With support for 
Keyword: NEGE
Reverse Whois » KEYWORD [nege ] { 3,466 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | nege.lt | - | 28 Feb 2005 | - | 28 Feb 2027 |
| 2 | nege.cricket | Alpnames Limited | 11 Aug 2015 | - | 10 Aug 2016 |
| 3 | nege.faith | Alpnames Limited | 20 Aug 2015 | - | 19 Aug 2016 |
| 4 | nege.racing | Alpnames Limited | 25 Aug 2015 | - | 24 Aug 2016 |
| 5 | nege.info | GoDaddy.com, LLC | 24 Feb 2019 | 24 Feb 2019 | 24 Feb 2020 |
| 6 | nege.com | Dynadot, LLC | 25 Feb 1998 | 15 Jun 2025 | 24 Feb 2026 |
| 7 | nege.xyz | GMO Internet Inc. | 26 Nov 2025 | 1 Dec 2025 | 26 Nov 2026 |
| 8 | nege.club | EJEE Group Holdings Limited | 22 Nov 2015 | 29 Nov 2016 | 21 Nov 2017 |
| 9 | nege.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Feb 2017 | 21 Jun 2017 | 26 Feb 2018 |
| 10 | nege.wang | eName Technology Co., Ltd. | 20 Oct 2015 | 15 Sep 2016 | 20 Oct 2017 |
| 11 | nege.us | Uniregistrar Corp | 5 Oct 2016 | 5 Oct 2016 | 4 Oct 2017 |
| 12 | nege.net | NameCheap, Inc. | 31 Dec 2005 | 7 Dec 2025 | 31 Dec 2026 |
| 13 | nege.org | TurnCommerce, Inc. DBA NameBright.com | 9 Aug 2012 | 31 Dec 2025 | 9 Aug 2026 |
| 14 | nege.loan | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Apr 2017 | 31 Oct 2017 | 18 Apr 2018 |
| 15 | nege.ltd | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 12 Sep 2017 | 12 Sep 2017 | 12 Sep 2018 |
| 16 | nege.life | Name.com, Inc. | 6 Oct 2017 | 6 Oct 2017 | 6 Oct 2018 |
| 17 | nege.co.kr | - | 19 Nov 2014 | 28 Dec 2017 | 19 Nov 2021 |
| 18 | nege.website | Limited Liability Company "Registrar of domain nam… | 15 Dec 2021 | 17 Mar 2022 | 15 Dec 2023 |
| 19 | nege.site | Limited Liability Company "Registrar of domain nam… | 15 Dec 2021 | 18 Mar 2022 | 15 Dec 2023 |
| 20 | nege.cc | HiChina Zhicheng Technology Limited | 24 May 2021 | 25 May 2022 | 24 May 2023 |
| 21 | nege.wtf | NETIM SARL | 5 Jan 2023 | 6 Mar 2024 | 5 Jan 2024 |
| 22 | nege.one | GoDaddy.com, LLC | 20 Mar 2025 | 15 Oct 2025 | 20 Mar 2026 |
| 23 | nege.africa | Domain Name Services (Pty) Ltd | 1 Jun 2022 | 11 Jun 2023 | 1 Jun 2023 |
| 24 | nege.pt | - | - | - | - |
| 25 | nege.co.jp | - | 1 Jun 2017 | 1 Jul 2025 | - |
| 26 | nege.online | NameCheap, Inc. | 28 May 2023 | 8 Aug 2024 | 28 May 2024 |
| 27 | nege.uk | - | 3 Jun 2023 | 2 Jun 2025 | 3 Jun 2026 |
| 28 | nege.shop | Realtime Register B.V. | 5 Mar 2024 | 26 Apr 2024 | 5 Mar 2025 |
| 29 | nege.ai | GoDaddy.com, LLC | 21 Mar 2024 | 2 Apr 2025 | 21 Mar 2026 |
| 30 | nege.ru | - | 24 Dec 2019 | - | 24 Dec 2026 |
| 31 | nege.in | - | 1 Oct 2018 | 3 Sep 2025 | 1 Oct 2027 |
| 32 | nege.de | - | - | 12 Oct 2011 | - |
| 33 | nege.fr | - | 31 Dec 2025 | 5 Jan 2026 | 31 Dec 2026 |
| 34 | negemart.com | Dynadot, LLC | 15 Oct 2018 | 16 Oct 2025 | 15 Oct 2026 |
| 35 | negeriku.info | GMO Internet Inc. | 29 Apr 2024 | 29 Apr 2025 | 29 Apr 2026 |
| 36 | negens-plateform.fr | - | 2 Mar 2014 | 2 Mar 2017 | 2 Mar 2018 |
| 37 | negetics.de | - | - | 3 Nov 2008 | - |
| 38 | negerijutawan.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 39 | negeninfotech.com | NameCheap, Inc. | 3 May 2023 | 28 Apr 2025 | 3 May 2026 |
| 40 | negerimorella.com | Tucows Domains Inc. | 22 Oct 2014 | 26 Oct 2015 | 22 Oct 2016 |
| 41 | negev-new.co.il | - | - | 12 Jun 2013 | 26 Dec 2018 |
| 42 | negeorgialakeregion.com | GoDaddy.com, LLC | 22 Oct 2014 | 31 Oct 2016 | 22 Oct 2018 |
| 43 | negeorgialakeregion.info | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 44 | negeorgialakeregion.org | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 45 | negeorgialakeregion.net | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 46 | negergy.com.au | - | - | 24 Jul 2023 | - |
| 47 | negevsilica.com | GoDaddy.com, LLC | 25 May 2004 | 26 May 2015 | 25 May 2016 |
| 48 | negevpingpong.com | eNom, Inc. | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 49 | negesysfreedom.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 50 | negesysbank.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 51 | negesysmovil.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 52 | negesysmobile.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 53 | negesystv.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 54 | negesysradio.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 55 | negevasakim.com | GoDaddy.com, LLC | 31 May 2012 | 1 Jun 2015 | 31 May 2016 |
| 56 | negevasakim.info | GoDaddy.com, LLC | 31 May 2012 | 31 May 2015 | 31 May 2016 |
| 57 | negezdik.com | GoDaddy.com, LLC | 27 Oct 2014 | 18 Oct 2024 | 27 Oct 2029 |
| 58 | negesystem.com | GoDaddy.com, LLC | 5 Jun 2013 | 6 Jun 2015 | 5 Jun 2016 |
| 59 | negevtech.com | DropCatch.com 1513 LLC | 24 Mar 2023 | 25 Mar 2023 | 24 Mar 2026 |
| 60 | negenix.com | Key-Systems GmbH | 10 Feb 2013 | 28 Nov 2025 | 10 Feb 2028 |
| 61 | negeorgiahomes.com | GoDaddy.com, LLC | 20 Sep 2019 | 2 Dec 2023 | 20 Sep 2023 |
| 62 | negentien.com | Namesilo, LLC | 12 May 2022 | 15 Jun 2023 | 12 May 2023 |
| 63 | negenca.com | Regional Network Information Center, JSC dba RU-CE… | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 64 | negeno.com | NameCheap, Inc. | 8 Mar 2025 | 10 Mar 2025 | 8 Mar 2026 |
| 65 | negem.com | PSI-USA, Inc. dba Domain Robot | 23 Mar 2010 | 21 Mar 2025 | 23 Mar 2026 |
| 66 | negenserv.com | Tucows Domains Inc. | 31 Oct 2014 | 4 Nov 2017 | 31 Oct 2017 |
| 67 | negevonline.com | eNom, Inc. | 31 May 2022 | 12 Jul 2023 | 31 May 2023 |
| 68 | negevonline.net | GoDaddy.com, LLC | 17 Dec 2010 | 25 Apr 2015 | 2 Sep 2015 |
| 69 | neget.com | GoDaddy.com, LLC | 21 Nov 2020 | 6 Sep 2025 | 21 Nov 2026 |
| 70 | negear.com | GoDaddy.com, LLC | 29 Sep 2004 | 6 Mar 2025 | 29 Sep 2026 |
| 71 | negevents.com | Network Solutions, LLC | 3 Nov 2014 | 15 Dec 2025 | 3 Nov 2025 |
| 72 | negenerator.com | GoDaddy.com, LLC | 20 Sep 2009 | 21 Sep 2025 | 20 Sep 2026 |
| 73 | negennet.net | FastDomain Inc. | 16 Aug 2011 | 31 Jul 2025 | 16 Aug 2026 |
| 74 | negeriouw.com | Tucows Domains Inc. | 1 Nov 2013 | 5 Nov 2014 | 1 Nov 2015 |
| 75 | negemall.com | - | - | - | - |
| 76 | negeridongeng.net | eNom, Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 77 | negevf.com | Network Solutions, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 78 | negecirir.com | GoDaddy.com, LLC | 21 Jun 2019 | 21 Jun 2019 | 21 Jun 2020 |
| 79 | negerikertas.com | CV. Jogjacamp | 6 Feb 2015 | 8 Feb 2025 | 6 Feb 2026 |
| 80 | negersaat.com | united-domains AG | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 81 | negersamen.com | united-domains AG | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 82 | negerzaad.com | Key-Systems GmbH | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 83 | negerzaad.net | united-domains AG | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 84 | negevsoft.com | NameCheap, Inc. | 14 Aug 2014 | 15 Jul 2025 | 14 Aug 2026 |
| 85 | negengroup.com | eNom, Inc. | 8 Nov 2014 | 10 Nov 2014 | 8 Nov 2015 |
| 86 | negefox.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 87 | negestinegeste.com | eNom, Inc. | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 88 | negentotvijf.com | Key-Systems GmbH | 11 Sep 2014 | 10 Sep 2017 | 11 Sep 2018 |
| 89 | negeridibawahkabut.com | CV. Jogjacamp | 11 Sep 2014 | 12 Sep 2014 | 11 Sep 2015 |
| 90 | negeriberita.com | NetEarth One Inc. d/b/a NetEarth | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 91 | negevlb.org | Dynadot11 LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 92 | negevmonument.org | GoDaddy.com, LLC | 15 Sep 2014 | 8 Oct 2017 | 15 Sep 2018 |
| 93 | negensoft.com | GoDaddy.com, LLC | 12 Jul 2018 | 12 Jul 2018 | 12 Jul 2019 |
| 94 | negeriku.com | TurnCommerce, Inc. DBA NameBright.com | 2 Sep 2014 | 6 Apr 2022 | 2 Sep 2026 |
| 95 | negeri.info | Limited Liability Company "Registrar of domain nam… | 3 Jan 2019 | 3 Jan 2019 | 3 Jan 2020 |
