 63 | newengland.lighting | GoDaddy.com, LLC | 28 Feb 2014 | 11 Apr 2023 | 28 Feb 2023 |
| 64 | newengland.photography | Porkbun, LLC | 23 Oct 2021 | 26 Dec 2024 | 23 Oct 2025 |
| 65 | newengland.tips | NETIM SARL | 26 Feb 2014 | 12 Mar 2018 | 26 Feb 2019 |
| 66 | newengland.company | Network Solutions, LLC | 16 Mar 2014 | 2 Nov 2015 | 16 Mar 2017 |
| 67 | newengland.media | GoDaddy.com, LLC | 13 Jul 2016 | 27 Aug 2024 | 13 Jul 2025 |
| 68 | newengland.holiday | united-domains AG | 16 Apr 2014 | 31 May 2017 | 16 Apr 2018 |
| 69 | newengland.today | Global Domains International, Inc. DBA DomainCostC… | 12 Jun 2023 | 20 Jul 2024 | 12 Jun 2024 |
| 70 | newengland.cruises | GoDaddy.com, LLC | 28 May 2014 | 8 Aug 2019 | 28 May 2020 |
| 71 | newengland.wiki | GoDaddy.com, LLC | 18 Jun 2014 | 14 Oct 2015 | 18 Jun 2017 |
| 72 | newengland.cleaning | CloudFlare, Inc. | 11 Jul 2022 | 20 Aug 2024 | 11 Jul 2024 |
| 73 | newengland.events | Dynadot, LLC | 9 Oct 2019 | 23 Nov 2024 | 9 Oct 2025 |
| 74 | newengland.reviews | Name.com, Inc. | 5 Jun 2014 | 29 May 2017 | 5 Jun 2018 |
| 75 | newengland.biz | GoDaddy.com, LLC | 15 May 2023 | 3 Aug 2024 | 15 May 2026 |
| 76 | newengland.gifts | GoDaddy.com, LLC | 22 Jul 2016 | 2 Sep 2017 | 22 Jul 2017 |
| 77 | newengland.vip | - | 31 Jul 2016 | 31 Jul 2016 | 31 Jul 2017 |
| 78 | newengland.coffee | GoDaddy.com, LLC | 11 Jan 2021 | 25 Feb 2025 | 11 Jan 2026 |
| 79 | newengland.net | Megazone Corp., dba HOSTING.KR | 18 Aug 2002 | 10 Sep 2024 | 18 Aug 2025 |
| 80 | newengland.com | Webnames.ca Inc. | 28 Oct 1994 | 20 Feb 2025 | 27 Oct 2026 |
| 81 | newengland.info | Google, Inc. | 12 Sep 2001 | 3 Jun 2025 | 12 Sep 2025 |
| 82 | newengland.ltd | GoDaddy.com, LLC | 11 Oct 2016 | 11 Oct 2017 | 11 Oct 2018 |
| 83 | newengland.org | Uniregistrar Corp | 16 Jun 2004 | 14 May 2025 | 16 Jun 2026 |
| 84 | newengland.coop | Domains.coop Limited | 31 Jan 2002 | 15 Mar 2025 | 31 Jan 2025 |
| 85 | newengland.hiphop | Uniregistrar Corp | 27 Oct 2016 | 7 Dec 2017 | 27 Oct 2017 |
| 86 | newengland.training | GoDaddy.com, LLC | 10 Nov 2016 | 11 Nov 2017 | 10 Nov 2018 |
| 87 | newengland.digital | GoDaddy.com, LLC | 17 Oct 2024 | 22 Oct 2024 | 17 Oct 2025 |
| 88 | newengland.in | - | 16 Jun 2016 | 15 Aug 2016 | 16 Jun 2017 |
| 89 | newengland.zone | NameCheap, Inc. | 23 May 2017 | 29 Sep 2017 | 23 May 2018 |
| 90 | newengland.group | - | 21 Jan 2025 | 26 Jan 2025 | 21 Jan 2026 |
| 91 | newengland.world | GoDaddy.com, LLC | 30 Jan 2025 | 4 Feb 2025 | 30 Jan 2027 |
| 92 | newengland.solar | Google, Inc. | 27 Sep 2021 | 27 Sep 2024 | 27 Sep 2025 |
| 93 | newengland.house | Global Domains International, Inc. DBA DomainCostC… | 17 Aug 2021 | 17 Aug 2023 | 17 Aug 2024 |
| 94 | newengland.mx | NameSector LLC | 5 Sep 2010 | 15 Sep 2017 | 4 Sep 2018 |
| 95 | newengland.style | Porkbun, LLC | 16 Feb 2022 | 28 Apr 2023 | 16 Feb 2023 |
| 96 | newengland.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 Oct 2017 | 25 Nov 2017 | 11 Oct 2019 |
| 97 | newengland.fyi | Dynadot, LLC | 18 Nov 2019 | 18 Nov 2019 | 18 Nov 2020 |
| 98 | newengland.investments | Uniregistrar Corp | - | - | - |
| 99 | newengland.agency | Global Domains International, Inc. DBA DomainCostC… | 1 Jul 2021 | 1 Jul 2021 | 1 Jul 2022 |
| 100 | newengland.marketing | Uniregistrar Corp | - | - | - |
| 101 | newengland.recipes | Amazon Registrar, Inc. | 5 Aug 2024 | 23 May 2025 | 5 Aug 2025 |
| 102 | newengland.productions | GoDaddy.com, LLC | 15 Sep 2019 | 20 Sep 2019 | 15 Sep 2020 |
| 103 | newengland.dev | Google, Inc. | 28 Feb 2019 | 5 Mar 2019 | 28 Feb 2020 |
| 104 | newengland.solutions | GoDaddy.com, LLC | 30 Jan 2025 | 4 Feb 2025 | 30 Jan 2027 |
| 105 | newengland.vacations | Uniregistrar Corp | 11 Apr 2019 | 27 Apr 2020 | 11 Apr 2021 |
| 106 | newengland.bet | GoDaddy.com, LLC | 25 Jun 2019 | 24 Aug 2019 | 25 Jun 2022 |
| 107 | newengland.glass | GoDaddy.com, LLC | 17 Sep 2019 | 14 Aug 2024 | 17 Sep 2025 |
| 108 | newengland.systems | Dynadot, LLC | 18 Nov 2019 | 4 Dec 2019 | 18 Nov 2020 |
| 109 | newengland.cloud | GMO Internet Inc. | 3 Oct 2024 | 25 Dec 2024 | 3 Oct 2025 |
| 110 | newengland.center | GoDaddy.com, LLC | 3 May 2023 | 9 May 2025 | 3 May 2027 |
| 111 | newengland.international | Tucows Domains Inc. | 21 Jan 2025 | 26 Jan 2025 | 21 Jan 2026 |
| 112 | newengland.ventures | GoDaddy.com, LLC | 14 Mar 2020 | 19 Mar 2020 | 14 Mar 2021 |
| 113 | newengland.institute | Google, Inc. | 21 Dec 2017 | 3 Jun 2025 | 21 Dec 2025 |
| 114 | newengland.education | Global Domains International, Inc. DBA DomainCostC… | 6 Feb 2017 | 16 Mar 2024 | 6 Feb 2024 |
| 115 | newengland.email | Global Domains International, Inc. DBA DomainCostC… | 6 Feb 2017 | 16 Apr 2023 | 6 Feb 2023 |
| 116 | newengland.energy | Automattic Inc. | 21 Feb 2024 | 5 Apr 2025 | 21 Feb 2025 |
| 117 | newengland.art | GoDaddy.com, LLC | 20 Nov 2020 | 20 Nov 2020 | 20 Nov 2022 |
| 118 | newengland.travel | Global Domains International, Inc. DBA DomainCostC… | 24 Feb 2021 | 3 Apr 2024 | 24 Feb 2024 |
| 119 | newengland.black | NameCheap, Inc. | 17 Apr 2021 | 29 May 2023 | 17 Apr 2023 |
| 120 | newengland.love | Dynadot, LLC | 24 Feb 2023 | 4 Apr 2024 | 24 Feb 2024 |
| 121 | newengland.show | NameCheap, Inc. | 13 Oct 2021 | 24 Nov 2023 | 13 Oct 2023 |
| 122 | newengland.technology | Network Solutions, LLC | 24 Oct 2021 | 24 Oct 2021 | 24 Oct 2022 |
| 123 | newengland.finance | NameCheap, Inc. | 4 Feb 2022 | 4 Feb 2022 | 4 Feb 2023 |
| 124 | newengland.beauty | Porkbun, LLC | 24 Nov 2023 | 11 Feb 2025 | 24 Nov 2025 |
| 125 | newengland.makeup | NameCheap, Inc. | 6 Aug 2024 | 14 Aug 2024 | 6 Aug 2025 |
| 126 | newengland.quest | Dynadot, LLC | 4 Mar 2022 | 14 Apr 2023 | 4 Mar 2023 |
| 127 | newengland.mobi | Dynadot, LLC | 16 Jun 2022 | 25 Aug 2023 | 16 Jun 2023 |
| 128 | newengland.financial | - | 18 Jul 2022 | 18 Jul 2022 | 18 Jul 2023 |
| 129 | newengland.creditcard | - | 18 Jul 2022 | 18 Jul 2022 | 18 Jul 2023 |
| 130 | newengland.host | Dynadot, LLC | 17 Nov 2022 | 17 Nov 2022 | 17 Nov 2023 |
| 131 | newengland.pl | home.pl S.A. | 17 Mar 2004 | 18 Feb 2025 | 17 Mar 2026 |
| 132 | newengland.app | Webnames.ca Inc. | 4 May 2018 | 27 Apr 2025 | 5 May 2027 |
| 133 | newengland.com.au | - | - | 6 Feb 2025 | - |
| 134 | newengland.autos | Dynadot, LLC | 4 Mar 2022 | 14 Apr 2024 | 4 Mar 2024 |
| 135 | newengland.blog | Global Domains International, Inc. DBA DomainCostC… | 30 Aug 2024 | 25 Apr 2025 | 30 Aug 2025 |
| 136 | newengland.boston | Global Domains International, Inc. DBA DomainCostC… | 3 Mar 2019 | 23 Mar 2025 | 3 Mar 2026 |
| 137 | newengland.cam | Global Domains International, Inc. DBA DomainCostC… | 27 Apr 2022 | 5 Jul 2023 | 27 Apr 2023 |
| 138 | newengland.bike | GoDaddy.com, LLC | 3 Feb 2023 | 20 Mar 2025 | 3 Feb 2026 |
| 139 | newengland.boats | NameCheap, Inc. | 3 Feb 2023 | 13 Jan 2025 | 3 Feb 2026 |
| 140 | newengland.aero | Tucows Domains Inc. | 30 May 2019 | 2 Jun 2025 | 30 May 2026 |
| 141 | newengland.hair | NameCheap, Inc. | 6 Aug 2024 | 14 Aug 2024 | 6 Aug 2025 |
| 142 | newengland.gay | Name.com, Inc. | 13 Oct 2021 | 26 Nov 2023 | 13 Oct 2023 |
| 143 | newengland.homes | Tucows Domains Inc. | 9 Feb 2022 | 10 Oct 2024 | 9 Feb 2026 |
| 144 | newengland.it | - | 14 Sep 2009 | 15 Oct 2024 | 29 Sep 2025 |
| 145 | newengland.law | 101domain, Inc. | 30 Jun 2017 | 27 Mar 2020 | 30 Jun 2025 |
| 146 | newengland.motorcycles | Global Domains International, Inc. DBA DomainCostC… | 29 Nov 2021 | 30 Nov 2023 | 29 Nov 2024 |
| 147 | newengland.esq | Google, Inc. | 14 May 2023 | 4 May 2025 | 14 May 2026 |
| 148 | newengland.guide | eNom, Inc. | 16 May 2023 | 27 Jul 2024 | 16 May 2024 |
| 149 | newengland.help | Dynadot, LLC | 18 Jun 2023 | 29 Jul 2024 | 18 Jun 2024 |
| 150 | newengland.support | Global Domains International, Inc. DBA DomainCostC… | 18 Jun 2023 | 27 Jul 2024 | 18 Jun 2024 |
| 151 | newengland.yachts | Porkbun, LLC | 4 Aug 2023 | 12 Sep 2024 | 4 Aug 2025 |
| 152 | newengland.mba | NameCheap, Inc. | 30 Sep 2023 | 11 Dec 2024 | 30 Sep 2024 |
| 153 | newengland.rentals | - | 10 Oct 2023 | 10 Oct 2023 | 10 Oct 2024 |
| 154 | newengland.network | - | 20 Dec 2023 | 20 Dec 2023 | 20 Dec 2024 |
| 155 | newengland.ai | Key-Systems GmbH | - | - | - |
| 156 | newengland.com.br | - | 4 Jan 2024 | 4 Jan 2024 | 4 Jan 2026 |
| 157 | newengland.ing | GoDaddy.com, LLC | 26 Feb 2024 | 26 Feb 2025 | 26 Feb 2026 |
| 158 | newengland.jp | - | 1 Nov 2013 | 1 Dec 2024 | 30 Nov 2025 |
| 159 | newengland.social | Google, Inc. | 1 Feb 2022 | 3 Jun 2025 | 1 Feb 2026 |
| 160 | newengland.gives | NameCheap, Inc. | 18 Apr 2024 | 30 May 2025 | 18 Apr 2025 |
| 161 | newengland.de | - | - | 21 Apr 2025 | - |
| 162 | newengland.capital | Porkbun, LLC | 3 May 2024 | 13 May 2025 | 3 May 2026 |
| 163 | newengland.io | NameKing.com Inc. | 27 May 2022 | 27 May 2025 | 27 May 2026 |
| 164 | newengland.dk | - | 23 Sep 2024 | - | 22 Sep 2025 |
| 165 | newengland.club | CloudFlare, Inc. | 12 Nov 2024 | 17 Nov 2024 | 12 Nov 2025 |
| 166 | newengland.se | - | 16 Apr 2010 | 3 Mar 2025 | 16 Apr 2026 |
| 167 | newengland.pizza | Google, Inc. | 9 Mar 2025 | 14 Mar 2025 | 9 Mar 2026 |
| 168 | newengland.uk.com | GoDaddy.com, LLC | 27 May 2025 | 30 May 2025 | 27 May 2026 |
| 169 | newenglandsoccerballs.com | GoDaddy.com, LLC | 1 Jan 2015 | 13 Jan 2016 | 1 Jan 2017 |
| 170 | newengland-patriotsjerseys.com | Internet.bs Corp. | 3 Oct 2012 | 3 Oct 2012 | 3 Oct 2013 |
| 171 | newengland-motorsports.com | DreamHost, LLC | 11 May 2025 | 11 May 2025 | 11 May 2028 |
| 172 | newenglandmetalroof.com | GoDaddy.com, LLC | 11 Jul 2006 | 11 Jul 2024 | 11 Jul 2025 |
| 173 | newenglandcouponsaver.com | NameCheap, Inc. | 17 Sep 2021 | 8 Sep 2024 | 17 Sep 2025 |
| 174 | newenglandstartsup.com | FastDomain Inc. | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 175 | newenglandspower.com | GoDaddy.com, LLC | 21 Oct 2014 | 22 Oct 2024 | 21 Oct 2025 |
| 176 | newenglandsenergy.com | GoDaddy.com, LLC | 21 Oct 2014 | 22 Oct 2024 | 21 Oct 2025 |
| 177 | newenglandlender.com | GoDaddy.com, LLC | 22 Oct 2014 | 11 Sep 2016 | 22 Oct 2017 |
| 178 | newenglandbusinessloans.com | GoDaddy.com, LLC | 22 Oct 2014 | 2 Dec 2023 | 22 Oct 2023 |
| 179 | newenglandboating.com | GoDaddy.com, LLC | 21 Jul 2005 | 13 Mar 2025 | 21 Jul 2030 |
| 180 | newenglandcollegeonline.com | GoDaddy.com, LLC | 26 Jul 2006 | 27 Jul 2024 | 26 Jul 2025 |
| 181 | newenglandfilm.com | Porkbun, LLC | 19 Apr 1997 | 16 May 2024 | 20 Apr 2026 |
| 182 | newenglandhistoricalsociety.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2025 | 28 May 2027 |
| 183 | newenglandinnsandresorts.com | GoDaddy.com, LLC | 8 Jan 2003 | 20 Oct 2024 | 16 Jan 2030 |
| 184 | newenglandmoves.com | CSC Corporate Domains, Inc. | 28 Apr 2000 | 24 Apr 2025 | 28 Apr 2026 |
| 185 | newenglandoil.com | GoDaddy.com, LLC | 25 Mar 2000 | 4 May 2024 | 25 Mar 2026 |
| 186 | newenglandrecruitingreport.com | 1&1 Internet AG | 1 May 2007 | 5 Jun 2024 | 1 May 2026 |
| 187 | newenglandreptile.com | GoDaddy.com, LLC | 28 May 1997 | 28 Oct 2024 | 28 Oct 2025 |