| 96 | negetco.com | eNom, Inc. | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 97 | negeliyo.com | GoDaddy.com, LLC | 7 Jul 2022 | 3 Jan 2026 | 7 Jul 2026 |
| 98 | negelio.com | GoDaddy.com, LLC | 8 Apr 2020 | 20 Jun 2025 | 8 Apr 2025 |
| 99 | negerisehat.com | NameCheap, Inc. | 9 Dec 2024 | 9 Dec 2025 | 9 Dec 2025 |
| 100 | negea.com | DropCatch.com 391 LLC | 27 Apr 2025 | 26 Dec 2025 | 27 Apr 2026 |
| 101 | negerio-formuns.info | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 102 | negentropicmedia.com | NameCheap, Inc. | 3 Feb 2025 | 18 Feb 2025 | 3 Feb 2026 |
| 103 | negelectroniccigarettes.com | Namesilo, LLC | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 104 | negelebank.com | Porkbun, LLC | 25 Mar 2019 | 26 Mar 2025 | 25 Mar 2026 |
| 105 | negeda.com | TurnCommerce, Inc. DBA NameBright.com | 24 Sep 2014 | 3 Nov 2024 | 24 Sep 2024 |
| 106 | negerek.org | Everyones Internet, Ltd. dba SoftLayer | 10 Sep 2010 | 24 Sep 2014 | 10 Sep 2015 |
| 107 | negerilaut.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Nov 2014 | 23 Nov 2025 | 23 Nov 2026 |
| 108 | negemp.com | Tucows Domains Inc. | 29 Sep 2014 | 22 Sep 2017 | 29 Sep 2018 |
| 109 | negeenirani.com | CloudFlare, Inc. | 20 Sep 2023 | 3 Jul 2024 | 20 Sep 2024 |
| 110 | negevgliding.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 9 Apr 2022 | 9 Jun 2023 | 9 Apr 2023 |
| 111 | negerinlive.com | Key-Systems GmbH | 27 Sep 2014 | 27 Sep 2016 | 27 Sep 2017 |
| 112 | negerekiyor.com | IHS Telekom, Inc. | 28 Jul 2020 | 7 Oct 2024 | 28 Jul 2024 |
| 113 | negeo.com | TurnCommerce, Inc. DBA NameBright.com | 13 Oct 2014 | 7 Oct 2020 | 13 Oct 2026 |
| 114 | negerisembilanproperty.com | Netowl, Inc. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 115 | negevdl.com | 1API GmbH | 13 Oct 2014 | 26 Nov 2024 | 13 Oct 2024 |
| 116 | negenentwintigelf.com | Tucows Domains Inc. | 29 Nov 2012 | 3 Dec 2014 | 29 Nov 2015 |
| 117 | negedzerem.com | DreamHost, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 118 | negengevoel.com | Tucows Domains Inc. | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 119 | negentwaalftwee.com | Tucows Domains Inc. | 10 Dec 2013 | 14 Dec 2014 | 10 Dec 2015 |
| 120 | negeria.com | NameCheap, Inc. | 5 Aug 2024 | 5 Aug 2024 | 5 Aug 2025 |
| 121 | negebi.com | Xin Net Technology Corporation | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 122 | negeriseribupulau.com | Tucows Domains Inc. | 18 Dec 2014 | 22 Dec 2017 | 18 Dec 2017 |
| 123 | negeng.com | Namesilo, LLC | 1 Nov 2025 | 1 Dec 2025 | 1 Nov 2026 |
| 124 | negeraanzee.com | Tucows Domains Inc. | 19 Dec 2013 | 23 Dec 2014 | 19 Dec 2015 |
| 125 | negev-new.com | Domain The Net Technologies Ltd. | 21 Feb 2017 | 7 Jan 2025 | 21 Feb 2027 |
| 126 | negeriawan.com | - | 3 Mar 2023 | 4 Mar 2024 | 3 Mar 2025 |
| 127 | negeorgialibraries.com | DropCatch.com 1513 LLC | 20 Mar 2018 | 20 Mar 2018 | 20 Mar 2019 |
| 128 | neger.tips | Key-Systems, LLC | 2 Jul 2014 | 2 Jul 2017 | 2 Jul 2018 |
| 129 | neger.support | Key-Systems, LLC | 2 Jul 2014 | 10 Jul 2017 | 2 Jul 2017 |
| 130 | neger.solutions | Porkbun, LLC | 3 Jan 2018 | 8 Jan 2018 | 3 Jan 2019 |
| 131 | neger.events | Key-Systems, LLC | 2 Jul 2014 | 10 Jul 2017 | 2 Jul 2017 |
| 132 | negearthlights.lighting | eNom, Inc. | 27 Jun 2014 | 25 Jun 2025 | - |
| 133 | negearth.lighting | eNom, Inc. | 26 Jun 2014 | 24 Jun 2025 | - |
| 134 | negev.clinic | GoDaddy.com, LLC | 7 Sep 2014 | 22 Oct 2025 | 7 Sep 2026 |
| 135 | negezio.com | FBS Inc. | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 136 | negentech.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 11 Mar 2024 | 12 Mar 2025 | 11 Mar 2026 |
| 137 | negears.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Aug 2015 | 9 Aug 2024 | 11 Aug 2026 |
| 138 | negerboll.glass | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 28 Oct 2014 | 29 Sep 2017 | 28 Oct 2018 |
| 139 | negenduust.gent | Register NV dba Register.eu | 26 Apr 2021 | 27 Apr 2025 | 26 Apr 2026 |
| 140 | negele.international | Cronon AG | 14 Jan 2015 | 28 Feb 2017 | 14 Jan 2018 |
| 141 | negele.email | Cronon AG | 14 Jan 2015 | 28 Feb 2020 | 14 Jan 2021 |
| 142 | negerikita.website | NameCheap, Inc. | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 143 | negej.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 144 | negentropie-mmm.ovh | OVH sas | 1 Apr 2015 | 1 Apr 2017 | 1 Apr 2018 |
| 145 | negev-kitchens.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 146 | negetirdin.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 1 Mar 2018 | 11 Apr 2024 | 1 Mar 2024 |
| 147 | negeru.science | Alpnames Limited | 30 Apr 2015 | - | 29 Apr 2016 |
| 148 | negerekse.com | - | 27 Jan 2025 | 29 Oct 2025 | 27 Jan 2027 |
| 149 | negetecloud.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2017 |
| 150 | negendanck.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Aug 2015 | 11 Aug 2025 | 14 Aug 2026 |
| 151 | negeon.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Nov 2016 | 28 Nov 2017 | 27 Nov 2017 |
| 152 | negepac.org | Domain.com, LLC | 2 Nov 2001 | 10 Jan 2015 | 2 Nov 2015 |
| 153 | negedurwc.com | DreamHost, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 154 | negedu-rwc.com | eNom, Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 155 | negeorgiahomeinspector.com | Tucows Domains Inc. | 11 Jan 2013 | 15 Jan 2015 | 11 Jan 2016 |
| 156 | negerimakmursentosa.com | Tucows Domains Inc. | 13 Jan 2014 | 17 Jan 2015 | 13 Jan 2016 |
| 157 | negenstraatjes.amsterdam | Metaregistrar BV Applications | 29 May 2015 | 29 May 2025 | 29 May 2026 |
| 158 | negerin.pics | DNC Holdings, Inc. | 26 Jun 2015 | 5 Jun 2025 | 26 Jun 2026 |
| 159 | negex.exchange | 1&1 Internet AG | 16 Aug 2015 | 6 Jan 2017 | 16 Aug 2017 |
| 160 | negedae.club | Alpnames Limited | 19 Sep 2016 | 19 Sep 2017 | 18 Sep 2017 |
| 161 | negei.top | Bizcn.com, Inc. | 17 Jul 2015 | 18 Jul 2017 | 17 Jul 2018 |
| 162 | neger.black | united-domains AG | 28 Jul 2015 | - | 28 Jul 2016 |
| 163 | negenduizend.gent | Register NV dba Register.eu | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 164 | negellar.review | Alpnames Limited | 6 Aug 2015 | - | 5 Aug 2016 |
| 165 | negellar.faith | Alpnames Limited | 6 Aug 2015 | - | 5 Aug 2016 |
| 166 | negellar.date | Alpnames Limited | 6 Aug 2015 | - | 5 Aug 2016 |
| 167 | negelmis.com | IHS Telekom, Inc. | 22 Nov 2021 | 27 Jan 2026 | 22 Nov 2026 |
| 168 | negevrising.com | GoDaddy.com, LLC | 20 Jan 2015 | 21 Jan 2026 | 20 Jan 2027 |
| 169 | negee.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 18 Jan 2012 | 14 Jan 2026 | 18 Jan 2027 |
| 170 | negevrising.org | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 171 | negerekvar.net | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 27 Jun 2019 | 27 Jun 2019 | 27 Jun 2020 |
| 172 | negeradores.com | Tucows Domains Inc. | 30 Jan 2015 | 3 Feb 2016 | 30 Jan 2017 |
| 173 | negeribuku.com | CV. Jogjacamp | 1 Aug 2018 | 1 Aug 2018 | 1 Aug 2019 |
| 174 | negeregivar.com | Tucows Domains Inc. | 2 Feb 2015 | 6 Feb 2016 | 2 Feb 2017 |
| 175 | negeri9.com | Tucows Domains Inc. | 5 Feb 2015 | 8 Sep 2025 | 5 Feb 2026 |
| 176 | negenitsolutions.com | Name.com, Inc. | 10 Feb 2015 | 3 Nov 2023 | 10 Feb 2033 |
| 177 | negenitsolutions.net | Name.com, Inc. | 10 Feb 2015 | 19 Jan 2025 | 10 Feb 2026 |
| 178 | negetitbrc.com | register.com, Inc. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 179 | negenentwintig.com | Tucows Domains Inc. | 13 Feb 2013 | 17 Feb 2015 | 13 Feb 2016 |
| 180 | negerbollen.com | Name.com, Inc. | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 181 | negerigowes.com | Web Commerce Communications Limited dba WebNic.cc | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 182 | negeribeta.com | NameCheap, Inc. | 27 Dec 2025 | 27 Dec 2025 | 27 Dec 2026 |
| 183 | negerastanyarn.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Dec 2018 | 17 Dec 2018 | 17 Dec 2019 |
| 184 | negeo.net | - | 13 Oct 2016 | 13 Oct 2016 | 13 Oct 2017 |
| 185 | negeri.net | NameCheap, Inc. | 26 Feb 2025 | 26 Feb 2025 | 26 Feb 2026 |
| 186 | negevproject.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2018 |
| 187 | negevproject.org | GoDaddy.com, LLC | 30 Nov 2023 | 11 Jan 2025 | 30 Nov 2024 |
| 188 | negevproject.net | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2017 |
| 189 | negevproject.info | GoDaddy.com, LLC | 27 Feb 2015 | - | 27 Feb 2017 |
| 190 | negenergy.com | Hosting Concepts B.V. dba Openprovider | 31 Aug 2020 | 31 Aug 2020 | 31 Aug 2021 |
| 191 | negentigtien.com | Key-Systems GmbH | 5 Mar 2015 | 28 Nov 2025 | 5 Mar 2026 |
| 192 | negegvdirect.com | eNom, Inc. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 193 | negeriimpian.com | CV. Jogjacamp | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 194 | negeriau.net | Dynadot, LLC | 2 Feb 2022 | 2 Feb 2022 | 2 Feb 2023 |
| 195 | negevist.com | Domain.com, LLC | 1 Sep 2019 | 2 Sep 2019 | 1 Sep 2020 |
| 196 | negert.com | - | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2017 |
| 197 | negeorgiamediation.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2017 |
| 198 | negetivepictures.com | register.com, Inc. | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 199 | negeripasir.com | Tucows Domains Inc. | 6 Mar 2014 | 10 Mar 2017 | 6 Mar 2017 |
| 200 | negeriroadstone.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 201 | negereethiopia.com | Wild West Domains, LLC | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 202 | negevrest.com | FastDomain Inc. | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 203 | negelecek.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Mar 2015 | 21 Apr 2017 | 19 Mar 2018 |
| 204 | negeekexpo.com | register.com, Inc. | 19 Mar 2015 | 4 Mar 2017 | 19 Mar 2018 |
| 205 | negeritembakau.com | GoDaddy.com, LLC | 12 Jun 2017 | 12 Jun 2017 | 12 Jun 2018 |
| 206 | negeenrestaurant.net | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 207 | negeendehesh.com | GoDaddy.com, LLC | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 208 | negeensanat.com | REALTIME REGISTER BV | 19 Jun 2016 | 19 Jun 2016 | 19 Jun 2017 |
| 209 | negei.com | GoDaddy.com, LLC | 12 Sep 2021 | 12 Sep 2025 | 12 Sep 2026 |
| 210 | neger.info | One.com A/S | 5 Dec 2025 | 5 Dec 2025 | 5 Dec 2026 |
| 211 | negerf.com | Xiamen ChinaSource Internet Service Co., Ltd. | 7 Sep 2022 | 12 Nov 2023 | 7 Sep 2023 |
| 212 | negericpa.com | Domaintimemachine.com LLC | 21 Jun 2016 | 5 Jul 2017 | 21 Jun 2018 |
| 213 | negeblog.com | eNom, Inc. | 4 Apr 2015 | 4 Apr 2015 | 4 Apr 2016 |
| 214 | negemlab.net | Tucows Domains Inc. | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2017 |
| 215 | negestyle.com | Wix.com Ltd. | 3 Jun 2020 | 10 May 2024 | 3 Jun 2026 |
| 216 | negevcouncil.org | GoDaddy.com, LLC | 6 Apr 2015 | 23 May 2025 | 6 Apr 2026 |
| 217 | negeriaffiliate.com | PT Ardh Global Indonesia | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2016 |
| 218 | negentropycollective.com | eNom, Inc. | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2016 |
| 219 | negetireyim.com | GoDaddy.com, LLC | 25 Apr 2019 | 6 Jun 2025 | 25 Apr 2025 |
| 220 | negevzoo.com | DNSPod, Inc. | 5 Jul 2021 | 6 Jul 2021 | 5 Jul 2022 |
| 221 | negevjudaica.com | - | 12 Jul 2016 | 12 Jul 2016 | 12 Jul 2017 |
| 222 | negelsin.com | Tucows Domains Inc. | 14 Apr 2014 | 15 Apr 2025 | 14 Apr 2026 |
| 223 | negentiendrieentachtig.com | Mijn InternetOplossing B.V. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 224 | negetti.com | - | - | - | - |
| 225 | negentropics.com | GoDaddy.com, LLC | 28 Apr 2015 | 29 Apr 2025 | 28 Apr 2026 |
| 226 | negentropics.biz | GoDaddy.com, LLC | 28 Apr 2015 | 7 Apr 2020 | 27 Apr 2021 |
| 227 | negentropics.org | GoDaddy.com, LLC | 28 Apr 2015 | 29 Apr 2017 | 28 Apr 2018 |
| 228 | negevlightopera.net | GoDaddy.com, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 229 | negere.com | OnlineNIC, Inc. | 30 Apr 2015 | 21 Jun 2023 | 30 Apr 2028 |
| 230 | negelecsa.com | NameCheap, Inc. | 16 Dec 2024 | 16 Dec 2025 | 16 Dec 2026 |
| 231 | negeorgiahousingsolutions.com | GoDaddy.com, LLC | 4 May 2015 | 15 Jul 2025 | 4 May 2025 |
| 232 | negeldi.info | GoDaddy.com, LLC | 6 May 2015 | - | 6 May 2016 |
| 233 | negeldi.com | Ä°simtescil BiliÅŸim A.Åž. | 2 Jan 2021 | 25 Dec 2025 | 2 Jan 2027 |
| 234 | negeldi.org | GoDaddy.com, LLC | 6 May 2015 | 6 May 2015 | 6 May 2016 |
| 235 | negeldi.net | Ä°simtescil BiliÅŸim A.Åž. | 19 Mar 2024 | 2 May 2025 | 19 Mar 2025 |
| 236 | negerikita.org | Hosting Concepts B.V. dba Openprovider | 2 May 2020 | 7 Jul 2025 | 2 May 2026 |
| 237 | negerihijau.com | Hostinger, UAB | 3 Mar 2025 | 3 Mar 2025 | 3 Mar 2026 |
| 238 | negevlivingnetworks.com | GoDaddy.com, LLC | 17 May 2015 | 17 May 2015 | 17 May 2017 |
| 239 | negevlivingnetworks.net | GoDaddy.com, LLC | 17 May 2015 | 17 May 2015 | 17 May 2016 |
| 240 | negevlivingnetworks.info | GoDaddy.com, LLC | 17 May 2015 | 18 May 2015 | 17 May 2016 |
| 241 | negevnetworks.com | GoDaddy.com, LLC | 18 May 2015 | 29 Jun 2025 | 18 May 2025 |
| 242 | negeribebek.com | CV. Rumahweb Indonesia | 21 May 2015 | 21 May 2015 | 21 May 2016 |
| 243 | negerikuindonesia.com | NameCheap, Inc. | 21 May 2015 | 21 Apr 2025 | 21 May 2026 |
| 244 | negeridiatasawan.com | Web Commerce Communications Limited dba WebNic.cc | 21 Aug 2018 | 21 Aug 2018 | 21 Aug 2027 |
| 245 | negeritogel.com | NameCheap, Inc. | 12 May 2025 | 12 May 2025 | 12 May 2026 |
| 246 | negev-incense.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 May 2015 | 2 Aug 2025 | 22 May 2025 |
| 247 | negeu2cj1.com | GMO Internet Inc. | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 248 | negerikita.net | - | 28 May 2015 | 3 Feb 2025 | 28 May 2026 |
| 249 | negeldeco.com | Realtime Register B.V. | 26 Apr 2011 | 31 May 2015 | 26 Apr 2016 |
| 250 | negenealogists.com | GoDaddy.com, LLC | 1 Jun 2015 | 2 Jun 2025 | 1 Jun 2026 |
| 251 | negev.info | Google, Inc. | 2 Jul 2021 | 23 Jun 2025 | 2 Jul 2026 |
| 252 | negearth.biz | Tucows Domains Inc. | 1 Jun 2012 | 1 Jun 2012 | 31 May 2016 |
| 253 | negelsin.net | FBS Inc. | 2 Jun 2015 | 13 Jul 2017 | 2 Jun 2017 |
| 254 | negezdikbe.com | Automattic Inc. | 19 Nov 2019 | 24 Nov 2025 | 19 Nov 2026 |
| 255 | negeonomics.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 256 | negerisembilansearch.com | Shinjiru MSC Sdn Bhd | 15 Jun 2015 | 26 Jul 2024 | 15 Jun 2024 |
| 257 | negezdim.com | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 258 | negeyofacoop.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 259 | negeensm.com | Network Solutions, LLC | 23 Jun 2015 | 6 Jul 2017 | 23 Jun 2018 |
| 260 | negerisembilanseek.com | IP Mirror Pte Ltd dba IP MIRROR | 23 Jun 2015 | 24 Jun 2015 | 23 Jun 2016 |
| 261 | negerisembilanrestaurant.com | IP Mirror Pte Ltd dba IP MIRROR | 23 Jun 2015 | 24 Jun 2015 | 23 Jun 2016 |
| 262 | negerisembilanprop.com | IP Mirror Pte Ltd dba IP MIRROR | 23 Jun 2015 | 24 Jun 2015 | 23 Jun 2016 |
| 263 | negerisembilanmotor.com | IP Mirror Pte Ltd dba IP MIRROR | 23 Jun 2015 | 24 Jun 2015 | 23 Jun 2016 |
| 264 | negerisembilanhotel.com | IP Mirror Pte Ltd dba IP MIRROR | 23 Jun 2015 | 24 Jun 2015 | 23 Jun 2016 |
| 265 | negeocaching.com | Megazone Corp., dba HOSTING.KR | 13 Jan 2024 | 16 Jan 2026 | 13 Jan 2026 |
| 266 | negestisheba.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 267 | negentropycapital.com | Webfusion Ltd. | 23 Jun 2010 | 27 Nov 2025 | 23 Jun 2026 |
| 268 | negemco-jo.com | Tucows Domains Inc. | 2 Jan 2025 | 6 Jan 2026 | 2 Jan 2027 |
| 269 | negeno.net | Tucows Domains Inc. | 22 Sep 2015 | 26 Sep 2020 | 22 Sep 2020 |
| 270 | negenstraatjes.com | - | 7 May 2024 | 29 May 2025 | 7 May 2026 |
| 271 | negevhighlandtrail.com | - | 8 Jan 2024 | 21 Feb 2025 | 8 Jan 2025 |