| 188 | newenglandskihistory.com | DreamHost, LLC | 12 Aug 2010 | 18 Apr 2023 | 12 Aug 2025 |
| 189 | newenglandtravelplanner.com | eNom, Inc. | 5 Sep 2003 | 26 May 2025 | 5 Sep 2026 |
| 190 | newenglandwaterfalls.com | GoDaddy.com, LLC | 11 Apr 2003 | 12 Apr 2025 | 11 Apr 2026 |
| 191 | newenglandwild.org | NameCheap, Inc. | 3 May 2001 | 8 Apr 2025 | 3 May 2026 |
| 192 | newenglandpetfoodpantry.org | eNom, Inc. | 18 Oct 2013 | 19 Oct 2014 | 18 Oct 2015 |
| 193 | newenglandoptiparents.org | register.com, Inc. | 19 Oct 2014 | 4 Oct 2017 | 19 Oct 2018 |
| 194 | newenglandspower.info | GoDaddy.com, LLC | 21 Oct 2014 | 5 Dec 2024 | 21 Oct 2025 |
| 195 | newenglandsenergy.info | GoDaddy.com, LLC | 21 Oct 2014 | 5 Dec 2024 | 21 Oct 2025 |
| 196 | newenglandmoldremoval.com | GoDaddy.com, LLC | 22 Oct 2014 | 23 Oct 2016 | 22 Oct 2017 |
| 197 | newenglandmoldexperts.com | GoDaddy.com, LLC | 8 Nov 2019 | 20 Jan 2025 | 8 Nov 2024 |
| 198 | newenglandcconciere.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 199 | newenglandauthors.com | GoDaddy.com, LLC | 6 Dec 2018 | 6 Dec 2018 | 6 Dec 2020 |
| 200 | newenglandspower.org | GoDaddy.com, LLC | 21 Oct 2014 | 5 Dec 2024 | 21 Oct 2025 |
| 201 | newenglandspower.net | GoDaddy.com, LLC | 21 Oct 2014 | 22 Oct 2024 | 21 Oct 2025 |
| 202 | newenglandsenergy.us | GoDaddy.com, LLC | 21 Oct 2014 | 31 Oct 2017 | 20 Oct 2019 |
| 203 | newenglandsenergy.org | GoDaddy.com, LLC | 21 Oct 2014 | 5 Dec 2024 | 21 Oct 2025 |
| 204 | newenglandsenergy.net | GoDaddy.com, LLC | 21 Oct 2014 | 22 Oct 2024 | 21 Oct 2025 |
| 205 | newenglandloop.com | Porkbun, LLC | 23 Oct 2014 | 22 Oct 2024 | 23 Oct 2025 |
| 206 | newenglandhorrorfilms.com | FastDomain Inc. | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 207 | newenglanddarkfibersolutions.com | Network Solutions, LLC | 17 Dec 2012 | 10 Jul 2023 | 17 Dec 2026 |
| 208 | newenglanddarkfiber.com | Network Solutions, LLC | 18 Feb 2010 | 29 Jan 2025 | 18 Feb 2026 |
| 209 | newenglandcoastalphotography.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 210 | newenglandcleanpro.com | GoDaddy.com, LLC | 23 Oct 2014 | 5 Oct 2016 | 23 Oct 2017 |
| 211 | newenglandone.com | eNom, Inc. | 18 Feb 2014 | 4 Feb 2025 | 18 Feb 2026 |
| 212 | newenglandopenmarkets.com | Tucows Domains Inc. | 27 Nov 2013 | 30 Apr 2025 | 27 Nov 2025 |
| 213 | newenglandthruway.com | TurnCommerce, Inc. DBA NameBright.com | 14 Sep 2001 | 8 Oct 2024 | 14 Sep 2025 |
| 214 | newenglandstones.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2024 | 25 Oct 2025 |
| 215 | newenglandltc.com | Wild West Domains, LLC | 24 Oct 2014 | 25 Oct 2024 | 24 Oct 2026 |
| 216 | newenglandkayakfishing.com | eNom, Inc. | 6 Nov 2005 | 6 Nov 2024 | 6 Nov 2025 |
| 217 | newenglandpromotions.net | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2019 |
| 218 | newenglandchevalcanadien.com | GoDaddy.com, LLC | 26 May 2008 | 26 May 2015 | 26 May 2016 |
| 219 | newenglandchevalcanadien.org | - | - | - | - |
| 220 | newenglandgocarts.com | GoDaddy.com, LLC | 26 May 2013 | 27 May 2015 | 26 May 2016 |
| 221 | newenglandenergyrenovations.com | GoDaddy.com, LLC | 26 May 2013 | 27 May 2015 | 26 May 2016 |
| 222 | newenglandoffleaseautowholesale.com | GoDaddy.com, LLC | 25 Oct 2014 | 26 Oct 2024 | 25 Oct 2026 |
| 223 | newenglandflashmobbers.com | GoDaddy.com, LLC | 27 May 2013 | 28 May 2015 | 27 May 2016 |
| 224 | newenglandseasaltcompany.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 225 | newenglandcreditcare.com | GoDaddy.com, LLC | 28 May 2014 | 29 May 2015 | 28 May 2016 |
| 226 | newenglandsportsroundup.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 227 | newenglandcreditcare.net | GoDaddy.com, LLC | 28 May 2014 | 29 May 2015 | 28 May 2016 |
| 228 | newenglandobesitynetwork.us | GoDaddy.com, LLC | 30 May 2014 | 30 May 2014 | 29 May 2015 |
| 229 | newenglandrealestategroup.com | GoDaddy.com, LLC | 23 Sep 2023 | 23 Sep 2023 | 23 Sep 2025 |
| 230 | newenglandstagedhomes.com | GoDaddy.com, LLC | 29 May 2006 | 30 May 2015 | 29 May 2016 |
| 231 | newenglandrealtygrp.com | GoDaddy.com, LLC | 29 May 2013 | 30 May 2015 | 29 May 2016 |
| 232 | newenglandassociates.org | GoDaddy.com, LLC | 24 Oct 2014 | 8 Dec 2024 | 24 Oct 2034 |
| 233 | newenglandobesitynetwork.info | GoDaddy.com, LLC | 30 May 2014 | 30 May 2015 | 30 May 2016 |
| 234 | newenglandobesitynetwork.com | GoDaddy.com, LLC | 30 May 2014 | 31 May 2015 | 30 May 2016 |
| 235 | newenglandobesitynetwork.net | GoDaddy.com, LLC | 30 May 2014 | 31 May 2015 | 30 May 2016 |
| 236 | newenglandcustomputtinggreens-sux.com | GoDaddy.com, LLC | 11 Jul 2011 | 28 Aug 2013 | 11 Jul 2015 |
| 237 | newenglandstate.info | Crazy Domains FZ-LLC | 26 Oct 2014 | - | 26 Oct 2016 |
| 238 | newenglandmystery.net | GoDaddy.com, LLC | 31 May 2014 | 1 Jun 2015 | 31 May 2016 |
| 239 | newenglandmystery.info | GoDaddy.com, LLC | 31 May 2014 | 31 May 2015 | 31 May 2016 |
| 240 | newenglandmystery.org | GoDaddy.com, LLC | 31 May 2014 | 12 Jun 2015 | 31 May 2016 |
| 241 | newenglandchristianartscouncil.org | Namesilo, LLC | 30 Aug 2015 | 5 Apr 2017 | 30 Aug 2017 |
| 242 | newenglandsc.com | Network Solutions, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 243 | newenglandcprassociates.com | FastDomain Inc. | 26 Oct 2014 | 26 Oct 2017 | 26 Oct 2018 |
| 244 | newenglandchampionsleague.com | - | 12 Apr 2024 | 2 May 2025 | 12 Apr 2025 |
| 245 | newenglandparks.org | NameCheap, Inc. | 27 Aug 2021 | 6 Jun 2025 | 27 Aug 2025 |
| 246 | newenglandexpress.com | GoDaddy.com, LLC | 3 Jun 2000 | 4 Jun 2025 | 3 Jun 2026 |
| 247 | newenglandtravelingmarketplace.com | GoDaddy.com, LLC | 3 Jun 2012 | 4 Jun 2015 | 3 Jun 2016 |
| 248 | newenglandgc.com | Google, Inc. | 19 May 2019 | 8 Jun 2025 | 19 May 2025 |
| 249 | newenglandwolfpack.com | GoDaddy.com, LLC | 22 May 2012 | 23 May 2015 | 22 May 2016 |
| 250 | newenglandbackyard.com | Dynadot, LLC | 9 Feb 2016 | 30 Jul 2024 | 9 Feb 2026 |
| 251 | newenglandbusinessforsale.com | GoDaddy.com, LLC | 22 May 2009 | 23 May 2015 | 22 May 2016 |
| 252 | newenglandcanna.com | register.com, Inc. | 20 Nov 2016 | 9 Nov 2017 | 20 Nov 2018 |
| 253 | newenglandhoops.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Apr 2024 | 11 Apr 2025 | 27 Apr 2026 |
| 254 | newenglandrivercottage.com | Network Solutions, LLC | 28 Oct 2014 | 28 Sep 2024 | 28 Oct 2026 |
| 255 | newenglandbikes.com | GoDaddy.com, LLC | 17 Jan 2025 | 17 Jan 2025 | 17 Jan 2028 |
| 256 | newenglandadditive.com | 1&1 Internet AG | 27 Oct 2014 | 28 Oct 2016 | 27 Oct 2017 |
| 257 | newengland3d.com | Launchpad, Inc. | 8 Feb 2019 | 24 Jan 2025 | 8 Feb 2026 |
| 258 | newenglandarborsstore.com | GoDaddy.com, LLC | 20 Jul 2020 | 20 Jul 2020 | 20 Jul 2021 |
| 259 | newenglandeventdj.com | - | 11 Mar 2023 | 13 May 2024 | 11 Mar 2024 |
| 260 | newenglandcities.com | CloudFlare, Inc. | 9 Dec 2022 | 3 Oct 2023 | 9 Dec 2025 |
| 261 | newenglandresorts.org | GoDaddy.com, LLC | 14 Mar 2014 | 27 Feb 2025 | 14 Mar 2026 |
| 262 | newenglandleague.com | eNom, Inc. | 28 Oct 2009 | 25 Oct 2024 | 28 Oct 2025 |
| 263 | newenglandtherapeutic.com | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 19 Dec 2021 | 19 Dec 2021 | 19 Dec 2022 |
| 264 | newenglandofficesolutions.com | Launchpad, Inc. | 12 Jun 2017 | 12 Aug 2017 | 12 Jun 2018 |
| 265 | newenglandschoolofphotography.com | eNom, Inc. | 5 Nov 2010 | 21 Dec 2016 | 5 Nov 2017 |
| 266 | newenglandschoolofacupuncture.com | eNom, Inc. | 8 Nov 2010 | 21 Dec 2016 | 8 Nov 2017 |
| 267 | newenglandfinishing.com | eNom, Inc. | 6 Nov 2010 | 21 Dec 2016 | 6 Nov 2017 |
| 268 | newenglandconference.com | eNom, Inc. | 29 Sep 2009 | 26 Sep 2024 | 29 Sep 2025 |
| 269 | newenglandhydroponics.com | Namesilo, LLC | 9 Oct 2014 | 1 Oct 2024 | 9 Oct 2025 |
| 270 | newenglandacademy.com | eNom, Inc. | 22 Jan 2007 | 30 Jan 2025 | 22 Jan 2026 |
| 271 | newenglandcarpentry.com | eNom, Inc. | 20 Dec 2010 | 11 Dec 2024 | 20 Dec 2025 |
| 272 | newenglandcharters.com | eNom, Inc. | 10 May 2009 | 21 May 2025 | 10 May 2026 |
| 273 | newenglandconsultinggroup.com | GoDaddy.com, LLC | 27 May 2021 | 27 May 2021 | 27 May 2022 |
| 274 | newenglandhousing.com | eNom, Inc. | 5 Jan 2012 | 10 Jan 2025 | 5 Jan 2026 |
| 275 | newenglandlawyers.com | eNom, Inc. | 12 Sep 2000 | 13 Sep 2024 | 12 Sep 2025 |
| 276 | newenglandlumber.com | eNom, Inc. | 9 Sep 2010 | 6 Sep 2024 | 9 Sep 2025 |
| 277 | newenglandmassage.com | eNom, Inc. | 1 Dec 2009 | 21 Dec 2016 | 1 Dec 2017 |
| 278 | newenglandmutuallife.com | eNom, Inc. | 19 Sep 2009 | 21 Sep 2024 | 19 Sep 2025 |
| 279 | newenglandpaint.com | eNom, Inc. | 13 Jan 2010 | 24 Jan 2025 | 13 Jan 2026 |
| 280 | newenglandplumbing.com | eNom, Inc. | 26 Jul 2007 | 27 Jul 2024 | 26 Jul 2025 |
| 281 | newenglandsportsnetwork.com | eNom, Inc. | 6 Jul 2011 | 18 Jul 2017 | 6 Jul 2018 |
| 282 | newenglandtitle.com | Google, Inc. | 26 Jul 2009 | 11 Jul 2024 | 26 Jul 2025 |
| 283 | newenglandwoodwork.com | NameKing.com Inc. | 5 Jan 2023 | 9 Mar 2025 | 5 Jan 2026 |
| 284 | newenglandballet.com | eNom, Inc. | 26 Sep 2007 | 21 Sep 2024 | 26 Sep 2025 |
| 285 | newenglandagent.com | Wix.com Ltd. | 15 Jan 2025 | 15 Jan 2025 | 15 Jan 2026 |
| 286 | newenglandbrokers.com | eNom, Inc. | 23 May 2011 | 2 Jun 2025 | 23 May 2026 |
| 287 | newenglandbusinessmedia.com | eNom, Inc. | 23 Sep 2010 | 21 Dec 2016 | 23 Sep 2017 |
| 288 | newenglandbusinessservices.com | eNom, Inc. | 17 Apr 2012 | 10 May 2017 | 17 Apr 2018 |
| 289 | newenglandcallcenter.com | eNom, Inc. | 27 May 2011 | 25 May 2017 | 27 May 2018 |
| 290 | newenglandcatering.com | eNom, Inc. | 28 Apr 2010 | 6 May 2025 | 28 Apr 2026 |
| 291 | newenglandcatholic.com | eNom, Inc. | 28 Jan 2012 | 6 Feb 2025 | 28 Jan 2026 |
| 292 | newenglandchimney.com | eNom, Inc. | 29 Mar 2010 | 20 Mar 2025 | 29 Mar 2026 |
| 293 | newenglandclinic.com | eNom, Inc. | 22 Feb 2011 | 8 Mar 2025 | 22 Feb 2026 |
| 294 | newenglandcoastal.com | GoDaddy.com, LLC | 22 Jun 2020 | 17 Dec 2024 | 22 Jun 2025 |
| 295 | newenglandconsulting.com | eNom, Inc. | 20 Jan 1999 | 30 Jan 2025 | 20 Jan 2026 |
| 296 | newenglandequipment.com | eNom, Inc. | 25 Jun 2011 | 26 Jun 2024 | 25 Jun 2025 |
| 297 | newenglandfish.com | eNom, Inc. | 14 Apr 1999 | 17 Apr 2025 | 14 Apr 2026 |
| 298 | newenglandinternational.com | eNom, Inc. | 4 Mar 2011 | 8 Mar 2017 | 4 Mar 2018 |
| 299 | newenglandjewelers.com | TurnCommerce, Inc. DBA NameBright.com | 18 Jan 2021 | 26 Aug 2021 | 18 Jan 2026 |
| 300 | newenglandlivery.com | eNom, Inc. | 23 Jun 2008 | 27 Jun 2017 | 23 Jun 2018 |
| 301 | newenglandmediation.com | eNom, Inc. | 21 Jan 2011 | 6 Feb 2025 | 21 Jan 2026 |
| 302 | newenglandrally.com | TurnCommerce, Inc. DBA NameBright.com | 13 Sep 2021 | 14 Sep 2021 | 13 Sep 2025 |
| 303 | newenglandwinter.com | GoDaddy.com, LLC | 17 Apr 2025 | 17 Apr 2025 | 17 Apr 2028 |
| 304 | newenglandchocolate.com | GoDaddy.com, LLC | 15 Jul 2024 | 15 Jul 2024 | 15 Jul 2025 |
| 305 | newenglandchristian.com | eNom, Inc. | 27 Jul 2010 | 27 Jul 2024 | 27 Jul 2025 |
| 306 | newenglandcredit.com | eNom, Inc. | 30 Apr 2010 | 6 May 2025 | 30 Apr 2026 |