| 272 | negevgastro.com | Tucows Domains Inc. | 8 Jul 2015 | 12 Jul 2018 | 8 Jul 2018 |
| 273 | negenergia.com | GoDaddy.com, LLC | 1 Mar 2022 | 12 Apr 2023 | 1 Mar 2023 |
| 274 | negev-soft.com | GoDaddy.com, LLC | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2017 |
| 275 | negenminutentestament.com | 1&1 Internet AG | 11 Jul 2015 | 12 Jul 2017 | 11 Jul 2018 |
| 276 | negeval.com | Domain The Net Technologies Ltd. | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2016 |
| 277 | negeriinspirasi.com | Hostinger, UAB | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2016 |
| 278 | negerekir.com | Wix.com Ltd. | 6 Dec 2025 | 6 Dec 2025 | 6 Dec 2026 |
| 279 | negenzohar.com | GoDaddy.com, LLC | 25 Jul 2015 | 26 Jul 2024 | 25 Jul 2026 |
| 280 | negearth.net | - | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2017 |
| 281 | negevcompany.com | DNC Holdings, Inc. | 12 Feb 2020 | 26 Apr 2025 | 12 Feb 2025 |
| 282 | negev-woodschool.com | Tucows Domains Inc. | 3 Aug 2015 | 7 Aug 2022 | 3 Aug 2022 |
| 283 | negelir.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 1 Jun 2025 | 1 Jun 2025 | 1 Jun 2026 |
| 284 | negelir.net | IHS Telekom, Inc. | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2016 |
| 285 | negelirse.net | Ä°simtescil BiliÅŸim A.Åž. | 21 Sep 2023 | 3 Nov 2024 | 21 Sep 2024 |
| 286 | negevsolutions.com | GoDaddy.com, LLC | 3 Oct 2015 | 3 Oct 2015 | 3 Oct 2017 |
| 287 | negev-tech.com | Network Solutions, LLC | 9 Aug 2015 | 7 Aug 2016 | 9 Aug 2017 |
| 288 | negerpikken.com | Internet Domain Services BS Corp | 8 Dec 2017 | 8 Dec 2017 | 8 Dec 2018 |
| 289 | negefi.com | GoDaddy.com, LLC | 5 Oct 2015 | 6 Oct 2025 | 5 Oct 2026 |
| 290 | negentertainment.org | Cronon AG | 6 Oct 2015 | - | 6 Oct 2016 |
| 291 | negev-hotel.com | eNom, Inc. | 7 Oct 2015 | 23 Aug 2021 | 7 Oct 2026 |
| 292 | negena.com | - | 11 May 2021 | 31 May 2025 | 11 May 2026 |
| 293 | negevherbals.com | GoDaddy.com, LLC | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2017 |
| 294 | negeorgiaappraisals.com | Wild West Domains, LLC | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 295 | negeeshut.com | Domain The Net Technologies Ltd. | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 296 | negerhosting.xyz | NameCheap, Inc. | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 297 | negeripenghafalquran.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 298 | negeriku.net | - | 16 Nov 2021 | 17 Nov 2023 | 16 Nov 2025 |
| 299 | neger.com | NameCheap, Inc. | 26 Apr 2003 | 5 Jun 2022 | 26 Apr 2031 |
| 300 | negeriperubahan.xyz | Hostinger, UAB | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 301 | negeorgiamfr.com | NameCheap, Inc. | 19 Mar 2022 | 17 Feb 2025 | 19 Mar 2026 |
| 302 | negeorgiahistorycenter.com | Tucows Domains Inc. | 19 Oct 2011 | 23 Oct 2015 | 19 Oct 2016 |
| 303 | negeosystems.com | GoDaddy.com, LLC | 24 Oct 2015 | 25 Oct 2025 | 24 Oct 2027 |
| 304 | negev-guesthouse.com | 1&1 Internet AG | 30 Oct 2015 | 31 Oct 2016 | 30 Oct 2017 |
| 305 | negevtoursil.com | GoDaddy.com, LLC | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 306 | negetirim.com | eNom, Inc. | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 307 | negetiv.net | GMO Internet Inc. | 23 Jan 2017 | 23 Nov 2017 | 22 Jan 2019 |
| 308 | negebproperties.com | Tucows Domains Inc. | 13 Nov 2015 | 17 Nov 2016 | 13 Nov 2016 |
| 309 | negelirelden.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 310 | negenius.com | GoDaddy.com, LLC | 19 Nov 2015 | 19 Nov 2025 | 19 Nov 2026 |
| 311 | negelectedrenderings.com | GoDaddy.com, LLC | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2016 |
| 312 | negeribola.com | Hosting Concepts B.V. dba Openprovider | 14 Nov 2020 | 14 Nov 2020 | 14 Nov 2021 |
| 313 | negev.club | EJEE Group Holdings Limited | 25 Nov 2015 | 30 Dec 2017 | 24 Nov 2017 |
| 314 | negeb.club | EJEE Group Holdings Limited | 25 Nov 2015 | 30 Dec 2017 | 24 Nov 2017 |
| 315 | negeriarab.com | CV. Jogjacamp | 25 Nov 2015 | 24 Nov 2016 | 25 Nov 2017 |
| 316 | negeziyorum.com | Wix.com Ltd. | 29 Sep 2020 | 3 Oct 2022 | 29 Sep 2022 |
| 317 | negev-eng.com | NameCheap, Inc. | 23 Feb 2021 | 6 Apr 2025 | 23 Feb 2025 |
| 318 | negendo.com | Name Connection Area LLC | 3 Feb 2022 | 3 Feb 2022 | 3 Feb 2023 |
| 319 | negeri.org | CV. Rumahweb Indonesia | 17 Dec 2025 | 17 Dec 2025 | 17 Dec 2026 |
| 320 | negeorgiafitbodybootcamp.com | GoDaddy.com, LLC | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2017 |
| 321 | negerikaos.com | Web Commerce Communications Limited dba WebNic.cc | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 322 | negeva.com | TurnCommerce, Inc. DBA NameBright.com | 12 Feb 2022 | 24 Apr 2025 | 12 Feb 2025 |
| 323 | negeorgiahomesales.com | eNom, Inc. | 9 Dec 2015 | 25 Nov 2016 | 9 Dec 2017 |
| 324 | negeb.com | PSI-USA, Inc. dba Domain Robot | 13 May 2018 | 30 May 2025 | 13 May 2026 |
| 325 | negeospatial.com | GoDaddy.com, LLC | 13 Nov 2017 | 25 Jan 2024 | 13 Nov 2023 |
| 326 | negewo.com | GoDaddy.com, LLC | 17 Dec 2015 | 17 Dec 2015 | 17 Dec 2016 |
| 327 | negevfootball.org | Chengdu West Dimension Digital Technology Co., Ltd… | 21 Dec 2015 | - | 21 Dec 2016 |
| 328 | negev.rocks | Name.com, Inc. | 22 Dec 2015 | 10 Jan 2017 | 22 Dec 2017 |
| 329 | negemi.xyz | NameCheap, Inc. | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 330 | negevco.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Mar 2021 | 19 Mar 2021 | 19 Mar 2022 |
| 331 | negev-cellular.com | 1&1 Internet AG | 31 Dec 2015 | 12 Jan 2017 | 31 Dec 2017 |
| 332 | negei.loan | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Apr 2017 | 31 Oct 2017 | 18 Apr 2018 |
| 333 | negedly.xyz | NameCheap, Inc. | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 334 | negeve.com | OVH sas | 6 Jan 2016 | 7 Jan 2025 | 6 Jan 2027 |
| 335 | negedent.com | GoDaddy.com, LLC | 11 Jan 2016 | 20 Nov 2025 | 11 Jan 2026 |
| 336 | negerinnensexdatingnow.date | Alpnames Limited | 10 Jan 2016 | 10 Jan 2016 | 9 Jan 2017 |
| 337 | negev.top | Alpnames Limited | 10 Jan 2016 | 10 Jan 2016 | 10 Jan 2017 |
| 338 | negeribaruhotel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 339 | negev-quants.com | Launchpad, Inc. | 14 Jan 2016 | 15 Mar 2016 | 14 Jan 2019 |
| 340 | negerabank.com | Kheweul.com SA | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 341 | negeorgiafca.org | - | 17 Apr 2025 | 22 Apr 2025 | 17 Apr 2026 |
| 342 | negendary.com | Tucows Domains Inc. | 9 Mar 2018 | 13 Mar 2019 | 9 Mar 2019 |
| 343 | negerikuindah.com | Namesilo, LLC | 2 Feb 2016 | 7 Jan 2026 | 2 Feb 2026 |
| 344 | negeorgiaswapmeet.com | GoDaddy.com, LLC | 4 Feb 2016 | 4 Feb 2025 | 4 Feb 2026 |
| 345 | negeocachingsupplies.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Feb 2016 | 24 Jan 2025 | 3 Feb 2026 |
| 346 | negerekirse.com | 1&1 Internet AG | 5 Feb 2016 | 19 Mar 2017 | 5 Feb 2018 |
| 347 | negerilaskarpelangi.com | Hostinger, UAB | 7 Feb 2016 | 7 Jan 2026 | 7 Feb 2026 |
| 348 | negevworks.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Feb 2016 | 9 Apr 2016 | 8 Feb 2018 |
| 349 | negevworks.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Feb 2016 | 9 Apr 2016 | 8 Feb 2018 |
| 350 | negevworks.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Feb 2016 | 9 Apr 2016 | 8 Feb 2018 |
| 351 | neger.xyz | GMO Internet Inc. | 20 Sep 2025 | 25 Sep 2025 | 20 Sep 2026 |
| 352 | negerinnen.net | Hosting Concepts B.V. dba Openprovider | 30 Jan 2019 | 19 Jul 2025 | 30 Jan 2026 |
| 353 | negerikita.info | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Feb 2016 | 8 Feb 2025 | 20 Feb 2026 |
| 354 | nege4.com | GMO Internet Inc. | 24 Feb 2016 | 6 Feb 2017 | 24 Feb 2018 |
| 355 | negen.xyz | GMO Internet Inc. | 17 Jun 2024 | 18 Jun 2025 | 17 Jun 2026 |
| 356 | negen.site | - | 18 May 2025 | 21 Jun 2025 | 18 May 2026 |
| 357 | negeye.loan | Alpnames Limited | 1 Mar 2016 | - | 28 Feb 2017 |
| 358 | negentem.com | Network Solutions, LLC | 1 Mar 2016 | 27 Feb 2017 | 1 Mar 2018 |
| 359 | negenweb.info | Network Solutions, LLC | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 360 | negex.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 3 Mar 2016 | 27 Aug 2025 | 3 Mar 2027 |
| 361 | negerimalaysia.com | NameCheap, Inc. | 4 Apr 2024 | 5 Mar 2025 | 4 Apr 2026 |
| 362 | negeig.accountant | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Mar 2016 | - | 1 Mar 2017 |
| 363 | negendrieeen.org | Tucows Domains Inc. | 9 Mar 2016 | 13 Mar 2017 | 9 Mar 2018 |
| 364 | negendrieeen.net | Tucows Domains Inc. | 9 Mar 2016 | 13 Mar 2017 | 9 Mar 2017 |
| 365 | negendrieeen.info | Tucows Domains Inc. | 9 Mar 2016 | 13 Mar 2017 | 9 Mar 2018 |
| 366 | negendrieeen.biz | Tucows Domains Inc. | 9 Mar 2016 | 12 Mar 2017 | 8 Mar 2017 |
| 367 | negeso-seo.com | GMO Internet Inc. | 29 Jun 2017 | 18 Jul 2017 | 29 Jun 2018 |
| 368 | negendrieeen.com | Tucows Domains Inc. | 9 Mar 2016 | 13 Mar 2017 | 9 Mar 2017 |
| 369 | negeriatasangin.com | CV. Jogjacamp | 10 Mar 2016 | 10 Mar 2016 | 10 Mar 2017 |
| 370 | negevlight.com | 1&1 Internet AG | 13 Mar 2016 | 16 Mar 2018 | 13 Mar 2026 |
| 371 | negeorgiateameas.com | Melbourne IT, Ltd | 13 Mar 2016 | 13 Mar 2016 | 13 Mar 2017 |
| 372 | negeridigital.com | Hostinger, UAB | 25 May 2024 | 11 Apr 2025 | 25 May 2027 |
| 373 | negeenmakeup.com | GoDaddy.com, LLC | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 374 | negen.style | GoDaddy.com, LLC | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 375 | negerisembilantrails.com | Tucows Domains Inc. | 18 Mar 2016 | 22 Mar 2018 | 18 Mar 2018 |
| 376 | negerisembilanhalalexpo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2017 |
| 377 | negetiriyoz.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Mar 2016 | 8 Mar 2017 | 18 Mar 2018 |
| 378 | negev.com | Wild West Domains, LLC | 13 Mar 1996 | 14 Mar 2025 | 14 Mar 2026 |
| 379 | negerinnen-sexdating.accountant | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Mar 2016 | 21 Mar 2016 | 20 Mar 2017 |
| 380 | negetiriyoruz.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Mar 2016 | 3 Apr 2017 | 21 Mar 2018 |
| 381 | negeri-sehat.com | Web Commerce Communications Limited dba WebNic.cc | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 382 | negeri.top | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Mar 2016 | 30 Dec 2016 | 23 Mar 2018 |
| 383 | negeri-sehat.net | Web Commerce Communications Limited dba WebNic.cc | 24 Mar 2016 | 24 Mar 2016 | 24 Mar 2017 |
| 384 | negevpost.com | GoDaddy.com, LLC | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 385 | negeth.com | GoDaddy.com, LLC | 13 Nov 2022 | 25 Jan 2024 | 13 Nov 2023 |
| 386 | negerikaya.com | Zhengzhou Century Connect Electronic Technology De… | 29 Nov 2019 | 30 Nov 2019 | 29 Nov 2020 |
| 387 | negeco.com | InterNetworX Ltd. & Co. KG | 9 Sep 2024 | 16 Dec 2025 | 9 Sep 2026 |
| 388 | negele.xyz | NameCheap, Inc. | 2 Apr 2016 | 1 Apr 2025 | 2 Apr 2026 |
| 389 | negele.website | NameCheap, Inc. | 12 Jan 2026 | 22 Jan 2026 | 12 Jan 2027 |
| 390 | negele.online | Cronon AG | 27 Aug 2024 | 3 Dec 2025 | 27 Aug 2026 |
| 391 | negele.family | NameCheap, Inc. | 2 Apr 2016 | 8 Mar 2025 | 2 Apr 2026 |
| 392 | negetfiley.com | eNom, Inc. | 2 Apr 2016 | 2 Apr 2016 | 2 Apr 2017 |
| 393 | negele.top | NameCheap, Inc. | 2 Apr 2016 | 2 Apr 2016 | 2 Apr 2017 |
| 394 | negevsol.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Apr 2016 | 7 Jan 2025 | 5 Apr 2026 |
| 395 | negentreopy.com | DreamHost, LLC | 4 Apr 2016 | 4 Apr 2016 | 4 Apr 2017 |
| 396 | neges.top | Alpnames Limited | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 397 | negezi.com | NameCheap, Inc. | 12 Feb 2020 | 13 Feb 2025 | 12 Feb 2026 |
| 398 | negel.com.br | - | 4 Feb 2009 | 27 May 2025 | 4 Feb 2031 |
| 399 | negerbauer.com | GoDaddy.com, LLC | 13 Apr 2016 | 13 Apr 2016 | 13 Apr 2017 |
| 400 | negeriku.xyz | Hostinger, UAB | 15 Apr 2016 | 15 Jun 2016 | 15 Apr 2017 |
| 401 | negerilangit.com | Google, Inc. | 19 Dec 2019 | 19 Dec 2019 | 19 Dec 2020 |
| 402 | negerijambi.info | - | 16 Apr 2016 | 16 Apr 2016 | 16 Apr 2017 |
| 403 | negeleknight.com | DropCatch.com 1342 LLC | 3 Jul 2018 | 3 Jul 2018 | 3 Jul 2019 |
| 404 | negeleknight.org | GoDaddy.com, LLC | 16 Apr 2016 | 15 Jun 2016 | 16 Apr 2018 |
| 405 | negeenandkouros.com | Tucows Domains Inc. | 20 Apr 2016 | 5 Apr 2025 | 20 Apr 2026 |
| 406 | negerefej.com | Cosmotown, Inc. | 21 Jul 2025 | 21 Jul 2025 | 21 Jul 2026 |
| 407 | negeorgianews.com | GoDaddy.com, LLC | 23 Apr 2016 | 23 Apr 2016 | 23 Apr 2017 |
| 408 | negerek.net | FBS Inc. | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 409 | negevarts.com | GoDaddy.com, LLC | 15 Oct 2017 | 16 Oct 2024 | 15 Oct 2026 |
| 410 | negeos.com | GoDaddy.com, LLC | 30 Apr 2016 | 1 May 2025 | 30 Apr 2026 |
| 411 | negeriakhirat.com | CV. Jogjacamp | 28 Aug 2023 | 4 Oct 2024 | 28 Aug 2024 |
| 412 | negeenmoussavian.com | GoDaddy.com, LLC | 2 May 2016 | 2 May 2016 | 2 May 2017 |
| 413 | negemlaw.lawyer | GoDaddy.com, LLC | 3 May 2016 | 14 Jul 2025 | 3 May 2025 |
| 414 | negemlaw.attorney | GoDaddy.com, LLC | 3 May 2016 | 14 Jul 2025 | 3 May 2025 |
| 415 | negemlaw.legal | GoDaddy.com, LLC | 3 May 2016 | 14 Jul 2025 | 3 May 2025 |
| 416 | negem.legal | GoDaddy.com, LLC | 3 May 2016 | 14 Jul 2025 | 3 May 2025 |
| 417 | negein.com | GoDaddy.com, LLC | 3 May 2016 | 3 May 2016 | 3 May 2017 |
| 418 | negerapos.top | Alpnames Limited | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 419 | negenics.com | GoDaddy.com, LLC | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 420 | neger.ninja | GoDaddy.com, LLC | 13 May 2016 | 12 May 2024 | 13 May 2024 |
| 421 | negeendargahi.com | Beijing Lanhai Jiye Technology Co., Ltd | 24 Dec 2024 | 8 Jan 2026 | 24 Dec 2026 |
| 422 | negeds.top | Alpnames Limited | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 423 | negentropymetasystems.net | GoDaddy.com, LLC | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 424 | negentropy-metasystems.net | GoDaddy.com, LLC | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 425 | negentropymetasystems.com | GoDaddy.com, LLC | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 426 | negentropy-metasystems.com | GoDaddy.com, LLC | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 427 | negeren.com | TurnCommerce, Inc. DBA NameBright.com | 21 May 2016 | 2 Aug 2024 | 21 May 2024 |
| 428 | negentropy-metasystems.xyz | GoDaddy.com, LLC | 18 May 2016 | 27 Jun 2016 | 18 May 2017 |
| 429 | negebi.top | Alpnames Limited | 15 May 2016 | 15 May 2016 | 15 May 2017 |
| 430 | negev.online | NameCheap, Inc. | 4 Nov 2020 | 5 Nov 2020 | 4 Nov 2021 |
| 431 | negentropy.xin | - | 24 Apr 2016 | 24 Apr 2016 | 24 Apr 2017 |
| 432 | negerkvindelokalehoensbroek.xyz | NameCheap, Inc. | 23 Apr 2016 | 23 May 2016 | 23 Apr 2017 |
| 433 | negevo.com | Tucows Domains Inc. | 24 May 2016 | 25 Apr 2025 | 24 May 2026 |
| 434 | negerkunst.com | Network Solutions, LLC | 27 May 2016 | 27 Apr 2025 | 27 May 2028 |
| 435 | negeup.com | - | 29 May 2016 | 29 May 2016 | 29 May 2017 |
| 436 | negerimandiri.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 May 2016 | 30 May 2016 | 30 May 2017 |
| 437 | negenenasib.org | Tucows Domains Inc. | 30 May 2016 | 19 May 2017 | 30 May 2018 |
| 438 | negenarchitects.com | GoDaddy.com, LLC | 24 Nov 2003 | 27 Oct 2022 | 24 Nov 2031 |
| 439 | negeansac.com | Tucows Domains Inc. | 31 May 2016 | 31 May 2016 | 31 May 2017 |
| 440 | negentropy.space | GoDaddy.com, LLC | 29 May 2016 | 27 Aug 2025 | 29 May 2026 |
| 441 | negerinenblikkstram.top | - | 30 May 2016 | 30 May 2016 | 30 May 2017 |
| 442 | negew.xyz | Uniregistrar Corp | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 443 | negeng.xyz | GMO Internet Inc. | 8 Oct 2025 | 13 Oct 2025 | 8 Oct 2026 |