| 307 | newenglandculinaryschool.com | eNom, Inc. | 17 Apr 2012 | 10 May 2017 | 17 Apr 2018 |
| 308 | newenglandcustom.com | eNom, Inc. | 27 May 2009 | 28 May 2025 | 27 May 2026 |
| 309 | newenglanddiscount.com | eNom, Inc. | 7 Jun 2012 | 20 Jun 2017 | 7 Jun 2018 |
| 310 | newenglanddrywall.com | - | 29 Nov 2020 | 29 Dec 2024 | 29 Nov 2025 |
| 311 | newenglandengraving.com | eNom, Inc. | 17 Apr 2012 | 22 Apr 2025 | 17 Apr 2026 |
| 312 | newenglandenvironmental.com | GoDaddy.com, LLC | 2 Feb 2024 | 16 Mar 2025 | 2 Feb 2025 |
| 313 | newenglandexteriors.com | eNom, Inc. | 1 Sep 1999 | 31 Aug 2024 | 1 Sep 2025 |
| 314 | newenglandfinancialgroup.com | eNom, Inc. | 15 Jun 2011 | 16 Jun 2025 | 15 Jun 2025 |
| 315 | newenglandfinancialservices.com | Go Montenegro Domains, LLC | 6 Jan 2023 | 7 Jan 2025 | 6 Jan 2026 |
| 316 | newenglandhomeinspect.com | eNom, Inc. | 29 Apr 2009 | 11 May 2017 | 29 Apr 2018 |
| 317 | newenglandinsuranceservices.com | eNom, Inc. | 5 Nov 2011 | 2 Nov 2024 | 5 Nov 2025 |
| 318 | newenglandmartialarts.com | eNom, Inc. | 28 Nov 2011 | 22 Nov 2024 | 28 Nov 2025 |
| 319 | newenglandmed.com | eNom, Inc. | 16 Aug 2011 | 20 Aug 2024 | 16 Aug 2025 |
| 320 | newenglandmedicalinsurance.com | eNom, Inc. | 8 Nov 2011 | 21 Dec 2016 | 8 Nov 2017 |
| 321 | newenglandmetal.com | eNom, Inc. | 29 Jan 2011 | 6 Feb 2025 | 29 Jan 2026 |
| 322 | newenglandmortgagegroup.com | eNom, Inc. | 15 Jan 2011 | 23 Jan 2017 | 21 Jan 2018 |
| 323 | newenglandmusicfestival.com | eNom, Inc. | 8 Oct 2010 | 21 Dec 2016 | 8 Oct 2017 |
| 324 | newenglandportable.com | eNom, Inc. | 6 Jun 2011 | 13 Jun 2025 | 6 Jun 2026 |
| 325 | newenglandrescue.com | eNom, Inc. | 26 Jan 2010 | 6 Feb 2025 | 26 Jan 2026 |
| 326 | newenglandsound.com | FastDomain Inc. | 7 Oct 2020 | 22 Sep 2024 | 7 Oct 2025 |
| 327 | newenglandspecialty.com | eNom, Inc. | 30 May 2008 | 25 May 2017 | 30 May 2018 |
| 328 | newenglandtechnologies.com | eNom, Inc. | 24 Apr 2012 | 1 May 2025 | 24 Apr 2026 |
| 329 | newenglandtheater.com | eNom, Inc. | 24 Apr 2012 | 11 May 2017 | 24 Apr 2018 |
| 330 | newenglandtimber.com | eNom, Inc. | 9 Jul 2010 | 12 Jul 2024 | 9 Jul 2025 |
| 331 | newenglandtradition.com | Key-Systems GmbH | 30 Oct 2024 | 30 Jan 2025 | 30 Oct 2025 |
| 332 | newenglandtransport.com | Hostinger, UAB | 10 Nov 2023 | 14 Oct 2024 | 10 Nov 2025 |
| 333 | newenglandtravelservice.com | eNom, Inc. | 17 Apr 2012 | 10 May 2017 | 17 Apr 2018 |
| 334 | newenglandtruck.com | eNom, Inc. | 11 Oct 2004 | 10 Oct 2024 | 11 Oct 2025 |
| 335 | newenglandwindow.com | eNom, Inc. | 22 May 2011 | 26 May 2025 | 22 May 2026 |
| 336 | newenglandhomerenovations.com | GoDaddy.com, LLC | 15 Aug 2021 | 15 Aug 2021 | 15 Aug 2022 |
| 337 | newenglandeventplanners.com | Squarespace Domains LLC | 27 Nov 2024 | 12 Dec 2024 | 27 Nov 2025 |
| 338 | newenglandfirearm.com | GoDaddy.com, LLC | 4 Nov 2004 | 25 Oct 2014 | 4 Nov 2015 |
| 339 | newenglandprephockey.org | GoDaddy.com, LLC | 5 Nov 2002 | 16 Oct 2016 | 5 Nov 2017 |
| 340 | newenglandtechsale.com | GoDaddy.com, LLC | 28 Oct 2014 | 29 Oct 2016 | 28 Oct 2018 |
| 341 | newenglandsongwritersfestival.com | GoDaddy.com, LLC | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2016 |
| 342 | newenglandseakayaking.com | FastDomain Inc. | 28 Oct 2014 | 13 Oct 2024 | 28 Oct 2025 |
| 343 | newenglandpubs.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2017 |
| 344 | newenglandoceanpaddler.com | FastDomain Inc. | 28 Oct 2014 | 13 Oct 2024 | 28 Oct 2025 |
| 345 | newenglandkayakclub.com | FastDomain Inc. | 28 Oct 2014 | 13 Oct 2024 | 28 Oct 2025 |
| 346 | newenglandbackoads.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 347 | newenglandtattoo.com | GoDaddy.com, LLC | 11 Mar 2019 | 12 Mar 2025 | 11 Mar 2026 |
| 348 | newenglanddentalimplants.com | GoDaddy.com, LLC | 31 Jan 2017 | 1 Oct 2022 | 31 Jan 2027 |
| 349 | newenglandcandlebarn.com | GoDaddy.com, LLC | 11 Jan 2008 | 1 May 2015 | 11 Jan 2016 |
| 350 | newenglandbeads.com | Key-Systems GmbH | 11 Sep 2011 | 17 Feb 2025 | 11 Sep 2025 |
| 351 | newengland-style.com | GoDaddy.com, LLC | 6 Dec 2010 | 16 Nov 2024 | 6 Dec 2025 |
| 352 | newenglandphotography.com | GoDaddy.com, LLC | 5 Sep 2001 | 25 Aug 2024 | 5 Sep 2025 |
| 353 | newenglandmeetup.com | GoDaddy.com, LLC | 10 Dec 2007 | 11 Dec 2024 | 10 Dec 2025 |
| 354 | newenglandautobody.com | eNom, Inc. | 10 Jun 2008 | 18 Jun 2025 | 10 Jun 2026 |
| 355 | newenglandcarwash.com | GoDaddy.com, LLC | 27 Apr 2023 | 8 Jun 2025 | 27 Apr 2025 |
| 356 | newenglandconnection.com | eNom, Inc. | 10 Feb 2004 | 22 Feb 2025 | 10 Feb 2026 |
| 357 | newenglandpropertymanagement.com | GoDaddy.com, LLC | 17 Jul 2023 | 8 Mar 2025 | 17 Jul 2025 |
| 358 | newenglandwheel.com | - | 22 Jan 2023 | 23 Jan 2024 | 22 Jan 2025 |
| 359 | newenglandcable.com | eNom, Inc. | 8 Jan 2012 | 18 Jan 2025 | 8 Jan 2026 |
| 360 | newenglandit.com | NameCheap, Inc. | 4 Jan 2012 | 5 Dec 2024 | 4 Jan 2026 |
| 361 | newenglandchampionsleague.us | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 26 Oct 2015 |
| 362 | newenglandpatriotshistory.com | GoDaddy.com, LLC | 29 Nov 2017 | 29 Nov 2017 | 29 Nov 2018 |
| 363 | newenglandnst.org | GoDaddy.com, LLC | 24 Feb 2009 | 9 Feb 2025 | 24 Feb 2026 |
| 364 | newenglandsports.org | GoDaddy.com, LLC | 2 Mar 2014 | 17 Jan 2015 | 2 Mar 2016 |
| 365 | newengland-nutrition.com | GoDaddy.com, LLC | 12 Aug 2013 | 2 May 2015 | 12 Aug 2015 |
| 366 | newenglandcedarhomes.com | Names On The Drop LLC | 9 Jun 2023 | 23 Jul 2024 | 9 Jun 2024 |
| 367 | newenglandpawn.com | Tucows Domains Inc. | 9 Jun 2024 | 13 Jun 2025 | 9 Jun 2026 |
| 368 | newenglandcollection.com | GoDaddy.com, LLC | 13 Mar 2002 | 14 Mar 2025 | 13 Mar 2026 |
| 369 | newenglandpatriotsgameday.com | GoDaddy.com, LLC | 19 Jul 2011 | 27 Apr 2015 | 19 Jul 2015 |
| 370 | newenglandphotogallery.com | GoDaddy.com, LLC | 8 Jul 2007 | 7 Jan 2015 | 8 Jul 2015 |
| 371 | newenglandagents.com | NameCheap, Inc. | 30 Mar 2023 | 11 May 2024 | 30 Mar 2024 |
| 372 | newenglandproducecouncil.com | GoDaddy.com, LLC | 29 Oct 2014 | 28 Oct 2024 | 29 Oct 2029 |
| 373 | newenglandmeadows.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 374 | newenglandjewelry.com | GoDaddy.com, LLC | 29 Oct 2014 | 5 Nov 2024 | 29 Oct 2026 |
| 375 | newenglandgenealogist.com | GoDaddy.com, LLC | 8 Sep 2022 | 20 Oct 2024 | 8 Sep 2024 |
| 376 | newenglanddeskco.com | eNom, Inc. | 29 Oct 2014 | 30 Sep 2016 | 29 Oct 2017 |
| 377 | newenglandasterisks.com | GoDaddy.com, LLC | 23 Jan 2015 | 17 Apr 2015 | 23 Jan 2016 |
| 378 | newenglandweddingart.com | GoDaddy.com, LLC | 27 Dec 2011 | 27 Dec 2011 | 27 Dec 2019 |
| 379 | newenglandhomesforsale.com | NameKing.com Inc. | 16 Mar 2000 | 19 Mar 2025 | 16 Mar 2026 |
| 380 | newenglandpromodeling.com | Tucows Domains Inc. | 30 Sep 2021 | 30 Sep 2021 | 30 Sep 2022 |
| 381 | newenglandapothecary.org | GoDaddy.com, LLC | 25 Aug 2013 | 26 Aug 2014 | 25 Aug 2015 |
| 382 | newenglandwellness.org | GoDaddy.com, LLC | 30 Jan 2024 | 2 Sep 2024 | 30 Jan 2026 |
| 383 | newenglandgreenrush.com | GoDaddy.com, LLC | 16 Mar 2014 | 24 Mar 2015 | 16 Mar 2016 |
| 384 | newenglandedibles.com | GoDaddy.com, LLC | 11 Jun 2022 | 23 Aug 2024 | 11 Jun 2024 |
| 385 | newenglandhashoil.com | GoDaddy.com, LLC | 9 Feb 2014 | 13 Oct 2014 | 9 Feb 2016 |
| 386 | newenglandmedicinals.com | Hosting Concepts B.V. dba Openprovider | 1 Jan 2022 | 2 Jan 2022 | 1 Jan 2023 |
| 387 | newenglandshatter.com | GoDaddy.com, LLC | 10 Mar 2014 | 13 Oct 2014 | 10 Mar 2016 |
| 388 | newenglandglitz.com | GoDaddy.com, LLC | 5 Oct 2012 | 19 Apr 2015 | 5 Oct 2015 |
| 389 | newenglandcamps.com | GoDaddy.com, LLC | 24 Apr 2000 | 29 Mar 2025 | 24 Apr 2026 |
| 390 | newenglanddentalmarketing.com | GoDaddy.com, LLC | 20 Feb 2013 | 30 Apr 2015 | 20 Feb 2016 |
| 391 | newengland3dprinting.com | GoDaddy.com, LLC | 9 Oct 2013 | 19 Apr 2015 | 9 Oct 2015 |
| 392 | newenglandbackoads.net | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 393 | newenglandautotalk.com | GoDaddy.com, LLC | 21 Apr 2012 | 29 Apr 2015 | 21 Apr 2017 |
| 394 | newenglandslots.com | Google, Inc. | 21 Feb 2013 | 6 Feb 2025 | 21 Feb 2026 |
| 395 | newenglandsolutions.com | eNom, Inc. | 10 Aug 2013 | 10 Aug 2024 | 10 Aug 2025 |
| 396 | newenglandsportsapp.com | GoDaddy.com, LLC | 1 Apr 2010 | 22 Apr 2015 | 1 Apr 2016 |
| 397 | newenglandsportsteamsapp.com | GoDaddy.com, LLC | 1 Apr 2010 | 22 Apr 2015 | 1 Apr 2016 |
| 398 | newenglandcheesemaking.com | Fabulous.com Pty Ltd. | 2 Oct 2005 | 12 Sep 2024 | 2 Oct 2025 |
| 399 | newenglandtreatmentaccess.com | GoDaddy.com, LLC | 23 Sep 2019 | 23 Sep 2019 | 23 Sep 2020 |
| 400 | newenglandphysician.com | eNom, Inc. | 7 Sep 2013 | 6 Sep 2024 | 7 Sep 2025 |
| 401 | newenglandair.com | eNom, Inc. | 4 Nov 2001 | 2 Nov 2024 | 4 Nov 2025 |
| 402 | newenglandsolarthermal.com | Tucows Domains Inc. | 27 Oct 2013 | 31 Oct 2014 | 27 Oct 2015 |
| 403 | newenglandfenceri.com | register.com, Inc. | 30 Oct 2014 | 31 Oct 2024 | 30 Oct 2025 |
| 404 | newenglandpats.com | GoDaddy.com, LLC | 30 Mar 2005 | 10 Mar 2025 | 30 Mar 2026 |
| 405 | newenglandflingz.net | AtlanticDomains, LLC | 10 Nov 2019 | 12 Nov 2019 | 10 Nov 2020 |
| 406 | newenglandloghomes.com | GoDaddy.com, LLC | 8 Nov 2001 | 28 Feb 2025 | 8 Nov 2025 |
| 407 | newenglandlawblog.com | Tucows Domains Inc. | 10 Jul 2020 | 8 Oct 2020 | 10 Jul 2021 |
| 408 | newenglandlawboston.com | GoDaddy.com, LLC | 4 Jul 2011 | 4 Jul 2015 | 4 Jul 2016 |
| 409 | newenglandskiandsportrentals.com | GoDaddy.com, LLC | 12 Sep 2011 | 27 Apr 2015 | 12 Sep 2015 |
| 410 | newenglandmeadows.net | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 411 | newenglandmade.net | eNom, Inc. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 412 | newenglandcarpetcleaning.com | - | 3 Jul 2025 | 3 Jul 2025 | 3 Jul 2026 |
| 413 | newenglandbankruptcyattorneys.com | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 414 | newenglanddivorceattorneys.com | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 415 | newenglandprobateattorneys.com | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 416 | newenglandimmigrationattorney.com | GoDaddy.com, LLC | 8 Apr 2015 | 13 Apr 2015 | 8 Apr 2016 |
| 417 | newenglandpod.com | GoDaddy.com, LLC | 30 Jul 2004 | 31 Jul 2014 | 30 Jul 2015 |
| 418 | newenglandexpressions.com | GoDaddy.com, LLC | 31 Jul 2007 | 31 Jul 2024 | 31 Jul 2026 |
| 419 | newenglandduilawyer.com | Name.com, Inc. | 4 Aug 2011 | 6 Aug 2018 | 4 Aug 2018 |
| 420 | newenglandrealestateguild.com | GoDaddy.com, LLC | 22 May 2013 | 22 May 2013 | 22 May 2018 |
| 421 | newenglandplumbingandheating.com | GoDaddy.com, LLC | 8 Jul 2007 | 9 Jul 2024 | 8 Jul 2026 |
| 422 | newenglandchiropractic.com | GoDaddy.com, LLC | 18 Jan 2004 | 28 Feb 2025 | 18 Jan 2026 |
| 423 | newenglandrealestate.org | GoDaddy.com, LLC | 18 Jan 2017 | 23 Jan 2018 | 18 Jan 2019 |
| 424 | newenglandtileinstallation.com | GoDaddy.com, LLC | 31 Oct 2014 | 1 Nov 2018 | 31 Oct 2019 |
| 425 | newenglandprepstars.com | Amazon Registrar, Inc. | 17 Jan 2016 | 17 Jan 2016 | 17 Jan 2017 |