| 444 | negee.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Jun 2021 | 19 Jun 2021 | 17 Jun 2022 |
| 445 | negermops.top | - | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 446 | negeenrestaurant.com | Hostinger, UAB | 18 Dec 2003 | 18 Nov 2025 | 18 Dec 2026 |
| 447 | negenerv.com | - | 3 Nov 2022 | 24 Nov 2025 | 3 Nov 2026 |
| 448 | negedu.net | - | 13 Jun 2016 | 13 Jun 2016 | 13 Jun 2017 |
| 449 | negexp.com | GoDaddy.com, LLC | 12 Jun 2016 | 12 Jun 2016 | 12 Jun 2017 |
| 450 | negedu.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Dec 2024 | 24 Dec 2025 | 16 Dec 2026 |
| 451 | negeenmasghati.com | GoDaddy.com, LLC | 16 Jun 2016 | 16 Jun 2016 | 16 Jun 2017 |
| 452 | negerkuss.com | united-domains AG | 24 Jan 2023 | 23 Nov 2025 | 24 Jan 2026 |
| 453 | negerisembilan.online | GMO Internet Inc. | 7 Dec 2025 | - | 7 Dec 2026 |
| 454 | negembickhamlaw.net | Tucows Domains Inc. | 16 Jun 2009 | 16 Jun 2009 | 16 Jun 2017 |
| 455 | negeg.space | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2016 | 24 Jun 2016 | 24 Jun 2017 |
| 456 | negenealogy.com | NameCheap, Inc. | 23 Jan 2002 | 28 Sep 2025 | 28 Oct 2026 |
| 457 | negeneralcontractors.com | GoDaddy.com, LLC | 13 Feb 2024 | 27 Mar 2025 | 13 Feb 2025 |
| 458 | negevbti.org | Web Drive Ltd | 4 Jul 2016 | 11 Jul 2017 | 4 Jul 2018 |
| 459 | negeyelemaya.com | register.com, Inc. | 5 Jul 2016 | 5 Jul 2016 | 5 Jul 2017 |
| 460 | negete.mobi | TPP Wholesale Pty Ltd. | 5 Jul 2016 | 5 Jul 2020 | 5 Jul 2021 |
| 461 | negerraus.com | Nominalia Internet S.L. | 7 Jul 2016 | 7 Jul 2016 | 7 Jul 2017 |
| 462 | negenduust.com | Register NV dba Register.eu | 8 Jul 2016 | 22 Nov 2025 | 8 Jul 2026 |
| 463 | negeenpersiangrill.com | Amazon Registrar, Inc. | 6 Feb 2020 | 2 Jan 2025 | 6 Feb 2026 |
| 464 | negelec.com | Ligne Web Services SARL | 5 May 2023 | 5 May 2023 | 5 May 2026 |
| 465 | negen.top | Bizcn.com, Inc. | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 466 | negeng.top | Jiangsu Bangning Science and technology Co. Ltd. | 28 Jun 2023 | 2 Aug 2024 | 28 Jun 2024 |
| 467 | negeri.science | Alpnames Limited | 25 Feb 2015 | 21 May 2016 | 24 Feb 2017 |
| 468 | neger.land | eNom, Inc. | 26 Feb 2014 | 20 Feb 2016 | 26 Feb 2017 |
| 469 | negeargenie.com | GoDaddy.com, LLC | 14 Jul 2016 | 14 Jul 2016 | 14 Jul 2017 |
| 470 | negergenerator.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Jul 2016 | 14 Jul 2016 | 14 Jul 2017 |
| 471 | negeenfarimani.com | - | 16 Jul 2016 | 16 Jul 2016 | 16 Jul 2018 |
| 472 | negerzoenen.biz | Key-Systems GmbH | 3 Apr 2006 | 18 May 2016 | 2 Apr 2017 |
| 473 | negext.biz | Arsys Internet, S.L. dba NICLINE.COM | 13 Nov 2001 | 18 Nov 2024 | 12 Nov 2024 |
| 474 | negerito.biz | Corehub, S.R.L. | 5 Nov 2009 | 20 Dec 2015 | 4 Nov 2016 |
| 475 | neget.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Dec 2015 | 12 Jun 2017 | 30 Nov 2017 |
| 476 | negetirelim.biz | Nics Telekomünikasyon Ticaret Ltd. Şti. | 3 May 2012 | 3 May 2020 | 2 May 2020 |
| 477 | negentropy.biz | GoDaddy.com, LLC | 3 Jul 2017 | 3 Jul 2017 | 2 Jul 2018 |
| 478 | negev.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Nov 2001 | 23 Oct 2025 | 6 Nov 2027 |
| 479 | negemlaw.biz | GoDaddy.com, LLC | 10 Oct 2013 | 20 Nov 2025 | 9 Oct 2025 |
| 480 | negeri.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Mar 2014 | 29 Mar 2024 | 28 Mar 2024 |
| 481 | negete.biz | Melbourne IT, Ltd | 3 Jul 2012 | 25 Oct 2017 | 2 Jul 2018 |
| 482 | negev-nadlan.biz | eNom, Inc. | 19 Nov 2009 | 24 Nov 2025 | 18 Nov 2026 |
| 483 | negest.org | Soluciones Corporativas IP, SLU | 18 Jul 2016 | 29 Aug 2017 | 18 Jul 2018 |
| 484 | negeenfathifarimani.com | FastDomain Inc. | 19 Jul 2016 | 20 Jun 2017 | 19 Jul 2018 |
| 485 | negerikuliner.com | Tucows Domains Inc. | 25 Jul 2016 | 29 Jul 2017 | 25 Jul 2017 |
| 486 | negeho.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jul 2016 | 28 Sep 2017 | 23 Jul 2017 |
| 487 | neger.com.br | - | 2 Jun 1999 | 14 May 2025 | 2 Jun 2029 |
| 488 | negels.com | eNom, Inc. | 26 Jul 2016 | 16 Jul 2017 | 26 Jul 2018 |
| 489 | negerinnensexdating.net | Key-Systems GmbH | 31 Jul 2023 | 12 Sep 2025 | 31 Jul 2025 |
| 490 | negen80.com | Tucows Domains Inc. | 1 Aug 2016 | 5 Aug 2019 | 1 Aug 2019 |
| 491 | negenentwintigzeveneen.com | Tucows Domains Inc. | 31 Jul 2013 | 4 Aug 2016 | 31 Jul 2016 |
| 492 | negeri.xyz | Web Commerce Communications Limited dba WebNic.cc | 2 Jul 2022 | 31 Aug 2023 | 2 Jul 2023 |
| 493 | negerisembilan.xyz | TLD Registrar Solutions Ltd. | 3 Jun 2016 | 13 Jul 2016 | 3 Jun 2017 |
| 494 | negeribatik.com | CV. Jogjacamp | 9 Aug 2016 | 15 Sep 2017 | 9 Aug 2017 |
| 495 | negend.accountant | Alpnames Limited | 11 Aug 2016 | 11 Aug 2017 | 10 Aug 2017 |
| 496 | negev-film.com | 1&1 Internet AG | 12 Aug 2016 | 25 Oct 2024 | 12 Aug 2024 |
| 497 | negetsoft.com | Web Commerce Communications Limited dba WebNic.cc | 13 Aug 2016 | 13 Aug 2016 | 13 Aug 2017 |
| 498 | negemlak.com | Dynadot7 LLC | 4 Mar 2022 | 14 Apr 2023 | 4 Mar 2023 |
| 499 | negerisatu.com | NameCheap, Inc. | 28 Jan 2026 | 28 Jan 2026 | 28 Jan 2027 |
| 500 | negericerdas.com | Hostinger, UAB | 19 Aug 2016 | 27 May 2025 | 19 Aug 2027 |
| 501 | negevnetwork.com | Internet Domain Services BS Corp | 18 Apr 2023 | 25 Nov 2025 | 18 Apr 2026 |
| 502 | negentropic.net | CloudFlare, Inc. | 25 Oct 2023 | 25 Sep 2025 | 25 Oct 2026 |
| 503 | negeripiknik.com | Hostinger, UAB | 26 Aug 2016 | 26 Oct 2016 | 26 Aug 2019 |
| 504 | negerkvindesnydlaekre.xyz | TLD Registrar Solutions Ltd. | 3 Jun 2016 | 13 Jul 2016 | 3 Jun 2017 |
| 505 | negeurope.com | GMO Internet Inc. | 29 Aug 2016 | 5 Jul 2023 | 29 Aug 2026 |
| 506 | negen.org | Google, Inc. | 11 Oct 2021 | 1 Oct 2025 | 11 Oct 2026 |
| 507 | negevgear.com | HiChina Zhicheng Technology Limited | 21 Nov 2019 | 22 Nov 2019 | 21 Nov 2020 |
| 508 | negevdoctors.org | CommuniGal Communication Ltd. | 4 Sep 2016 | 8 Oct 2017 | 4 Sep 2018 |
| 509 | negevsolar.com | Hostinger, UAB | 4 Feb 2025 | 4 Feb 2025 | 4 Feb 2027 |
| 510 | negerekvargardasoyleseylerehaber.com | 1&1 Internet AG | 8 Sep 2016 | 8 Sep 2016 | 8 Sep 2017 |
| 511 | negerikaton.com | Hostinger, UAB | 9 Sep 2016 | 20 Oct 2017 | 9 Sep 2017 |
| 512 | negeophysical.com | Network Solutions, LLC | 3 Jul 2000 | 29 Jun 2025 | 3 Jul 2027 |
| 513 | negerinews.com | CV. Jogjacamp | 14 Nov 2025 | 15 Nov 2025 | 14 Nov 2026 |
| 514 | negerisembilanvip.com | - | 13 Sep 2016 | 13 Sep 2016 | 13 Sep 2017 |
| 515 | negeki.com | Name.com, Inc. | 27 Mar 2013 | 5 Mar 2017 | 27 Mar 2018 |
| 516 | negeso-jp.com | - | 28 Apr 2022 | 30 Apr 2023 | 28 Apr 2024 |
| 517 | negeninvestigativeservices.com | GoDaddy.com, LLC | 9 May 2012 | 20 Jun 2025 | 9 May 2025 |
| 518 | negeocoinc.com | GoDaddy.com, LLC | 16 Feb 2008 | 10 Feb 2025 | 16 Feb 2026 |
| 519 | negevnaki.com | GoDaddy.com, LLC | 3 Nov 2012 | 27 Oct 2015 | 3 Nov 2016 |
| 520 | negev-study.com | MarkMonitor Inc. | 26 Jul 2007 | 24 Jun 2017 | 26 Jul 2019 |
| 521 | negevision.com | Wix.com Ltd. | 28 Jun 2023 | 8 Aug 2024 | 28 Jun 2024 |
| 522 | negevnadlan.com | Amazon Registrar, Inc. | 12 Mar 2014 | 5 Feb 2025 | 12 Mar 2026 |
| 523 | negerlullen.com | Key-Systems GmbH | 19 Jan 2018 | 20 Jan 2018 | 19 Jan 2019 |
| 524 | negerholz.com | 1API GmbH | 13 Jan 2011 | 12 Jan 2026 | 13 Jan 2027 |
| 525 | negest.com | GoDaddy.com, LLC | 27 Sep 2012 | 28 Sep 2025 | 27 Sep 2026 |
| 526 | negembickhamlaw.com | GoDaddy.com, LLC | 19 Feb 2004 | 14 Apr 2015 | 19 Feb 2018 |
| 527 | negeso-arabic.com | Key-Systems GmbH | 18 Jul 2021 | 19 Jul 2021 | 18 Jul 2022 |
| 528 | negenentwintigtientwee.com | Tucows Domains Inc. | 29 Oct 2012 | 2 Nov 2018 | 29 Oct 2018 |
| 529 | negeenamuzegar.com | GoDaddy.com, LLC | 5 Mar 2014 | 6 Mar 2016 | 5 Mar 2017 |
| 530 | negevtrails.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Apr 2014 | 8 Dec 2025 | 9 Apr 2028 |
| 531 | negep.com | GoDaddy.com, LLC | 14 Mar 2011 | 7 Mar 2025 | 14 Mar 2026 |
| 532 | negevjewels.com | GoDaddy.com, LLC | 27 May 2013 | 28 May 2025 | 27 May 2026 |
| 533 | negerboll.com | Hosting Concepts B.V. dba Openprovider | 10 Jan 2005 | 8 Jan 2026 | 10 Jan 2027 |
| 534 | negevtreks.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2014 | 20 Feb 2016 | 20 Apr 2018 |
| 535 | negeoresearch.com | GoDaddy.com, LLC | 21 Sep 2021 | 21 Sep 2021 | 21 Sep 2022 |
| 536 | negevjeep.com | - | 8 Jun 2024 | 9 Jun 2025 | 8 Jun 2026 |
| 537 | negera.com | NameKing.com Inc. | 29 Jul 2023 | 16 Jul 2025 | 29 Jul 2026 |
| 538 | negerlach.com | Namesilo, LLC | 22 Jun 2021 | 22 Aug 2023 | 22 Jun 2023 |
| 539 | negerporno.com | DomainAhead LLC | 2 Sep 2012 | 3 Sep 2017 | 2 Sep 2018 |
| 540 | negentropy.com | Cronon AG | 20 Dec 2000 | 8 Feb 2025 | 20 Dec 2026 |
| 541 | negers.com | GoDaddy.com, LLC | 12 Jun 2002 | 24 May 2025 | 12 Jun 2026 |
| 542 | negelirse.com | GoDaddy.com, LLC | 16 Feb 2023 | 17 Feb 2025 | 16 Feb 2026 |
| 543 | negeso.com | Realtime Register B.V. | 9 Apr 2003 | 10 Apr 2025 | 9 Apr 2026 |
| 544 | negext.com | Arsys Internet, S.L. dba NICLINE.COM | 26 May 2000 | 27 May 2017 | 26 May 2026 |
| 545 | negevresto.com | GoDaddy.com, LLC | 26 May 2011 | 14 Nov 2025 | 26 May 2026 |
| 546 | negetirelim.com | Squarespace Domains LLC | 11 Jul 2025 | 12 Jul 2025 | 11 Jul 2026 |
| 547 | negevnews.com | Wild West Domains, LLC | 26 May 2014 | 25 Apr 2025 | 26 May 2026 |
| 548 | negelap.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jan 2004 | 22 Dec 2025 | 19 Jan 2027 |
| 549 | negevdg.com | eNom, Inc. | 27 Jul 2010 | 20 Jul 2025 | 27 Jul 2026 |
| 550 | negevtours.com | GoDaddy.com, LLC | 19 Apr 2009 | 11 May 2025 | 11 May 2027 |
| 551 | negeoscience.com | Domain.com, LLC | 16 Jun 2011 | 18 May 2025 | 16 Jun 2026 |
| 552 | negeotextile.com | NamePal.com #8021 | 1 Sep 2022 | 15 Nov 2023 | 1 Sep 2023 |
| 553 | negearsourcing.com | register.com, Inc. | 20 Nov 2012 | 24 Jan 2019 | 20 Nov 2019 |
| 554 | negelenstone.com | Hosting Concepts B.V. dba Openprovider | 5 Jan 2009 | 5 Jan 2016 | 5 Jan 2017 |
| 555 | negervotzen.com | PSI-USA, Inc. dba Domain Robot | 4 Oct 2011 | 23 Nov 2015 | 4 Oct 2016 |
| 556 | negeotech.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 17 Nov 2005 | 17 Nov 2025 | 17 Nov 2026 |
| 557 | negele-automation.com | 1&1 Internet AG | 5 Jan 2010 | 6 Jan 2020 | 5 Jan 2027 |
| 558 | negevdirectmarketing.com | GoDaddy.com, LLC | 2 Mar 2003 | 11 Sep 2022 | 13 Aug 2027 |
| 559 | negento.com | TLDs LLC dba SRSplus | 23 Jan 2011 | 4 Sep 2012 | 23 Jan 2018 |
| 560 | negeziyon.com | DomainHood LLC | 6 May 2012 | 7 May 2017 | 6 May 2018 |
| 561 | negenit.com | Name.com, Inc. | 27 Nov 2007 | 1 Nov 2019 | 27 Nov 2028 |
| 562 | negerinnen.com | GoDaddy.com, LLC | 27 Oct 2019 | 28 Oct 2025 | 27 Oct 2026 |
| 563 | negersmith.com | GoDaddy.com, LLC | 21 Apr 2008 | 12 Apr 2016 | 21 Apr 2017 |
| 564 | negeri.com | Uniregistrar Corp | 15 Jun 2003 | 14 May 2025 | 15 Jun 2026 |
| 565 | negeorgiashopper.com | DomainPeople, Inc. | 16 Apr 1999 | 1 Apr 2025 | 17 Apr 2026 |
| 566 | negevdirect.com | GoDaddy.com, LLC | 2 Mar 2003 | 11 Sep 2022 | 13 Aug 2027 |
| 567 | negemco.com | GoDaddy.com, LLC | 24 Dec 2007 | 7 Dec 2025 | 22 Dec 2026 |
| 568 | negenmaanden.com | VisualNames LLC | 22 Feb 2013 | 23 Feb 2017 | 22 Feb 2018 |
| 569 | negempres.com | GoDaddy.com, LLC | 20 Aug 2010 | 21 Aug 2016 | 20 Aug 2017 |
| 570 | negean.com | GoDaddy.com, LLC | 9 Sep 2005 | 10 Sep 2025 | 9 Sep 2026 |
| 571 | negevtactical.com | TurnCommerce, Inc. DBA NameBright.com | 9 Apr 2013 | 10 Nov 2025 | 9 Apr 2026 |
| 572 | negenstappenplan.com | Vautron Rechenzentrum AG | 12 Apr 2012 | 14 Apr 2016 | 12 Apr 2017 |
| 573 | negetivenomore.com | GoDaddy.com, LLC | 21 Oct 2006 | 20 Aug 2014 | 21 Oct 2017 |
| 574 | negeothermal.com | Tucows Domains Inc. | 14 Jan 2019 | 9 Jan 2026 | 14 Jan 2027 |
| 575 | negerisenja.com | GoDaddy.com, LLC | 10 May 2005 | 20 Apr 2025 | 10 May 2026 |
| 576 | negelmann.com | 1&1 Internet AG | 17 Feb 2002 | 5 Oct 2018 | 17 Feb 2026 |
| 577 | negenweb.com | - | 19 Dec 2025 | 19 Dec 2025 | 19 Dec 2026 |
| 578 | negeriatrics.com | GoDaddy.com, LLC | 8 Jan 2002 | 9 Jan 2026 | 8 Jan 2029 |
| 579 | negevjourney.com | GMO Internet Inc. | 23 Nov 2019 | 23 Nov 2019 | 23 Nov 2020 |
| 580 | negeengrill.com | NameCheap, Inc. | 5 Dec 2022 | 16 Feb 2024 | 5 Dec 2023 |
| 581 | negeritimur.com | GoDaddy.com, LLC | 8 Feb 2013 | 9 Feb 2016 | 8 Feb 2017 |
| 582 | negendustri.com | Alantron BiliÅŸim Ltd Åžti. | 12 Jun 2017 | 16 May 2012 | 17 Jun 2018 |
| 583 | negerib.com | Name.com, Inc. | 16 Sep 2009 | 17 Sep 2025 | 16 Sep 2026 |
| 584 | negevpower.com | 1API GmbH | 1 Jul 2021 | 2 Jul 2024 | 1 Jul 2026 |
| 585 | negeorgiaderm.com | GoDaddy.com, LLC | 2 Apr 2014 | 3 Apr 2025 | 2 Apr 2026 |
| 586 | negev4you.com | Gransy s.r.o. d/b/a subreg.cz | 1 Jun 2023 | 2 Jun 2024 | 1 Jun 2025 |
| 587 | negelo.com | Beijing Lanhai Jiye Technology Co., Ltd | 22 Mar 2023 | 7 Jan 2026 | 22 Mar 2026 |
| 588 | negev-aroma.com | Register4Less, Inc. | 1 Jun 2014 | 5 Jun 2017 | 1 Jun 2018 |
| 589 | negesa.com | NamePal.com #8018 | 18 Dec 2025 | 19 Dec 2025 | 18 Dec 2026 |
| 590 | negentropia.com | Realtime Register B.V. | 6 Mar 2024 | 6 Mar 2024 | 6 Mar 2027 |
| 591 | negele2010.com | FastDomain Inc. | 16 Mar 2010 | 16 Mar 2017 | 16 Mar 2018 |
| 592 | negedo.com | Epik Inc. | 4 Jul 2020 | 4 Jul 2020 | 4 Jul 2021 |
| 593 | negenesis.com | GoDaddy.com, LLC | 11 Jan 2023 | 23 Jan 2024 | 11 Jan 2025 |
| 594 | negevnet.com | GoDaddy.com, LLC | 25 Oct 2012 | 26 Oct 2025 | 25 Oct 2027 |
| 595 | negestisheba.com | eNom, Inc. | 2 Sep 2013 | 5 Sep 2016 | 2 Sep 2016 |
| 596 | negevrockcity.com | NameCheap, Inc. | 14 Nov 2025 | 14 Nov 2025 | 14 Nov 2026 |
| 597 | negeriternak.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Oct 2009 | 6 Nov 2025 | 26 Oct 2026 |
| 598 | negerzoen.com | DropCatch.com 984 LLC | 10 Sep 2017 | 10 Sep 2017 | 10 Sep 2018 |
| 599 | negenmaand.com | DomainTact LLC | 28 Sep 2012 | 29 Sep 2017 | 28 Sep 2018 |
| 600 | negemaande.com | CSC Corporate Domains, Inc. | 3 Jun 2013 | 30 May 2017 | 3 Jun 2018 |
| 601 | negerekvar.com | Reg2C.com Inc. | 10 Jul 2025 | 9 Sep 2025 | 10 Jul 2026 |
| 602 | negedly.com | 1API GmbH | 28 Nov 2004 | 25 Nov 2025 | 28 Nov 2026 |
| 603 | negeenpersiangrillsummit.com | CloudFlare, Inc. | 9 Aug 2014 | 21 Aug 2025 | 9 Aug 2026 |
| 604 | negevtraveler.com | GoDaddy.com, LLC | 14 Jan 2013 | 13 Mar 2025 | 12 Mar 2026 |
| 605 | negemlaw.com | GoDaddy.com, LLC | 3 Apr 2004 | 24 Jul 2025 | 23 Jul 2026 |
| 606 | negeripesona.com | - | 18 Jun 2025 | 24 Sep 2025 | 18 Jun 2026 |
| 607 | negev-shuttle.com | OVH sas | 6 Oct 2020 | 7 Oct 2024 | 6 Oct 2024 |
| 608 | negeritua.com | Hongkong Domain Name Information Management Co., L… | 25 Oct 2022 | 4 Dec 2023 | 25 Oct 2023 |
| 609 | negemlab.com | GoDaddy.com, LLC | 6 Jun 2001 | 7 Jun 2025 | 6 Jun 2026 |
| 610 | negearthgroup.com | eNom, Inc. | 25 Jan 2002 | 18 Jan 2025 | 25 Jan 2027 |
| 611 | negerkoepp.com | OnlineNIC, Inc. | 22 Jul 2019 | 24 Jul 2019 | 22 Jul 2020 |
| 612 | negeriparapemimpi.com | Tucows Domains Inc. | 2 Apr 2023 | 6 Apr 2025 | 2 Apr 2026 |
| 613 | negentis.com | Tucows Domains Inc. | 25 May 2007 | 28 May 2025 | 25 May 2026 |
| 614 | negerisembilan.com | TurnCommerce, Inc. DBA NameBright.com | 4 Sep 2012 | 10 Nov 2025 | 4 Sep 2026 |
| 615 | negevtour.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2021 | 21 Nov 2025 | 9 Sep 2025 |
| 616 | negenadvance.com | eNom, Inc. | 18 Jan 2012 | 16 Jan 2026 | 18 Jan 2027 |
| 617 | negevcanaan.com | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2017 | 26 Sep 2017 | 26 Sep 2018 |
| 618 | negevclinic.com | GoDaddy.com, LLC | 8 Jul 2013 | 9 Jul 2025 | 8 Jul 2026 |
| 619 | negevberama.com | eNom, Inc. | 29 Apr 2014 | 31 Mar 2024 | 29 Apr 2026 |
| 620 | negevdesign.com | GoDaddy.com, LLC | 21 Aug 2007 | 18 Aug 2012 | 1 Jan 2017 |