| 426 | newenglandbiketours.com | Squarespace Domains LLC | 5 Nov 2023 | 22 Oct 2024 | 5 Nov 2025 |
| 427 | newenglandcommercialproperties.com | GoDaddy.com, LLC | 20 Jul 2013 | 8 Jun 2024 | 20 Jul 2024 |
| 428 | newenglandwines.com | TurnCommerce, Inc. DBA NameBright.com | 6 Feb 2010 | 9 Jan 2025 | 6 Feb 2026 |
| 429 | newenglandcraftfairs.com | Tucows Domains Inc. | 29 Feb 2004 | 16 Jan 2025 | 28 Feb 2026 |
| 430 | newenglandauction.com | GoDaddy.com, LLC | 19 Feb 2010 | 2 Apr 2025 | 19 Feb 2026 |
| 431 | newenglandchimneysupply.com | Amazon Registrar, Inc. | 25 Mar 2010 | 18 Feb 2025 | 25 Mar 2026 |
| 432 | newenglandhunters.com | GoDaddy.com, LLC | 13 Apr 2008 | 14 Apr 2025 | 13 Apr 2026 |
| 433 | newenglandlectureship.org | GoDaddy.com, LLC | 10 Jul 2012 | 28 Jun 2024 | 10 Jul 2025 |
| 434 | newenglandcarinsurance.com | GoDaddy.com, LLC | 27 Sep 2009 | 9 Dec 2024 | 27 Sep 2024 |
| 435 | newenglandphc.com | Amazon Registrar, Inc. | 3 Feb 2014 | 19 Apr 2025 | 3 Feb 2025 |
| 436 | newenglandmortgages.com | GoDaddy.com, LLC | 23 Jun 1999 | 28 Feb 2025 | 23 Jun 2025 |
| 437 | newenglandlodging.com | GoDaddy.com, LLC | 24 Aug 2001 | 19 Jun 2024 | 24 Aug 2025 |
| 438 | newenglandconstructioninc.com | GoDaddy.com, LLC | 12 Sep 2019 | 23 Oct 2024 | 12 Sep 2024 |
| 439 | newenglandappliance.com | GoDaddy.com, LLC | 7 Nov 2006 | 11 Sep 2022 | 7 Nov 2025 |
| 440 | newenglandsteam.org | GoDaddy.com, LLC | 4 Jul 2013 | 18 Aug 2024 | 4 Jul 2025 |
| 441 | newenglandgreetings.com | Google, Inc. | 16 Jul 2021 | 1 Jul 2024 | 16 Jul 2025 |
| 442 | newenglandgolfcars.com | register.com, Inc. | 30 Nov 2001 | 28 Jul 2023 | 30 Nov 2028 |
| 443 | newenglandwga.org | Network Solutions, LLC | 16 May 2008 | 22 Mar 2023 | 16 May 2028 |
| 444 | newenglandmobility.net | Beijing Lanhai Jiye Technology Co., Ltd | 30 Nov 2023 | 1 Feb 2025 | 30 Nov 2024 |
| 445 | newenglandoil.org | GoDaddy.com, LLC | 26 Mar 2009 | 10 May 2025 | 26 Mar 2026 |
| 446 | newenglandfanfest.com | GoDaddy.com, LLC | 9 May 2023 | 10 May 2025 | 9 May 2026 |
| 447 | newenglandfarmlandfinder.org | Wild West Domains, LLC | 9 Feb 2012 | 10 Jun 2024 | 9 Feb 2027 |
| 448 | newenglandamc.com | - | 29 Aug 2021 | 31 Aug 2021 | 29 Aug 2022 |
| 449 | newenglandsbestroof.com | CloudFlare, Inc. | 1 Dec 2003 | 9 Jan 2025 | 1 Dec 2026 |
| 450 | newenglandbassethoundrescue.org | Network Solutions, LLC | 2 Jun 2001 | 7 Apr 2021 | 2 Jun 2026 |
| 451 | newenglandcabins.com | GoDaddy.com, LLC | 12 May 2017 | 13 May 2025 | 12 May 2027 |
| 452 | newenglandballproject.com | GoDaddy.com, LLC | 19 Jul 2008 | 5 Sep 2022 | 19 Jul 2025 |
| 453 | newenglandclassicalacademy.com | GoDaddy.com, LLC | 1 Feb 2010 | 15 Mar 2025 | 1 Feb 2026 |
| 454 | newenglandpatiots.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Nov 2005 | 14 Oct 2016 | 16 Nov 2017 |
| 455 | newenglandnsw.com | NameCheap, Inc. | 24 Feb 2023 | 25 Jan 2025 | 24 Feb 2026 |
| 456 | newenglandlightingsupply.com | GoDaddy.com, LLC | 3 Oct 2014 | 21 Apr 2015 | 3 Oct 2015 |
| 457 | newenglandrush.com | GoDaddy.com, LLC | 20 Jan 2013 | 21 Jan 2024 | 20 Jan 2026 |
| 458 | newenglandjournalofbusiness.com | GoDaddy.com, LLC | 17 Sep 2010 | 24 Apr 2015 | 17 Sep 2015 |
| 459 | newenglandcadillac.com | Network Solutions, LLC | 25 Jun 2006 | 8 Jun 2017 | 24 Jun 2018 |
| 460 | newenglandterrierclub.org | Tucows Domains Inc. | 13 Oct 2006 | 12 Oct 2024 | 13 Oct 2025 |
| 461 | newenglandcremation.com | Wild West Domains, LLC | 24 Nov 2008 | 25 Nov 2024 | 24 Nov 2025 |
| 462 | newenglandsupermegafest.com | GoDaddy.com, LLC | 23 Jun 2014 | 10 Jun 2025 | 23 Jun 2025 |
| 463 | newenglandblues.com | GoDaddy.com, LLC | 19 Jun 1999 | 30 May 2025 | 19 Jun 2026 |
| 464 | newenglandinc.com | GoDaddy.com, LLC | 1 Nov 2014 | 2 Nov 2024 | 1 Nov 2025 |
| 465 | newenglandcollegeofoptometry.com | Fabulous.com Pty Ltd. | 11 Oct 2006 | 13 Sep 2017 | 11 Oct 2018 |
| 466 | newenglandpremiere.com | Wild West Domains, LLC | 26 Jan 2012 | 27 Jan 2025 | 26 Jan 2026 |
| 467 | newenglandnurseries.com | GoDaddy.com, LLC | 26 Aug 1998 | 13 Oct 2022 | 25 Aug 2026 |
| 468 | newenglandriders.org | GoDaddy.com, LLC | 5 Oct 1999 | 6 Oct 2024 | 5 Oct 2026 |
| 469 | newenglandtechniclinstitute.com | GMO Internet Inc. | 26 Oct 2016 | 31 Oct 2017 | 26 Oct 2018 |
| 470 | newenglandarttiles.com | GoDaddy.com, LLC | 7 Jan 2019 | 7 Jan 2019 | 7 Jan 2020 |
| 471 | newenglandfamilychiropractic.com | GoDaddy.com, LLC | 18 Mar 2015 | 19 Mar 2015 | 18 Mar 2016 |
| 472 | newenglandgas.com | DomainGetter LLC | 27 Feb 2017 | 28 Feb 2017 | 27 Feb 2018 |
| 473 | newenglandclockshop.com | - | 7 Oct 2022 | 13 Nov 2024 | 7 Oct 2025 |
| 474 | newenglandchocolatecompany.com | Nordreg AB | 17 Nov 2002 | 8 Nov 2024 | 17 Nov 2025 |
| 475 | newenglandmountainsports.com | 1&1 Internet AG | 4 Jul 2025 | 4 Jul 2025 | 4 Jul 2026 |
| 476 | newenglandfalconry.com | GoDaddy.com, LLC | 2 Jan 2007 | 4 Sep 2022 | 2 Jan 2026 |
| 477 | newenglandgaragedoors.com | GoDaddy.com, LLC | 4 Dec 2009 | 5 Dec 2024 | 4 Dec 2027 |
| 478 | newenglandfirearms.com | Uniregistrar Corp | 9 Sep 2002 | 21 Aug 2024 | 9 Sep 2025 |
| 479 | newenglandkendalls.com | GoDaddy.com, LLC | 20 Feb 2022 | 3 Apr 2023 | 20 Feb 2023 |
| 480 | newenglandcopperart.com | GoDaddy.com, LLC | 3 Mar 2015 | 17 Jun 2015 | 3 Mar 2016 |
| 481 | newenglandcopper.com | GoDaddy.com, LLC | 3 Mar 2015 | 17 Jun 2015 | 3 Mar 2016 |
| 482 | newenglandmedicalchannel.com | GoDaddy.com, LLC | 4 Jan 2011 | 29 Dec 2014 | 4 Jan 2016 |
| 483 | newenglandadjusters.com | eNom, Inc. | 6 Jan 2010 | 30 Dec 2024 | 6 Jan 2026 |
| 484 | newenglandtractor.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Apr 2002 | 8 Feb 2025 | 5 Apr 2034 |
| 485 | newenglandauctioneersusa.com | GoDaddy.com, LLC | 5 Sep 2008 | 18 Apr 2015 | 5 Sep 2015 |
| 486 | newenglandcyclocross.com | Tucows Domains Inc. | 23 Jun 2007 | 27 Jun 2019 | 23 Jun 2019 |
| 487 | newenglandnews.com | GoDaddy.com, LLC | 27 Apr 1997 | 29 Mar 2025 | 28 Apr 2026 |
| 488 | newenglandcondos.com | Dynadot, LLC | 20 Dec 2015 | 12 Jan 2017 | 20 Dec 2017 |
| 489 | newenglandboatshow.com | CloudFlare, Inc. | 4 Apr 2003 | 5 Dec 2024 | 4 Apr 2026 |
| 490 | newenglandtrailrunner.com | Google, Inc. | 22 May 2020 | 22 May 2023 | 22 May 2024 |
| 491 | newenglandsubs.com | - | 22 May 2022 | 23 May 2023 | 22 May 2024 |
| 492 | newenglandoceanodyssey.org | GoDaddy.com, LLC | 21 Apr 2011 | 5 Jun 2025 | 21 Apr 2026 |
| 493 | newenglandid.com | GoDaddy.com, LLC | 6 Apr 2023 | 18 Jun 2025 | 6 Apr 2025 |
| 494 | newenglandlaminating.com | Google, Inc. | 21 Mar 2023 | 20 Apr 2024 | 21 Mar 2024 |
| 495 | newenglandappliances.com | - | 26 Jan 2023 | 20 Feb 2025 | 26 Jan 2026 |
| 496 | newenglandgreenhomes.com | Nordreg AB | 12 Jun 2025 | 12 Jun 2025 | 12 Jun 2026 |
| 497 | newenglandbells.com | TLDs LLC dba SRSplus | 23 Jul 2007 | 24 Jul 2024 | 23 Jul 2025 |
| 498 | newenglandcommercialproperty.com | GoDaddy.com, LLC | 4 Jun 2009 | 28 Aug 2024 | 4 Jun 2026 |
| 499 | newenglandbackpacker.com | GoDaddy.com, LLC | 17 Mar 2000 | 18 Mar 2025 | 17 Mar 2026 |
| 500 | newenglandrealestate.tv | Name.com, Inc. | 30 Apr 2011 | 11 Jun 2015 | 30 Apr 2016 |
| 501 | newenglandforum.com | Epik Inc. | 23 Jan 2021 | 22 Feb 2025 | 23 Jan 2025 |
| 502 | newenglandmom.com | GoDaddy.com, LLC | 22 Oct 2024 | 22 Oct 2024 | 22 Oct 2027 |
| 503 | newenglandperformanceproducts.com | FastDomain Inc. | 12 Dec 2011 | 21 Jan 2025 | 12 Dec 2024 |
| 504 | newenglandcabinetry.net | GoDaddy.com, LLC | 5 Jul 2016 | 5 Jul 2016 | 5 Jul 2017 |
| 505 | newenglandndgoats.org | Dynadot, LLC | 13 Jul 2015 | 30 Jun 2017 | 13 Jul 2018 |
| 506 | newenglandsafetytraining.com | DropCatch.com 528 LLC | 9 Jul 2015 | 10 Jul 2017 | 9 Jul 2018 |
| 507 | newenglandtruckmaster.com | EuroDNS S.A. | 4 Apr 2005 | 10 Oct 2014 | 3 Oct 2015 |
| 508 | newenglandcheesesupply.com | Moniker Online Services LLC | 18 Oct 2005 | 4 Nov 2014 | 18 Oct 2015 |
| 509 | newenglandhomefinder.com | GoDaddy.com, LLC | 17 Aug 2009 | 30 Jul 2024 | 17 Aug 2025 |
| 510 | newenglandfertilizer.com | GoDaddy.com, LLC | 11 Dec 2011 | 12 Dec 2024 | 11 Dec 2025 |
| 511 | newenglandfertilizing.com | GoDaddy.com, LLC | 9 Dec 2011 | 10 Dec 2014 | 9 Dec 2015 |
| 512 | newenglandturbine.com | GoDaddy.com, LLC | 21 Dec 2007 | 22 Dec 2024 | 21 Dec 2025 |
| 513 | newenglandvodka.com | GoDaddy.com, LLC | 16 Oct 2007 | 17 Oct 2024 | 16 Oct 2026 |
| 514 | newenglandcontractors.com | GoDaddy.com, LLC | 6 Oct 2001 | 8 Jun 2025 | 6 Oct 2025 |
| 515 | newenglandbeernews.com | GoDaddy.com, LLC | 10 Oct 2008 | 19 Apr 2015 | 10 Oct 2015 |
| 516 | newenglandsportsfan.com | DNSPod, Inc. | 20 Dec 2021 | 21 Dec 2021 | 20 Dec 2022 |
| 517 | newenglandnursery.com | GoDaddy.com, LLC | 13 Feb 2003 | 28 Feb 2025 | 13 Feb 2026 |
| 518 | newenglandvapes.com | Tucows Domains Inc. | 21 Mar 2018 | 25 Mar 2020 | 21 Mar 2020 |
| 519 | newenglandblog.com | Dynadot, LLC | 4 Nov 2023 | 28 Nov 2024 | 4 Nov 2025 |
| 520 | newenglandfinance.com | Name.com, Inc. | 4 May 2022 | 7 Jun 2025 | 4 May 2026 |
| 521 | newenglandrealty.com | GoDaddy.com, LLC | 4 Jan 1997 | 1 Jan 2025 | 3 Jan 2026 |
| 522 | newenglandshutters-bg.com | eNom, Inc. | 11 Jun 2012 | 12 Jun 2015 | 11 Jun 2016 |
| 523 | newenglandclinicaltrials.com | GoDaddy.com, LLC | 7 Feb 2015 | 16 Apr 2015 | 7 Feb 2016 |
| 524 | newenglandmaintenance.com | eNom, Inc. | 18 Mar 2011 | 30 Mar 2025 | 18 Mar 2026 |
| 525 | newenglandford.com | CSC Corporate Domains, Inc. | 9 Feb 2000 | 11 Jan 2024 | 10 Feb 2026 |
| 526 | newenglandcustomgun.com | GoDaddy.com, LLC | 22 Oct 1998 | 21 Oct 2024 | 21 Oct 2026 |
| 527 | newenglandmanagement.net | 1&1 Internet AG | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 528 | newenglandwitchery.com | Squarespace Domains LLC | 27 Mar 2021 | - | 27 Mar 2022 |
| 529 | newenglandrapidedge.com | Tucows Domains Inc. | 30 Oct 2010 | 3 Nov 2014 | 30 Oct 2015 |
| 530 | newenglandrapidedge.biz | Tucows Domains Inc. | 30 Oct 2010 | 2 Nov 2014 | 29 Oct 2014 |
| 531 | newenglandtowingandrecovery.net | GoDaddy.com, LLC | 7 Jun 2014 | 8 Jun 2015 | 7 Jun 2016 |
| 532 | newenglandfinancespecialists.com | GoDaddy.com, LLC | 9 Jun 2009 | 10 Jun 2015 | 9 Jun 2016 |
| 533 | newenglanddistilling.com | FastDomain Inc. | 27 Aug 2009 | 12 Aug 2024 | 27 Aug 2025 |
| 534 | newenglandipblog.com | GoDaddy.com, LLC | 18 Jul 2014 | 19 Jul 2024 | 18 Jul 2034 |
| 535 | newenglandpumpkinfestival.com | GoDaddy.com, LLC | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2016 |
| 536 | newenglandsoccerclassic.com | GoDaddy.com, LLC | 15 Dec 2004 | 16 Dec 2024 | 15 Dec 2025 |
| 537 | newenglandsubaruparts.com | GoDaddy.com, LLC | 15 May 2008 | 16 May 2025 | 15 May 2026 |
| 538 | newenglandtowing.com | TurnCommerce, Inc. DBA NameBright.com | 25 Aug 2015 | 6 Oct 2023 | 25 Aug 2025 |
| 539 | newenglandmermaids.com | 1&1 Internet AG | 18 Aug 2016 | 16 Mar 2018 | 18 Aug 2025 |
| 540 | newenglanddragway.com | GoDaddy.com, LLC | 11 Feb 1998 | 11 Feb 2025 | 10 Feb 2026 |
| 541 | newenglandbulkhead.com | GoDaddy.com, LLC | 29 Feb 2008 | 5 Sep 2022 | 28 Feb 2026 |
| 542 | newenglandwebdevelopment.com | DreamHost, LLC | 6 May 2019 | 5 Apr 2025 | 6 May 2026 |