| 621 | negevhiking.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Apr 2014 | 30 Mar 2016 | 9 Apr 2018 |
| 622 | negenservice.com | GoDaddy.com, LLC | 2 Mar 2014 | 6 Mar 2015 | 2 Mar 2017 |
| 623 | negene.com | GoDaddy.com, LLC | 29 Nov 2009 | 29 Nov 2025 | 29 Nov 2026 |
| 624 | negeorgiaauto.com | GoDaddy.com, LLC | 18 Feb 2013 | 19 Feb 2025 | 18 Feb 2026 |
| 625 | negenpower.com | GoDaddy.com, LLC | 17 Jan 2013 | 17 Jan 2013 | 17 Jan 2018 |
| 626 | negevcold.com | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 27 Dec 2021 | 27 Dec 2021 | 27 Dec 2022 |
| 627 | negentec.com | TurnCommerce, Inc. DBA NameBright.com | 9 May 2012 | 10 Nov 2025 | 9 May 2026 |
| 628 | negeorgiagme.com | Network Solutions, LLC | 23 Mar 2012 | 29 Jan 2015 | 23 Mar 2017 |
| 629 | negenplus.com | Hosting Concepts B.V. dba Openprovider | 5 Mar 2010 | 19 Dec 2025 | 5 Mar 2026 |
| 630 | negentropic.com | DreamHost, LLC | 15 Jun 2000 | 3 Jun 2025 | 15 Jun 2026 |
| 631 | negeorgiareia.com | GoDaddy.com, LLC | 8 May 2014 | 14 Apr 2016 | 8 May 2018 |
| 632 | negengec.com | Namesilo, LLC | 3 Aug 2018 | 3 Aug 2018 | 3 Aug 2019 |
| 633 | negeensobhani.com | GoDaddy.com, LLC | 13 Jun 2010 | 14 Jun 2025 | 13 Jun 2026 |
| 634 | negen.com | GoDaddy.com, LLC | 28 Aug 2003 | 1 Jul 2025 | 28 Aug 2028 |
| 635 | negevdistillers.com | Active Registrar, Inc. | 19 Jun 2011 | 30 Nov 2014 | 19 Jun 2017 |
| 636 | negeribadri.com | Tucows Domains Inc. | 19 Nov 2013 | 10 Oct 2025 | 19 Nov 2026 |
| 637 | negev-bioproducts.com | Google, Inc. | 24 Aug 2025 | 8 Sep 2025 | 24 Aug 2026 |
| 638 | negeorgiamountainproperty.com | Tucows Domains Inc. | 8 Apr 2008 | 12 Apr 2022 | 8 Apr 2022 |
| 639 | negedit.com | Eranet International Limited | 23 Nov 2025 | 24 Nov 2025 | 23 Nov 2026 |
| 640 | negevsun.com | GoDaddy.com, LLC | 5 Jul 2006 | 16 Aug 2025 | 5 Jul 2026 |
| 641 | negeri5menara.com | - | 16 Aug 2025 | 18 Aug 2025 | 16 Aug 2026 |
| 642 | negev-trial.com | MarkMonitor Inc. | 26 Jul 2007 | 24 Jun 2017 | 26 Jul 2019 |
| 643 | negentropylaboratory.com | GoDaddy.com, LLC | 27 Apr 2012 | 7 Dec 2025 | 6 Dec 2026 |
| 644 | negemlabma.com | GoDaddy.com, LLC | 12 Apr 2011 | 13 Apr 2025 | 12 Apr 2027 |
| 645 | negeriads.com | Namesilo, LLC | 2 Mar 2024 | 20 Jun 2025 | 2 Mar 2026 |
| 646 | negerfrauen.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 May 2021 | 22 May 2023 | 21 May 2024 |
| 647 | negerseks.com | Tucows Domains Inc. | 4 Nov 2005 | 8 Nov 2018 | 4 Nov 2018 |
| 648 | negeta.com | eNom, Inc. | 7 Jan 2003 | 8 Dec 2023 | 7 Jan 2027 |
| 649 | negerifantasia.com | CV. Rumahweb Indonesia | 12 Apr 2010 | 14 Apr 2025 | 12 Apr 2026 |
| 650 | negevdesert.com | GoDaddy.com, LLC | 20 Feb 2025 | 5 Jan 2026 | 20 Feb 2027 |
| 651 | negeorgiacars.com | GoDaddy.com, LLC | 10 May 2012 | 22 Jul 2024 | 10 May 2024 |
| 652 | negetaway.com | Hostinger, UAB | 16 Jul 2023 | 19 Jun 2025 | 16 Jul 2026 |
| 653 | negeriwaai.com | Metaregistrar BV Applications | 22 Feb 2013 | 23 Feb 2025 | 22 Feb 2026 |
| 654 | negencommentaren.com | GMO Internet Inc. | 7 May 2017 | 13 Jun 2017 | 7 May 2018 |
| 655 | negeridiawan.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 22 May 2021 | 22 May 2021 | 22 May 2022 |
| 656 | negexcel.com | GoDaddy.com, LLC | 30 Jan 2009 | 31 Jan 2025 | 30 Jan 2026 |
| 657 | negevtextil.com | Key-Systems GmbH | 13 May 2022 | 13 May 2022 | 13 May 2023 |
| 658 | negentertainment.com | RegistryGate GmbH | 13 Jun 2014 | - | 13 Jun 2017 |
| 659 | negenborn.com | 1&1 Internet AG | 22 Feb 2004 | 1 Feb 2022 | 22 Feb 2026 |
| 660 | negerekli.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Apr 2023 | 13 Jun 2025 | 11 Apr 2025 |
| 661 | negevecolodge.com | GMO Internet Inc. | 19 Mar 2017 | 1 May 2017 | 18 Mar 2018 |
| 662 | negele.com | 1&1 Internet AG | 19 Jan 1998 | 19 Jan 2026 | 18 Jan 2027 |
| 663 | negeblon.com | GoDaddy.com, LLC | 21 Nov 2009 | 5 Jan 2026 | 21 Nov 2026 |
| 664 | negenstraatjesshop.com | Key-Systems GmbH | 8 Jan 2010 | 9 Jan 2026 | 8 Jan 2027 |
| 665 | negerfotzen.com | GoDaddy.com, LLC | 4 Nov 2005 | 15 Oct 2025 | 4 Nov 2026 |
| 666 | negentropyee.com | Xin Net Technology Corporation | 28 Mar 2013 | 11 Nov 2016 | 28 Mar 2020 |
| 667 | negearth.com | eNom, Inc. | 10 Dec 2002 | 3 Dec 2025 | 10 Dec 2028 |
| 668 | negentigpluswijn.com | Metaregistrar BV Applications | 24 May 2012 | 23 May 2024 | 24 May 2024 |
| 669 | negenerators.com | Network Solutions, LLC | 31 Dec 2012 | 27 Nov 2024 | 31 Dec 2027 |
| 670 | negevwilderness.com | Network Solutions, LLC | 8 Jul 2013 | 30 Aug 2015 | 8 Jul 2017 |
| 671 | negete.com | Key-Systems GmbH | 23 May 2012 | 28 Nov 2025 | 23 May 2026 |
| 672 | negerisabah.com | HiChina Zhicheng Technology Limited | 19 May 2021 | 22 Apr 2025 | 19 May 2026 |
| 673 | negestesaba.com | GoDaddy.com, LLC | 28 Jun 2011 | 29 Jun 2025 | 28 Jun 2028 |
| 674 | negentropie.com | FastDomain Inc. | 25 Nov 2020 | 7 Jan 2025 | 25 Nov 2024 |
| 675 | negeenmosley.com | GoDaddy.com, LLC | 20 Mar 2010 | 20 Mar 2015 | 20 Mar 2020 |
| 676 | negevland.com | Web Commerce Communications Limited dba WebNic.cc | 17 Mar 2024 | 17 Mar 2024 | 17 Mar 2026 |
| 677 | negerisembilantourism.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Apr 2017 | 30 May 2025 | 19 Apr 2026 |
| 678 | negetiv.com | GoDaddy.com, LLC | 27 May 2005 | 7 May 2025 | 27 May 2026 |
| 679 | negetekstil.com | EPAG Domainservices GmbH | 13 Sep 2010 | 14 Sep 2017 | 13 Sep 2018 |
| 680 | neger-sex.com | PSI-USA, Inc. dba Domain Robot | 15 Oct 2010 | 4 May 2018 | 15 Oct 2018 |
| 681 | negen95.com | Tucows Domains Inc. | 2 Feb 2014 | 4 Jan 2017 | 2 Feb 2018 |
| 682 | negeorgiasigns.com | FastDomain Inc. | 23 Jul 2007 | 8 Jul 2025 | 23 Jul 2026 |
| 683 | negevlightopera.com | GoDaddy.com, LLC | 18 Jun 2009 | 2 Apr 2025 | 9 Oct 2026 |
| 684 | negentia.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Aug 2021 | 30 Aug 2023 | 29 Aug 2024 |
| 685 | negebu.com | Google, Inc. | 8 Sep 2020 | 15 Dec 2025 | 8 Sep 2026 |
| 686 | negeap.com | GoDaddy.com, LLC | 25 Mar 2003 | 22 Oct 2025 | 25 Mar 2026 |
| 687 | negertitten.com | Key-Systems GmbH | 24 Aug 2020 | 7 Mar 2024 | 24 Aug 2024 |
| 688 | negele-messtechnik.com | united-domains AG | 5 Jan 2010 | 26 Nov 2025 | 5 Jan 2027 |
| 689 | negemlabct.com | GoDaddy.com, LLC | 12 Apr 2011 | 13 Apr 2025 | 12 Apr 2027 |
| 690 | negerinnensexdating.com | Key-Systems GmbH | 23 May 2010 | 20 Dec 2024 | 23 May 2025 |
| 691 | negeorgia.com | GoDaddy.com, LLC | 1 Apr 2004 | 2 Apr 2024 | 1 Apr 2026 |
| 692 | negenet.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Apr 2006 | 12 Apr 2025 | 1 Apr 2026 |
| 693 | negenman.com | Cronon AG | 7 Sep 2001 | 27 Oct 2025 | 7 Sep 2026 |
| 694 | negentropi.com | CloudFlare, Inc. | 16 Feb 2011 | 12 Jul 2025 | 16 Feb 2027 |
| 695 | negentachtig.com | Tucows Domains Inc. | 30 Dec 2011 | 31 Dec 2025 | 30 Dec 2026 |
| 696 | negen-elf.com | The Registrar Company B.V. | 10 Apr 2014 | 11 Apr 2017 | 10 Apr 2018 |
| 697 | negevpv.com | GoDaddy.com, LLC | 21 May 2012 | 21 May 2012 | 21 May 2017 |
| 698 | negentiggraden.com | Metaregistrar BV Applications | 14 Sep 2009 | 15 Sep 2025 | 14 Sep 2026 |
| 699 | negestaoescolar.com | GoDaddy.com, LLC | 15 Jan 2013 | 15 Jan 2013 | 15 Jan 2018 |
| 700 | negetuan.com | MAFF Inc. | 13 Jul 2021 | 21 Sep 2023 | 13 Jul 2023 |
| 701 | negerkekse.com | Cronon AG | 8 Sep 2004 | 8 Sep 2004 | 7 Sep 2016 |
| 702 | negenic.com | BigRock Solutions Ltd. | 26 May 2014 | 28 May 2017 | 26 May 2018 |
| 703 | negerkussschleudermaschine.com | GoDaddy.com, LLC | 4 Nov 2011 | 5 Nov 2015 | 4 Nov 2016 |
| 704 | negeen-fashion.com | Bizcn.com, Inc. | 16 Jan 2013 | 17 Jan 2025 | 16 Jan 2026 |
| 705 | negevphotography.com | GoDaddy.com, LLC | 6 Mar 2012 | 13 Oct 2014 | 13 Aug 2018 |
| 706 | negevhike.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Apr 2014 | 30 Mar 2016 | 9 Apr 2018 |
| 707 | negeeklakeenterprises.com | GoDaddy.com, LLC | 