| 543 | newenglandbodybyvi.com | GoDaddy.com, LLC | 9 Jun 2011 | 10 Jun 2015 | 9 Jun 2016 |
| 544 | newenglandtowing.info | GoDaddy.com, LLC | 7 Jun 2014 | 7 Jun 2015 | 7 Jun 2016 |
| 545 | newenglandmystery.com | - | 1 May 2025 | 1 May 2025 | 1 May 2026 |
| 546 | newenglandlighthouses.net | register.com, Inc. | 8 Dec 2012 | 25 Nov 2024 | 8 Dec 2026 |
| 547 | newenglandcuriosities.com | GoDaddy.com, LLC | 27 Jun 2004 | 17 Jun 2025 | 27 Jun 2026 |
| 548 | newenglandtowingandrecovery.com | GoDaddy.com, LLC | 7 Jun 2014 | 8 Jun 2015 | 7 Jun 2016 |
| 549 | newenglandbirdhouse.com | FastDomain Inc. | 21 Jan 2004 | 6 Jan 2025 | 21 Jan 2026 |
| 550 | newenglandnaturalhealth.net | Wild West Domains, LLC | 7 Jun 2011 | 12 Jun 2015 | 7 Jun 2016 |
| 551 | newenglandracingnews.com | GoDaddy.com, LLC | 22 Jan 2012 | 9 Jan 2025 | 22 Jan 2026 |
| 552 | newenglandsolar.co | GoDaddy.com, LLC | 7 Jun 2012 | 12 Jun 2015 | 6 Jun 2015 |
| 553 | newenglandforestryequip.com | NameCheap, Inc. | 19 Jan 2022 | 20 Dec 2024 | 19 Jan 2026 |
| 554 | newenglandtowingandrecovery.co | GoDaddy.com, LLC | 7 Jun 2014 | 12 Jun 2015 | 6 Jun 2015 |
| 555 | newenglandtowing.net | GoDaddy.com, LLC | 7 Jun 2014 | 8 Jun 2015 | 7 Jun 2016 |
| 556 | newenglandneeds.com | GoDaddy.com, LLC | 6 Jun 2014 | 7 Jun 2015 | 6 Jun 2016 |
| 557 | newenglandtowing.co | GoDaddy.com, LLC | 7 Jun 2014 | 12 Jun 2015 | 6 Jun 2015 |
| 558 | newenglandgolf.com | Moniker Online Services LLC | 29 Mar 1997 | 28 Apr 2025 | 30 Mar 2026 |
| 559 | newenglandaudidealers.com | 1API GmbH | 8 Feb 2008 | 27 Jan 2021 | 8 Feb 2026 |
| 560 | newenglandtowing.org | - | - | - | - |
| 561 | newenglandexplorer.com | DomainPeople, Inc. | 18 Jun 1999 | 19 Jun 2025 | 18 Jun 2026 |
| 562 | newenglandrei.com | GoDaddy.com, LLC | 23 May 2022 | 4 Aug 2024 | 23 May 2024 |
| 563 | newenglandquiltsupply.net | Google, Inc. | 21 Feb 2012 | 16 Feb 2025 | 21 Feb 2026 |
| 564 | newenglandcycleworks.com | Network Solutions, LLC | 10 Feb 2001 | 6 Dec 2022 | 10 Feb 2028 |
| 565 | newenglandlobsta.com | Wild West Domains, LLC | 8 Jun 2012 | 9 Jun 2015 | 8 Jun 2016 |
| 566 | newenglandtowingandrecovery.org | GoDaddy.com, LLC | 7 Jun 2014 | 19 Jun 2015 | 7 Jun 2016 |
| 567 | newenglandspecial-teas.com | GoDaddy.com, LLC | 9 Jun 2014 | 9 Jun 2015 | 9 Jun 2016 |
| 568 | newenglandlivingmagazine.com | GoDaddy.com, LLC | 25 Jan 2008 | 10 Nov 2022 | 25 Jan 2028 |
| 569 | newenglandrecipes.com | GoDaddy.com, LLC | 20 Nov 2002 | 2 Sep 2022 | 20 Nov 2027 |
| 570 | newenglandfootballconference.com | GoDaddy.com, LLC | 3 Jul 2024 | 4 Feb 2025 | 3 Jul 2025 |
| 571 | newenglandrealestate.co | GoDaddy.com, LLC | 11 Jun 2014 | 16 Jun 2015 | 10 Jun 2015 |
| 572 | newenglandsoundproofing.com | GoDaddy.com, LLC | 15 Nov 2011 | 10 Sep 2022 | 15 Nov 2025 |
| 573 | newenglandinstituteofrealestate.com | GoDaddy.com, LLC | 12 Jun 2013 | 12 Jun 2015 | 12 Jun 2016 |
| 574 | newenglandgreeters.com | GoDaddy.com, LLC | 11 Jun 2013 | 12 Jun 2015 | 11 Jun 2016 |
| 575 | newenglandminiatures.com | GoDaddy.com, LLC | 20 Dec 2007 | 1 Dec 2024 | 20 Dec 2025 |
| 576 | newenglanduua.org | NameCheap, Inc. | 7 Aug 2023 | 2 Jun 2025 | 7 Aug 2025 |
| 577 | newenglandbrigade.com | Wix.com Ltd. | 28 Jan 2024 | 28 Jan 2024 | 28 Jan 2026 |
| 578 | newenglandweathertite.net | Tucows Domains Inc. | 27 Dec 2013 | 31 Dec 2015 | 27 Dec 2016 |
| 579 | newenglandtelephone.net | GoDaddy.com, LLC | 11 Jun 2013 | 12 Jun 2015 | 11 Jun 2016 |
| 580 | newenglandfirechiefs.org | eNom, Inc. | 23 Feb 2000 | 8 Feb 2025 | 23 Feb 2026 |
| 581 | newenglandreglaze.com | Wix.com Ltd. | 6 Oct 2007 | 6 Sep 2024 | 6 Oct 2025 |
| 582 | newenglandhiphop.com | Tucows Domains Inc. | 9 Mar 2007 | 16 Apr 2025 | 9 Mar 2026 |
| 583 | newenglandhome.us | FastDomain Inc. | 4 Jun 2014 | 24 May 2025 | 3 Jun 2026 |
| 584 | newenglandrail.net | Above.com Pty Ltd. | 28 Mar 2023 | 9 May 2024 | 28 Mar 2024 |
| 585 | newenglandforestry.org | Network Solutions, LLC | 28 Aug 2002 | 25 Jul 2022 | 28 Aug 2027 |
| 586 | newenglandlymangroup.org | Tucows Domains Inc. | 22 Jun 2014 | 7 Jun 2025 | 22 Jun 2026 |
| 587 | newenglandpackandship.com | GoDaddy.com, LLC | 1 Jan 2014 | 2 Jan 2024 | 1 Jan 2034 |
| 588 | newenglandsunglasses.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 589 | newenglandlegion.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 590 | newenglandgolfclub.com | GoDaddy.com, LLC | 3 Nov 2014 | 4 Nov 2016 | 3 Nov 2017 |
| 591 | newenglandeyewear.com | GoDaddy.com, LLC | 8 Feb 2020 | 8 Feb 2020 | 8 Feb 2021 |
| 592 | newenglandskiboat.com | GoDaddy.com, LLC | 20 May 2003 | 3 Dec 2024 | 20 May 2027 |
| 593 | newenglandclassics.com | Network Solutions, LLC | 28 Jan 1999 | 30 Jan 2025 | 28 Jan 2026 |
| 594 | newenglandcedarfence.com | GoDaddy.com, LLC | 8 Jul 2009 | 21 Sep 2022 | 8 Jul 2025 |
| 595 | newenglandturf.com | Brandon Gray Internet Services, Inc. (dba NameJuic… | 15 Jan 2002 | 18 Jan 2024 | 15 Jan 2027 |
| 596 | newenglandmintcoins.com | Jiangsu Bangning Science and technology Co. Ltd. | 1 Mar 2022 | 5 May 2023 | 1 Mar 2023 |
| 597 | newenglanduniform.com | Network Solutions, LLC | 2 Aug 1999 | 3 Jun 2024 | 2 Aug 2027 |
| 598 | newenglandcleaningservices.com | Hostinger, UAB | 6 May 2024 | 9 Apr 2025 | 6 May 2026 |
| 599 | newenglandnativestone.com | GoDaddy.com, LLC | 4 Jan 2008 | 5 Jan 2025 | 4 Jan 2026 |
| 600 | newenglandforestrally.com | GoDaddy.com, LLC | 12 Oct 2006 | 13 Oct 2024 | 12 Oct 2026 |
| 601 | newenglandclerks.org | GoDaddy.com, LLC | 4 Aug 2005 | 25 Aug 2024 | 4 Aug 2025 |
| 602 | newenglandcivilwarmuseum.com | Network Solutions, LLC | 31 Oct 2009 | 1 Oct 2024 | 31 Oct 2025 |
| 603 | newenglandcondo.com | Dynadot, LLC | 22 Apr 2005 | 9 Aug 2024 | 22 Apr 2027 |
| 604 | newenglanddogtravel.com | GoDaddy.com, LLC | 12 Jul 2010 | 13 Jul 2024 | 12 Jul 2025 |
| 605 | newenglandtire.com | GoDaddy.com, LLC | 29 Jan 2000 | 30 Jan 2025 | 29 Jan 2026 |
| 606 | newenglandreformedfellowship.org | GoDaddy.com, LLC | 27 Mar 2006 | 1 Mar 2025 | 27 Mar 2026 |
| 607 | newenglandmeteoriteservices.com | - | - | - | - |
| 608 | newenglandeye.org | Network Solutions, LLC | 10 Apr 2004 | 15 Apr 2024 | 10 Apr 2034 |
| 609 | newenglandsite.com | GoDaddy.com, LLC | 3 Jul 2004 | 5 Sep 2022 | 3 Jul 2025 |
| 610 | newenglandmeetingsites.com | Network Solutions, LLC | 28 Mar 2001 | 26 Nov 2024 | 28 Mar 2028 |
| 611 | newenglandcops.org | register.com, Inc. | 14 Jul 2011 | 13 Aug 2021 | 14 Jul 2026 |
| 612 | newenglandstonemasonry.com | Tucows Domains Inc. | 8 Oct 2003 | 12 Aug 2024 | 8 Oct 2025 |
| 613 | newenglandfoam.com | Tucows Domains Inc. | 13 Mar 2002 | 30 Sep 2021 | 22 Apr 2026 |
| 614 | newenglandairgun.com | Domain.com, LLC | 6 Apr 2013 | 7 Feb 2023 | 6 Apr 2028 |
| 615 | newengland4x4jamboree.com | GoDaddy.com, LLC | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2017 |
| 616 | newenglandwaterman.com | DropCatch.com 1436 LLC | 13 Apr 2022 | 14 Apr 2022 | 13 Apr 2026 |
| 617 | newenglandinpatientspecialists.com | Domain.com, LLC | 10 Oct 2007 | 27 Jul 2023 | 10 Oct 2025 |
| 618 | newenglandmaltipoobreeders.com | GoDaddy.com, LLC | 9 Mar 2009 | 19 Apr 2015 | 9 Mar 2016 |
| 619 | newenglandclassic.com | GoDaddy.com, LLC | 18 Jun 1999 | 19 Jun 2025 | 18 Jun 2034 |
| 620 | newenglandgreatdanebreeders.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Sep 2021 | 6 May 2025 | 16 Sep 2025 |
| 621 | newenglandtowns.org | pair Networks, Inc. d/b/a pairNIC | 19 Jul 2004 | 21 Jun 2023 | 19 Jul 2025 |
| 622 | newenglandwhiskyfestival.com | MarkMonitor Inc. | 4 Nov 2014 | 26 May 2021 | 4 Nov 2026 |
| 623 | newenglandwhiskyfest.com | MarkMonitor Inc. | 4 Nov 2014 | 26 May 2021 | 4 Nov 2026 |
| 624 | newenglandtowingarmidale.com | Domain.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 625 | newenglandstateofmind.com | Media Elite Holdings Limited | 11 Feb 2021 | 11 Feb 2021 | 11 Feb 2022 |
| 626 | newenglandoverland.com | GoDaddy.com, LLC | 4 Nov 2014 | 5 Nov 2024 | 4 Nov 2025 |
| 627 | newenglandinhouse.com | GoDaddy.com, LLC | 5 Feb 2003 | 6 Feb 2025 | 5 Feb 2026 |
| 628 | newenglandboatandmotor.com | GoDaddy.com, LLC | 25 Aug 2008 | 26 Aug 2024 | 25 Aug 2025 |
| 629 | newenglandtrim.com | register.com, Inc. | 13 May 2005 | 12 Oct 2023 | 13 May 2026 |
| 630 | newenglandautofinance.com | GoDaddy.com, LLC | 6 Jan 2009 | 7 Jan 2025 | 6 Jan 2026 |
| 631 | newenglandrealestate.com | GoDaddy.com, LLC | 3 Apr 1997 | 9 Mar 2025 | 4 Apr 2028 |
| 632 | newenglandgis.com | GoDaddy.com, LLC | 6 Nov 2006 | 7 Nov 2024 | 6 Nov 2025 |
| 633 | newenglandbaptistradiology.org | GoDaddy.com, LLC | 12 Jun 2013 | 24 Jun 2015 | 12 Jun 2016 |
| 634 | newenglandknights.com | GoDaddy.com, LLC | 25 Apr 2017 | 26 Apr 2025 | 25 Apr 2026 |
| 635 | newenglandlincolns.org | GoDaddy.com, LLC | 12 Jun 2007 | 24 Jun 2015 | 12 Jun 2016 |
| 636 | newenglandpizza.net | GoDaddy.com, LLC | 12 Jun 2013 | 13 Jun 2015 | 12 Jun 2016 |
| 637 | newenglandpropertyquest.com | GoDaddy.com, LLC | 12 Jun 2014 | 13 Jun 2015 | 12 Jun 2016 |
| 638 | newenglandfutsalclub.com | FastDomain Inc. | 17 Aug 2014 | 19 Jun 2015 | 17 Aug 2020 |
| 639 | newenglandgreetings.net | GoDaddy.com, LLC | 13 Jun 2014 | 14 Jun 2015 | 13 Jun 2016 |
| 640 | newenglandbagpipes.biz | GoDaddy.com, LLC | 14 Jun 2011 | 14 Jun 2014 | 13 Jun 2015 |
| 641 | newenglandantiquer.com | GoDaddy.com, LLC | 13 Jun 2011 | 14 Jun 2015 | 13 Jun 2016 |
| 642 | newenglandgreetings.info | GoDaddy.com, LLC | 13 Jun 2014 | 13 Jun 2015 | 13 Jun 2016 |
| 643 | newenglandgreetings.org | - | - | - | - |
| 644 | newenglandpoolleague.com | GoDaddy.com, LLC | 14 Jun 2013 | 15 Jun 2015 | 14 Jun 2016 |
| 645 | newenglandtriathlontraining.com | GoDaddy.com, LLC | 14 Jun 2007 | 15 Jun 2015 | 14 Jun 2016 |
| 646 | newenglandebikes.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Nov 2022 | 9 Dec 2024 | 7 Nov 2024 |
| 647 | newengland-charter-yachts.com | GoDaddy.com, LLC | 19 Mar 2003 | 16 Jun 2015 | 16 Jun 2016 |
| 648 | newenglandpride.net | GoDaddy.com, LLC | 20 Sep 2017 | 1 Nov 2024 | 20 Sep 2024 |
| 649 | newenglandtoorlando.com | Wild West Domains, LLC | 25 Jul 2011 | 17 Jun 2015 | 16 Jun 2016 |
| 650 | newenglandcountryrental.com | GoDaddy.com, LLC | 9 Feb 2018 | 26 Feb 2025 | 9 Feb 2026 |
| 651 | newenglandclockcompany.com | Fabulous.com Pty Ltd. | 18 Oct 2005 | 14 Feb 2019 | 18 Oct 2019 |
| 652 | newenglandclimbs.com | GoDaddy.com, LLC | 23 Jan 2016 | 24 Jan 2025 | 23 Jan 2026 |
| 653 | newenglandchildcare.com | Domain.com, LLC | 1 Mar 2021 | 9 Feb 2025 | 1 Mar 2026 |
| 654 | newenglandcanecorso.com | Tucows Domains Inc. | 5 Nov 2014 | 9 Nov 2018 | 5 Nov 2018 |
| 655 | newenglandbikepaths.com | GoDaddy.com, LLC | 16 Jun 2013 | 17 Jun 2015 | 16 Jun 2016 |
| 656 | newenglandbridalnetwork.com | GoDaddy.com, LLC | 16 Jun 2010 | 17 Jun 2015 | 16 Jun 2016 |
| 657 | newenglandseoteam.com | GoDaddy.com, LLC | 16 Jun 2012 | 17 Jun 2015 | 16 Jun 2016 |
| 658 | newenglandclockrepair.com | GoDaddy.com, LLC | 16 Jun 2014 | 17 Jun 2015 | 16 Jun 2016 |
| 659 | newenglandcraftfairs.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Aug 2014 | 18 Aug 2014 | 17 Aug 2015 |
| 660 | newenglandoils.com | GoDaddy.com, LLC | 18 Aug 2014 | 19 Aug 2024 | 18 Aug 2025 |
| 661 | newenglandsavant.com | register.com, Inc. | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 662 | newenglandsmovers.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 663 | newenglanddays.com | NameCheap, Inc. | 18 Dec 2022 | 28 Feb 2024 | 18 Dec 2023 |
| 664 | newenglandbrickfaceandexterior.com | GoDaddy.com, LLC | 19 Jun 2014 | 19 Jun 2015 | 19 Jun 2016 |
| 665 | newenglandcompost.com | Tucows Domains Inc. | 21 Jul 2018 | 6 Jul 2024 | 21 Jul 2025 |
| 666 | newenglandhomesource.com | GoDaddy.com, LLC | 19 Jun 2008 | 19 Jun 2015 | 19 Jun 2016 |
| 667 | newenglandsod.com | GoDaddy.com, LLC | 9 Jul 2024 | 9 Jul 2024 | 9 Jul 2025 |
| 668 | newenglandvirtualservices.net | GoDaddy.com, LLC | 19 Jun 2014 | 20 Jun 2015 | 19 Jun 2016 |
| 669 | newenglanddaily.com | GoDaddy.com, LLC | 31 Jul 2024 | 19 Apr 2025 | 31 Jul 2027 |
| 670 | newenglandrealestate.net | GoDaddy.com, LLC | 7 Jul 2015 | 5 Jan 2023 | 11 Jan 2026 |
| 671 | newenglandareabargainhouses.com | Wild West Domains, LLC | 19 Aug 2014 | 1 Sep 2016 | 19 Aug 2017 |
| 672 | newenglandathand.com | Nobel Networks | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 673 | newenglandcleanenergy.net | Name.com, Inc. | 19 Aug 2014 | 13 Sep 2024 | 19 Aug 2026 |
| 674 | newenglandelopements.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 675 | newenglandlabor.com | Namesilo, LLC | 3 May 2021 | 3 May 2025 | 3 May 2026 |
| 676 | newenglandmemoirs.com | Namesilo, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 677 | newenglandofficiants.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 678 | newenglandquiltcruise.com | GoDaddy.com, LLC | 19 Aug 2014 | 20 Aug 2016 | 19 Aug 2017 |
| 679 | newenglandquiltcruises.com | GoDaddy.com, LLC | 19 Aug 2014 | 20 Aug 2016 | 19 Aug 2017 |
| 680 | newenglandfunctionalglass.com | eNom, Inc. | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 681 | newenglandphotoarts.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 682 | newenglandsparanormalduo.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 683 | newenglanddealingacademy.com | GoDaddy.com, LLC | 1 May 2017 | 2 May 2018 | 1 May 2019 |
| 684 | newenglandamateurradio.org | Gandi SAS | 20 Aug 2014 | 5 Aug 2016 | 20 Aug 2017 |
| 685 | newenglandartistsrecords.com | Gandi SAS | 19 Aug 2003 | 21 May 2025 | 19 Aug 2025 |
| 686 | newenglandbookshow.org | - | 5 Nov 2023 | 20 Dec 2024 | 5 Nov 2025 |
| 687 | newenglandcleanenergy.biz | Name.com, Inc. | 19 Aug 2014 | 18 Sep 2024 | 18 Aug 2026 |
| 688 | newenglandcleanenergy.info | Name.com, Inc. | 19 Aug 2014 | 18 Sep 2024 | 19 Aug 2026 |
| 689 | newenglandcleanenergy.org | Name.com, Inc. | 19 Aug 2014 | 18 Sep 2024 | 19 Aug 2026 |
| 690 | newenglandspinecenter.com | DNC Holdings, Inc. | 20 Aug 2014 | 22 Aug 2016 | 20 Aug 2017 |
| 691 | newenglandbituminous.com | GoDaddy.com, LLC | 12 Jan 2015 | 13 Jan 2024 | 12 Jan 2026 |
| 692 | newenglandlandscapingct.com | Tucows Domains Inc. | 12 Jan 2015 | 16 Jan 2018 | 12 Jan 2018 |
| 693 | newenglandoffgrid.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 694 | newenglandpoloniapages.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 695 | newenglandshorttrackracing.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 696 | newenglandcsllc.com | Tucows Domains Inc. | 18 Aug 2012 | 22 Aug 2014 | 18 Aug 2015 |
| 697 | newenglandkenyaninvestorsassociation.org | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 698 | newenglandlifecoaching.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Aug 2024 | 21 Aug 2025 |
| 699 | newenglandpropertyimaging.com | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 700 | newenglandpropertyimaging.net | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 701 | newenglandpropertyimaging.org | GoDaddy.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 702 | newenglandrestorationandremodeling.com | register.com, Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 703 | newenglandslim.com | Squarespace Domains LLC | 2 Nov 2024 | 2 Nov 2024 | 2 Nov 2025 |
| 704 | newenglanddecksandfloors.com | Wild West Domains, LLC | 6 Feb 2015 | 7 Feb 2025 | 6 Feb 2026 |
| 705 | newenglandframeandautobody.com | DomainPeople, Inc. | 6 Feb 2015 | 8 Jan 2017 | 6 Feb 2018 |
| 706 | newenglandholidaymarket.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2017 |
| 707 | newenglandrent.com | DROPCATCH.COM 827 LLC | 17 Mar 2017 | 18 Mar 2017 | 17 Mar 2018 |
| 708 | newenglandtequilaandrumfest.com | MarkMonitor Inc. | 6 Feb 2015 | 8 May 2021 | 6 Feb 2027 |
| 709 | newenglandtequilaandrumfestival.com | MarkMonitor Inc. | 6 Feb 2015 | 30 Jul 2021 | 6 Feb 2027 |
| 710 | newenglandwealthbuilders.com | Domain.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 711 | newenglandautoworld.net | GoDaddy.com, LLC | 28 Feb 2015 | 1 Mar 2025 | 28 Feb 2030 |
| 712 | newenglandhemp.com | GoDaddy.com, LLC | 1 Mar 2015 | 27 Aug 2024 | 9 Jan 2026 |
| 713 | newenglandsalsaawards.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 714 | newenglandrealestateteam.com | GoDaddy.com, LLC | 5 Feb 2019 | 19 Apr 2025 | 5 Feb 2025 |
| 715 | newenglandcomputersrecyclers.info | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 716 | newenglandouterwear.net | Xin Net Technology Corporation | 17 Aug 2013 | 22 Aug 2014 | 17 Aug 2015 |
| 717 | newenglandcraftcider.com | GoDaddy.com, LLC | 1 Mar 2013 | 14 Apr 2015 | 1 Mar 2020 |
| 718 | newenglandaedsales.biz | 1&1 Internet AG | 12 Aug 2014 | 7 Aug 2017 | 11 Aug 2017 |
| 719 | newenglandchiliclassic.com | GMO Internet Inc. | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 720 | newenglandtribute.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 721 | newenglandweddingvideographer.com | FastDomain Inc. | 17 May 2018 | 17 May 2018 | 17 May 2019 |
| 722 | newenglandrealestateteam.info | GoDaddy.com, LLC | 7 Nov 2014 | 8 Nov 2016 | 7 Nov 2017 |
| 723 | newenglandaedsales.com | 1&1 Internet AG | 12 Aug 2014 | 16 Mar 2018 | 12 Aug 2020 |
| 724 | newenglandaedsales.net | 1&1 Internet AG | 12 Aug 2014 | 7 Dec 2017 | 12 Aug 2018 |
| 725 | newenglandletterpress.com | Network Solutions, LLC | 24 Nov 2023 | 6 Jan 2025 | 24 Nov 2024 |
| 726 | newenglandpatriotsproshop.org | register.com, Inc. | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 727 | newenglandvintagecoop.com | NameCheap, Inc. | 12 Apr 2018 | 12 Apr 2018 | 12 Apr 2019 |
| 728 | newenglandrealestateteam.net | GoDaddy.com, LLC | 7 Nov 2014 | 8 Nov 2016 | 7 Nov 2017 |
| 729 | newenglandfoodsafety.org | GoDaddy.com, LLC | 22 Nov 2024 | 27 Nov 2024 | 22 Nov 2025 |
| 730 | newenglandaedsales.info | 1&1 Internet AG | 12 Aug 2014 | 29 Aug 2017 | 12 Aug 2018 |
| 731 | newenglandaedsales.org | 1&1 Internet AG | 12 Aug 2014 | 13 Oct 2017 | 12 Aug 2018 |
| 732 | newenglandcjdr.com | TurnCommerce, Inc. DBA NameBright.com | 31 Oct 2020 | 10 Nov 2020 | 31 Oct 2021 |
| 733 | newenglandcjdr.net | GoDaddy.com, LLC | 13 Aug 2014 | 14 Aug 2016 | 13 Aug 2018 |
| 734 | newenglanddancect.com | register.com, Inc. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 735 | newenglandmedibles.com | GoDaddy.com, LLC | 13 Aug 2014 | 24 Aug 2016 | 13 Aug 2017 |
| 736 | newenglandrundreise.com | Wild West Domains, LLC | 13 Aug 2014 | 13 Jul 2016 | 13 Aug 2017 |
| 737 | newenglandyard.com | GoDaddy.com, LLC | 19 Sep 2021 | 1 Dec 2023 | 19 Sep 2023 |
| 738 | newenglandchaga.com | GoDaddy.com, LLC | 27 Aug 2014 | 10 Jun 2025 | 27 Aug 2026 |
| 739 | newenglandchaga.info | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 740 | newenglandcma.org | GMO Internet Inc. | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 741 | newenglandeffect.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 742 | newenglandenvironmentalschool.com | register.com, Inc. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 743 | newenglandprincess.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 744 | newenglandseeds.biz | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 24 Aug 2015 |
| 745 | newenglandseeds.us | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 24 Aug 2015 |
| 746 | newenglandsquire.com | GoDaddy.com, LLC | 26 Aug 2014 | 23 Aug 2016 | 26 Aug 2017 |
| 747 | newenglandunleashed.org | Network Solutions, LLC | 8 Nov 2014 | 13 Sep 2023 | 8 Nov 2025 |
| 748 | newenglandanimal.com | GoDaddy.com, LLC | 14 Aug 2014 | 15 Aug 2023 | 14 Aug 2025 |
| 749 | newenglandbassfishing.com | Heavydomains.net LLC | 21 Jan 2022 | 22 Jan 2022 | 21 Jan 2023 |
| 750 | newenglanddj.org | eNom, Inc. | 14 Aug 2014 | 22 Aug 2015 | 14 Aug 2017 |
| 751 | newenglandblackwolves.com | CSC Corporate Domains, Inc. | 27 Aug 2014 | 23 Aug 2017 | 27 Aug 2018 |
| 752 | newenglandcarpentersfund.com | Key-Systems GmbH | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 753 | newenglandhousevt.com | GoDaddy.com, LLC | 27 Aug 2014 | 16 Sep 2022 | 27 Aug 2025 |
| 754 | newenglandoddjobs.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 755 | newenglandblackwolves.net | CSC Corporate Domains, Inc. | 27 Aug 2014 | 23 Aug 2017 | 27 Aug 2018 |
| 756 | newenglandhouse.net | Tucows Domains Inc. | 21 Nov 2019 | 25 Nov 2021 | 21 Nov 2021 |
| 757 | newenglandskiclub.com | GoDaddy.com, LLC | 25 Jan 2021 | 26 Jan 2025 | 25 Jan 2026 |
| 758 | newenglandsaltworks.com | Squarespace Domains LLC | 22 Nov 2023 | 8 Nov 2024 | 22 Nov 2025 |
| 759 | newenglandbuyback.com | GoDaddy.com, LLC | 10 Nov 2014 | 11 Nov 2016 | 10 Nov 2018 |
| 760 | newenglandblackwolves.org | CSC Corporate Domains, Inc. | 27 Aug 2014 | 23 Aug 2017 | 27 Aug 2018 |
| 761 | newenglandprincessparties.com | GoDaddy.com, LLC | 28 Aug 2014 | 29 Aug 2016 | 28 Aug 2017 |
| 762 | newenglandvintagewedding.com | GoDaddy.com, LLC | 16 Jul 2013 | 28 Jun 2016 | 16 Jul 2017 |
| 763 | newenglandfanexperience.com | DropCatch.com 1385 LLC | 12 Jan 2019 | 12 Jan 2019 | 12 Jan 2020 |
| 764 | newenglandseasons.com | TurnCommerce, Inc. DBA NameBright.com | 16 Aug 2014 | 24 Aug 2022 | 16 Aug 2025 |
| 765 | newenglandsaver.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 766 | newenglandaerialimaging.com | GoDaddy.com, LLC | 30 Jul 2020 | 30 Jul 2020 | 30 Jul 2021 |
| 767 | newenglandrebyowner.com | GoDaddy.com, LLC | 13 Nov 2014 | 25 Dec 2024 | 13 Nov 2024 |
| 768 | newenglandlistonly.com | GoDaddy.com, LLC | 13 Nov 2014 | 25 Dec 2024 | 13 Nov 2024 |
| 769 | newenglandlift.com | GoDaddy.com, LLC | 18 Sep 2019 | 18 Sep 2019 | 18 Sep 2020 |
| 770 | newenglandgoth.com | Dynadot, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 771 | newenglandgolfleague.com | GoDaddy.com, LLC | 13 Nov 2014 | 14 Nov 2016 | 13 Nov 2017 |
| 772 | newenglandcivilwarevents.com | eNom, Inc. | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 773 | newenglandghostfinders.com | Tucows Domains Inc. | 8 Sep 2013 | 12 Sep 2014 | 8 Sep 2015 |
| 774 | newenglandsterilaire.com | Tucows Domains Inc. | 8 Sep 2013 | 11 Sep 2014 | 8 Sep 2015 |
| 775 | newenglandtonic.com | GoDaddy.com, LLC | 11 Sep 2014 | 12 Sep 2024 | 11 Sep 2025 |
| 776 | newenglandcandleco.com | GoDaddy.com, LLC | 18 Dec 2020 | 29 Jan 2025 | 18 Dec 2024 |
| 777 | newenglandcandlecompany.com | Wix.com Ltd. | 2 Apr 2021 | 12 Jun 2023 | 2 Apr 2023 |
| 778 | newenglandpatriotsjersey.net | Network Solutions, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 779 | newenglandpatriotsshop.com | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Dec 2023 | 12 Feb 2025 | 30 Dec 2024 |
| 780 | newenglandsoycandle.com | Tucows Domains Inc. | 29 Aug 2014 | 2 Sep 2018 | 29 Aug 2018 |
| 781 | newenglandwaterfronthomes.com | eNom, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 782 | newenglandwelca.org | Google, Inc. | 29 Aug 2014 | 29 Aug 2017 | 29 Aug 2018 |
| 783 | newenglandaquaponics.com | GoDaddy.com, LLC | 12 Sep 2014 | 13 Sep 2024 | 12 Sep 2026 |
| 784 | newenglandhomeassistance.com | register.com, Inc. | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 785 | newenglandpremierfutsalclub.com | FastDomain Inc. | 13 Sep 2014 | 13 Sep 2017 | 13 Sep 2018 |
| 786 | newenglandpump.com | GoDaddy.com, LLC | 17 Jan 2023 | 17 Jan 2023 | 17 Jan 2024 |
| 787 | newenglandseafoodsdirect.com | GoDaddy.com, LLC | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2016 |
| 788 | newenglandsewerpump.com | GoDaddy.com, LLC | 13 Sep 2014 | 29 Aug 2016 | 13 Sep 2017 |
| 789 | newenglandvisualmedia.com | register.com, Inc. | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 790 | newenglandrna.org | GMO Internet Inc. | 12 Sep 2014 | 13 Jul 2017 | 12 Sep 2018 |
| 791 | newenglandpatriotsjerseys.org | Network Solutions, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 792 | newenglandskytv.net | Tucows Domains Inc. | 27 Aug 2012 | 31 Aug 2014 | 27 Aug 2015 |
| 793 | newenglandhempcrete.com | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2016 | 14 Sep 2017 |
| 794 | newenglandjumps.com | GoDaddy.com, LLC | 13 Sep 2014 | 14 Sep 2024 | 13 Sep 2025 |
| 795 | newenglandsongwritingcompetition.com | Automattic Inc. | 13 Apr 2021 | 24 Mar 2025 | 13 Apr 2026 |
| 796 | newenglandsongwritingcompetition.org | GoDaddy.com, LLC | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 797 | newenglandroofingcontractors.com | GoDaddy.com, LLC | 1 Aug 2019 | 2 Aug 2024 | 1 Aug 2025 |
| 798 | newenglandlongboards.com | GoDaddy.com, LLC | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 799 | newenglandhospitalityservices.com | AcquiredNames LLC | 14 Nov 2014 | 15 Nov 2017 | 14 Nov 2018 |
| 800 | newenglandfencecompany.com | GoDaddy.com, LLC | 15 Nov 2014 | 26 Nov 2024 | 15 Nov 2025 |
| 801 | newenglandcenterformindfulness.com | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 802 | newenglandcenterformindfulness.org | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 803 | newenglandforeclosureprevention.com | Tucows Domains Inc. | 10 Sep 2013 | 15 Sep 2014 | 10 Sep 2015 |
| 804 | newenglandish.com | GoDaddy.com, LLC | 16 Aug 2020 | 27 Sep 2024 | 16 Aug 2024 |
| 805 | newenglandfolkart.net | Domain.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 806 | newenglandfolkartist.net | Domain.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 807 | newenglandcompanies.com | TurnCommerce, Inc. DBA NameBright.com | 1 Sep 2014 | 11 Oct 2024 | 1 Sep 2024 |
| 808 | newenglandscientificrefrigeration.com | GoDaddy.com, LLC | 3 Aug 2020 | 3 Aug 2020 | 3 Aug 2021 |
| 809 | newenglandbrewreview.com | Marcaria.com International, Inc. | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 810 | newenglandzen.com | GoDaddy.com, LLC | 8 Aug 2016 | 28 Sep 2022 | 8 Aug 2026 |
| 811 | newenglandzen.net | FastDomain Inc. | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 812 | newenglandpiano.com | NameCheap, Inc. | 16 Sep 2014 | 17 Aug 2024 | 16 Sep 2025 |
| 813 | newenglandanimalhealth.org | GoDaddy.com, LLC | 2 Sep 2014 | 4 Aug 2024 | 2 Sep 2025 |
| 814 | newenglandhomebuilder.com | GoDaddy.com, LLC | 21 Jun 2025 | 21 Jun 2025 | 21 Jun 2026 |
| 815 | newenglandscales.com | Omnis Network, LLC | 2 Sep 2014 | 2 Sep 2024 | 2 Sep 2025 |
| 816 | newenglandsupplycompany.com | GoDaddy.com, LLC | 20 Dec 2024 | 20 Dec 2024 | 20 Dec 2025 |
| 817 | newenglandracing.org | GoDaddy.com, LLC | 13 Nov 2014 | 14 Nov 2016 | 13 Nov 2018 |
| 818 | newenglandracing.net | GoDaddy.com, LLC | 13 Nov 2014 | 14 Nov 2016 | 13 Nov 2018 |
| 819 | newenglandfencecompany.net | GoDaddy.com, LLC | 15 Nov 2014 | 26 Nov 2024 | 15 Nov 2025 |
| 820 | newenglandatheist.com | Tucows Domains Inc. | 12 Sep 2013 | 16 Sep 2014 | 12 Sep 2015 |
| 821 | newenglandcarports.com | GoDaddy.com, LLC | 15 Sep 2014 | 16 Sep 2024 | 15 Sep 2025 |
| 822 | newenglandexecutivecenter.com | GoDaddy.com, LLC | 15 Sep 2014 | 16 Sep 2016 | 15 Sep 2017 |
| 823 | newenglandfamilyadventure.com | Wild West Domains, LLC | 15 Sep 2014 | 15 Aug 2016 | 15 Sep 2017 |
| 824 | newenglandschessies.com | Tucows Domains Inc. | 15 Sep 2014 | 19 Sep 2021 | 15 Sep 2021 |
| 825 | newenglandsocialmagazine.com | GoDaddy.com, LLC | 15 Sep 2014 | 16 Sep 2016 | 15 Sep 2017 |
| 826 | newenglandweddingnetwork.com | Xin Net Technology Corporation | 31 Jul 2023 | 30 Sep 2024 | 31 Jul 2024 |
| 827 | newenglandwomensconference.com | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 828 | newenglandeggdrop.com | GoDaddy.com, LLC | 15 Nov 2014 | 16 Nov 2016 | 15 Nov 2017 |
| 829 | newenglandtransunited.org | GMO Internet Inc. | 16 Sep 2014 | - | 16 Sep 2015 |
| 830 | newengland-kitchenandbath.com | Network Solutions, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 831 | newenglandbook.com | DropCatch.com 403 LLC | 3 Sep 2014 | 4 Sep 2017 | 3 Sep 2018 |
| 832 | newenglanddancecenter.com | Network Solutions, LLC | 3 Sep 2014 | 3 Sep 2024 | 3 Sep 2026 |
| 833 | newenglanddanceparties.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 834 | newenglandferry.com | Fabulous.com Pty Ltd. | 10 Aug 2006 | 2 Aug 2016 | 10 Aug 2017 |
| 835 | newenglandheatingandair.info | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 836 | newenglandrailcoalition.org | GMO Internet Inc. | 3 Sep 2014 | 9 Nov 2016 | 3 Sep 2017 |
| 837 | newenglandtreeservices.com | GoDaddy.com, LLC | 2 Aug 2020 | 24 Feb 2025 | 31 Oct 2025 |
| 838 | newenglandbondbondschool.com | GoDaddy.com, LLC | 17 Sep 2014 | 12 Sep 2016 | 17 Sep 2017 |
| 839 | newenglandcrapcakes.com | Tucows Domains Inc. | 14 Sep 2011 | 17 Sep 2014 | 14 Sep 2015 |
| 840 | newenglandhomebuyers.com | GoDaddy.com, LLC | 25 Jan 2016 | 26 Jan 2024 | 25 Jan 2026 |
| 841 | newenglandhomebuyers.us | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 16 Sep 2015 |
| 842 | newenglandvoicelesson.com | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 843 | newenglandschessiesdogtrainer.com | Tucows Domains Inc. | 13 Nov 2013 | 17 Nov 2014 | 13 Nov 2015 |
| 844 | newenglandnoveltees.com | register.com, Inc. | 16 Nov 2014 | 17 Nov 2014 | 16 Nov 2015 |
| 845 | newenglandjunglists.com | GoDaddy.com, LLC | 16 Nov 2014 | 17 Nov 2016 | 16 Nov 2017 |
| 846 | newenglandexec.com | NameCheap, Inc. | 4 Sep 2014 | 28 Apr 2024 | 4 Sep 2025 |
| 847 | newenglandexeccenters.com | GoDaddy.com, LLC | 4 Sep 2014 | 5 Sep 2016 | 4 Sep 2017 |
| 848 | newenglandexecsuites.com | GoDaddy.com, LLC | 4 Sep 2014 | 5 Sep 2016 | 4 Sep 2017 |
| 849 | newenglandexecutivecenters.com | GoDaddy.com, LLC | 4 Sep 2014 | 5 Sep 2016 | 4 Sep 2017 |
| 850 | newenglandexecutivesuites.com | GoDaddy.com, LLC | 4 Sep 2014 | 5 Sep 2016 | 4 Sep 2017 |
| 851 | newenglandflingz.com | DropCatch.com 596 LLC | 28 Jan 2018 | 28 Jan 2018 | 28 Jan 2019 |
| 852 | newenglandhundredhighest.com | GoDaddy.com, LLC | 4 Sep 2014 | 5 Sep 2024 | 4 Sep 2025 |
| 853 | newenglandwrap.com | GoDaddy.com, LLC | 4 Sep 2014 | 16 Oct 2024 | 4 Sep 2024 |
| 854 | newenglanddiapers.com | eNom, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 855 | newenglandweddingvendors.com | eNom, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 856 | newenglandskimaps.com | GoDaddy.com, LLC | 18 Sep 2014 | 19 Sep 2024 | 18 Sep 2026 |
| 857 | newenglanddesigns.com | TurnCommerce, Inc. DBA NameBright.com | 8 Feb 2012 | 21 Mar 2025 | 8 Feb 2025 |
| 858 | newenglandhydro.com | FastDomain Inc. | 5 Sep 2014 | 18 Oct 2024 | 5 Sep 2024 |
| 859 | newenglandlaseresthetics.com | GoDaddy.com, LLC | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 860 | newenglandmedicalcoating.com | GoDaddy.com, LLC | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 861 | newenglandhoods.com | NameCheap, Inc. | 15 Apr 2025 | 15 Apr 2025 | 15 Apr 2026 |
| 862 | newenglandsigns.com | GoDaddy.com, LLC | 19 May 2018 | 12 Apr 2025 | 19 May 2026 |
| 863 | newenglandfirebird.com | NameCheap, Inc. | 20 Dec 2016 | 6 Dec 2024 | 20 Dec 2025 |
| 864 | newenglandmedicalmarijuanadispensary.com | GoDaddy.com, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2016 |
| 865 | newenglandplumbingsupply.com | Wild West Domains, LLC | 7 Sep 2014 | 8 Sep 2016 | 7 Sep 2017 |
| 866 | newenglandfurnitureoutlet.com | GoDaddy.com, LLC | 20 Sep 2014 | 29 Mar 2024 | 15 Mar 2025 |
| 867 | newenglandyachtcharters.com | TurnCommerce, Inc. DBA NameBright.com | 17 Sep 2012 | 28 Oct 2024 | 17 Sep 2024 |
| 868 | newenglanddentist.com | Namesilo, LLC | 26 Sep 2002 | 1 Sep 2024 | 26 Sep 2025 |
| 869 | newenglandyachtpartners.us | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2016 | 19 Sep 2018 |
| 870 | newengland-sportsfans.com | - | 9 Oct 2016 | 9 Oct 2016 | 9 Oct 2017 |
| 871 | newenglandshockers.com | GoDaddy.com, LLC | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2017 |
| 872 | newenglandwoodcrafters.com | GoDaddy.com, LLC | 7 Sep 2014 | 16 Sep 2022 | 7 Sep 2026 |
| 873 | newenglandwomenofstrength.org | Tucows Domains Inc. | 16 Nov 2014 | 20 Nov 2015 | 16 Nov 2016 |
| 874 | newenglandjunglists.us | GoDaddy.com, LLC | 16 Nov 2014 | 21 Nov 2017 | 15 Nov 2018 |
| 875 | newenglandjunglists.org | GoDaddy.com, LLC | 16 Nov 2014 | 17 Nov 2017 | 16 Nov 2018 |
| 876 | newenglandcardiology.org | Brandon Gray Internet Services, Inc. (dba NameJuic… | 17 Nov 2014 | - | 17 Nov 2015 |
| 877 | newenglandequestrians.com | Domainshype.com, Inc. | 8 May 2018 | 8 May 2018 | 8 May 2019 |
| 878 | newenglandfamilydentistry.com | eNom, Inc. | 8 Sep 2014 | 7 Sep 2024 | 8 Sep 2025 |
| 879 | newenglandrealestatesolutions.info | GoDaddy.com, LLC | 8 Sep 2014 | 16 Aug 2024 | 8 Sep 2025 |
| 880 | newenglandwebsitedesigns.com | eNom, Inc. | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 881 | newenglandwheelleather.com | GMO Internet Inc. | 8 Sep 2014 | 24 Aug 2017 | 8 Sep 2018 |
| 882 | newenglandworldartistry.com | Tucows Domains Inc. | 18 Nov 2014 | 22 Nov 2015 | 18 Nov 2016 |
| 883 | newenglandrecordcc.com | GoDaddy.com, LLC | 8 Nov 2019 | 8 Nov 2019 | 8 Nov 2020 |
| 884 | newenglandprivatelender.com | GoDaddy.com, LLC | 22 Jun 2021 | 22 Jun 2021 | 22 Jun 2022 |
| 885 | newenglandflood.com | GoDaddy.com, LLC | 18 Nov 2014 | 17 Sep 2022 | 18 Nov 2025 |
| 886 | newenglandcustomwoodworks.com | DNC Holdings, Inc. | 19 May 2022 | 20 May 2025 | 19 May 2025 |
| 887 | newengland-chevy.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 888 | newenglandworkerscomp.com | Network Solutions, LLC | 15 Oct 2008 | 17 Oct 2024 | 15 Oct 2025 |
| 889 | newenglandfinancialservices.net | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2024 | 2 Oct 2025 |
| 890 | newenglanddieseltrucks.com | GoDaddy.com, LLC | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2019 |
| 891 | newenglandsnowcone.com | Wild West Domains, LLC | 9 Sep 2014 | 10 Sep 2016 | 9 Sep 2017 |
| 892 | newenglandqualitygoods.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 893 | newenglandreinsurance.net | GoDaddy.com, LLC | 2 Oct 2014 | 21 Sep 2015 | 2 Oct 2017 |
| 894 | newenglandmedicalmanagement.net | GoDaddy.com, LLC | 2 Oct 2014 | 20 Jul 2015 | 2 Oct 2017 |
| 895 | newenglandadministrators.net | GoDaddy.com, LLC | 2 Oct 2014 | 20 Jul 2015 | 2 Oct 2017 |
| 896 | newenglandadministrators.org | GoDaddy.com, LLC | 2 Oct 2014 | 3 Oct 2017 | 2 Oct 2018 |
| 897 | newenglandwines.us | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 1 Oct 2015 |
| 898 | newenglandmedicalmanagement.org | GoDaddy.com, LLC | 2 Oct 2014 | 3 Oct 2017 | 2 Oct 2018 |
| 899 | newenglandcraftfairs.info | NameCheap, Inc. | 5 May 2018 | 5 May 2018 | 5 May 2019 |
| 900 | newenglandbizreviews.com | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 901 | newenglandfolkmusic.mobi | GMO Internet Inc. | 3 Oct 2014 | 4 Oct 2014 | 3 Oct 2015 |
| 902 | newenglandlawncareinc.com | Tucows Domains Inc. | 30 Sep 2010 | 4 Oct 2014 | 30 Sep 2015 |
| 903 | newenglandmilkweed.com | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2018 |
| 904 | newenglandsoccerchallenge.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 905 | newenglandseacoastproperties.com | Google, Inc. | 5 Apr 2022 | 21 Mar 2025 | 5 Apr 2026 |
| 906 | newenglandrestaurantexchange.com | eNom, Inc. | 19 Nov 2014 | 25 Dec 2017 | 19 Nov 2018 |
| 907 | newenglandcashback.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 908 | newenglandah.com | GoDaddy.com, LLC | 1 Oct 2024 | 1 Oct 2024 | 1 Oct 2025 |
| 909 | newenglandclamshacks.com | GoDaddy.com, LLC | 10 Sep 2014 | 22 Oct 2024 | 10 Sep 2024 |
| 910 | newenglandlobstershacks.com | GoDaddy.com, LLC | 10 Sep 2014 | 22 Oct 2024 | 10 Sep 2024 |
| 911 | newenglandplumbingmass.com | Tucows Domains Inc. | 10 Sep 2014 | 14 Sep 2015 | 10 Sep 2016 |
| 912 | newenglandwings.info | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 913 | newenglandwings.org | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 914 | newenglandheatingcoolingandplumbing.com | Wild West Domains, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 915 | newenglandqc.com | GoDaddy.com, LLC | 1 Oct 2014 | 4 Sep 2024 | 1 Oct 2029 |
| 916 | newenglandcyclones.com | Tucows Domains Inc. | 5 Oct 2014 | 9 Oct 2019 | 5 Oct 2019 |
| 917 | newenglandhomeaccents.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Feb 2025 | 28 Feb 2025 | 28 Feb 2026 |
| 918 | newenglandmenshealth.info | GoDaddy.com, LLC | 4 Oct 2014 | 18 Nov 2024 | 4 Oct 2025 |
| 919 | newenglandstreeteats.com | eNom, Inc. | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2015 |
| 920 | newenglandteambuilding.us | 1&1 Internet AG | 4 Oct 2014 | 18 Nov 2017 | 3 Oct 2018 |
| 921 | newenglandrefugeewelcomingcenter.com | Tucows Domains Inc. | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2015 |
| 922 | newenglandfarmfresh.com | Network Solutions, LLC | 21 Sep 2014 | 19 Sep 2016 | 21 Sep 2017 |
| 923 | newenglandlighthouselovers.org | GoDaddy.com, LLC | 21 Sep 2014 | 6 Jul 2024 | 21 Sep 2029 |
| 924 | newenglandwreath.net | GoDaddy.com, LLC | 18 Nov 2014 | 19 Nov 2024 | 18 Nov 2025 |
| 925 | newenglandfreeze.org | Annulet LLC | 8 Oct 2008 | 13 Dec 2015 | 8 Oct 2017 |
| 926 | newenglandbrownswiss.org | Wild West Domains, LLC | 18 Nov 2014 | 2 Jan 2025 | 18 Nov 2026 |
| 927 | newenglandbrownswiss.net | Wild West Domains, LLC | 18 Nov 2014 | 19 Nov 2024 | 18 Nov 2026 |
| 928 | newenglandnoize.com | Tucows Domains Inc. | 2 Oct 2014 | 24 Apr 2025 | 2 Oct 2025 |
| 929 | newenglandreinsurance.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2017 |
| 930 | newenglandreinsurance.info | GoDaddy.com, LLC | 2 Oct 2014 | 14 Oct 2019 | 2 Oct 2020 |
| 931 | newenglandadministrators.com | GoDaddy.com, LLC | 2 Oct 2014 | 3 Oct 2016 | 2 Oct 2018 |
| 932 | newenglandaesthetics.com | DropCatch.com 1228 LLC | 30 May 2024 | 31 May 2024 | 30 May 2025 |
| 933 | newenglandclamchowdah.com | Tucows Domains Inc. | 30 Sep 2012 | 3 Oct 2014 | 30 Sep 2015 |
| 934 | newenglandmedicalmanagement.com | GoDaddy.com, LLC | 2 Oct 2014 | 3 Oct 2016 | 2 Oct 2018 |
| 935 | newenglandweddingfilms.com | GoDaddy.com, LLC | 3 Oct 2014 | 14 Nov 2024 | 3 Oct 2024 |
| 936 | newenglandaviationhistory.com | NameCheap, Inc. | 4 Oct 2014 | 7 Jul 2024 | 4 Oct 2026 |
| 937 | newenglandmenshealth.net | GoDaddy.com, LLC | 4 Oct 2014 | 5 Oct 2024 | 4 Oct 2025 |
| 938 | newenglandrecyclers.com | GoDaddy.com, LLC | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2019 |
| 939 | newenglandteambuilding.org | 1&1 Internet AG | 4 Oct 2014 | 18 Nov 2024 | 4 Oct 2025 |
| 940 | newenglandvettes.com | NameCheap, Inc. | 4 Oct 2014 | 6 Oct 2024 | 4 Oct 2025 |
| 941 | newenglandlaserskincenter.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 942 | newenglandleads.com | GoDaddy.com, LLC | 27 Jun 2021 | 27 Jun 2023 | 27 Jun 2025 |
| 943 | newenglandlasercenter.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 944 | newenglandprinters.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2019 |
| 945 | newenglandtalent.net | Google, Inc. | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 946 | newenglandcolorcopies.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2019 |
| 947 | newenglandpickleball.com | NameCheap, Inc. | 22 Sep 2014 | 20 Nov 2023 | 22 Sep 2025 |
| 948 | newenglandcopies.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2019 |
| 949 | newenglandhw.com | Network Solutions, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2016 |
| 950 | newenglandspecialized.com | GoDaddy.com, LLC | 8 Feb 2016 | 27 Jan 2025 | 8 Feb 2026 |
| 951 | newenglandseaglasscreations.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 952 | newenglandregional.org | Network Solutions, LLC | 23 May 2023 | 1 Mar 2025 | 23 May 2026 |
| 953 | newenglandrealestatenetwork.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 954 | newenglandmmahalloffame.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 955 | newenglandforgotten.com | Network Solutions, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 956 | newenglandfamilyeyecare.com | register.com, Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 957 | newenglanddockandboatlift.com | GoDaddy.com, LLC | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2019 |
| 958 | newenglandexecutivesolutions.com | Network Solutions, LLC | 23 Sep 2014 | 25 Jan 2018 | 23 Sep 2019 |
| 959 | newenglandapa.com | GoDaddy.com, LLC | 23 Sep 2014 | 5 Oct 2024 | 23 Sep 2026 |
| 960 | newengland-classified.com | Fabulous.com Pty Ltd. | 24 Sep 2006 | 19 Jun 2017 | 24 Sep 2018 |
| 961 | newenglandcamo.com | GoDaddy.com, LLC | 6 Oct 2014 | 7 Oct 2016 | 6 Oct 2018 |
| 962 | newenglandjobfair.com | Brandsight, Inc. | 21 Aug 2018 | 22 Jul 2024 | 21 Aug 2025 |
| 963 | newenglandneurofeedback.org | Name.com, Inc. | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 964 | newenglandchallenge.org | - | 7 Apr 2024 | 7 Apr 2025 | 7 Apr 2026 |
| 965 | newenglandhomepros.com | TLDs LLC dba SRSplus | 22 Jul 2021 | 23 Jul 2024 | 22 Jul 2025 |
| 966 | newenglandjeeppatriots.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 967 | newenglandsignrentals.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 968 | newenglandvps.com | GoDaddy.com, LLC | 8 Oct 2014 | 19 Oct 2016 | 8 Oct 2017 |
| 969 | newenglandrvrental.com | Tucows Domains Inc. | 27 Sep 2014 | 20 Sep 2024 | 27 Sep 2025 |
| 970 | newenglandexecutivesolutions.net | Network Solutions, LLC | 24 Sep 2014 | 25 Jan 2018 | 24 Sep 2019 |
| 971 | newenglandshopping.biz | GMO Internet Inc. | 24 Sep 2014 | 1 Aug 2016 | 23 Sep 2017 |
| 972 | newenglandgeographic.com | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2016 |
| 973 | newenglandmasshomes.com | GoDaddy.com, LLC | 24 Sep 2014 | 17 Sep 2022 | 24 Sep 2026 |
| 974 | newenglandpageants.com | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 975 | newenglandmortgagebanker.com | GoDaddy.com, LLC | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 976 | newenglandcustomwoodfinishing.com | Tucows Domains Inc. | 22 Nov 2014 | 26 Nov 2015 | 22 Nov 2016 |
| 977 | newenglanddronevideo.com | united-domains AG | 27 Sep 2014 | 28 Sep 2017 | 27 Sep 2018 |
| 978 | newenglanddining.com | Wild West Domains, LLC | 5 Jan 2024 | 29 Nov 2024 | 5 Jan 2026 |
| 979 | newenglandgambling.com | GoDaddy.com, LLC | 8 Oct 2014 | 9 Oct 2016 | 8 Oct 2017 |
| 980 | newenglandlive.com | Namesilo, LLC | 13 Oct 2002 | 17 Apr 2025 | 13 Oct 2025 |
| 981 | newenglandusedcars.com | Namesilo, LLC | 14 Oct 2002 | 14 Oct 2024 | 14 Oct 2025 |
| 982 | newengland511.org | Gandi SAS | 20 Nov 2014 | 22 Oct 2024 | 20 Nov 2025 |
| 983 | newenglandco.net | Wild West Domains, LLC | 21 Nov 2014 | 20 Nov 2016 | 21 Nov 2017 |
| 984 | newenglandrealtysolutions.com | Wild West Domains, LLC | 11 Feb 2021 | 11 Feb 2021 | 11 Feb 2022 |
| 985 | newenglandar.com | Network Solutions, LLC | 11 Mar 2021 | 10 Jan 2025 | 11 Mar 2026 |
| 986 | newenglandsportscomplex.com | GoDaddy.com, LLC | 27 Jul 2020 | 27 Jul 2020 | 27 Jul 2022 |
| 987 | newenglandfarmandpetsupply.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2015 |
| 988 | newenglandhomepartners.com | GoDaddy.com, LLC | 13 Mar 2025 | 13 Mar 2025 | 13 Mar 2026 |
| 989 | newenglandtubs2go.com | Jiangsu Bangning Science and technology Co. Ltd. | 17 Oct 2018 | 17 Oct 2018 | 17 Oct 2019 |
| 990 | newenglandroadtrips.com | Tucows Domains Inc. | 31 Mar 2019 | 30 Mar 2025 | 31 Mar 2026 |
| 991 | newenglandadministrativeservices.com | Tucows Domains Inc. | 7 Oct 2013 | 11 Oct 2014 | 7 Oct 2015 |
| 992 | newenglandautosdirect.com | GoDaddy.com, LLC | 10 Oct 2014 | 11 Oct 2024 | 10 Oct 2026 |
| 993 | newenglandcarsdirect.com | GoDaddy.com, LLC | 10 Oct 2014 | 11 Oct 2024 | 10 Oct 2026 |
| 994 | newenglanddairycouncilorders.com | eNom, Inc. | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2017 |
| 995 | newenglanddairycouncilorders.org | eNom, Inc. | 10 Oct 2014 | 10 Sep 2017 | 10 Oct 2018 |
| 996 | newenglandglassart.com | GoDaddy.com, LLC | 11 Oct 2014 | 12 Sep 2016 | 11 Oct 2018 |
| 997 | newenglandhoneyco.com | Domain.com, LLC | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 998 | newenglandhoneycompany.com | Google, Inc. | 4 Aug 2017 | 4 Aug 2017 | 4 Aug 2018 |
| 999 | newenglandmakeup.com | GoDaddy.com, LLC | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 1000 | newenglandoffleaseauto.com | GoDaddy.com, LLC | 10 Oct 2014 | 11 Oct 2024 | 10 Oct 2026 |
Displaying 1,000 out of 19,737 domains starting with the keyword "NEWENGLAND". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=newengland
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |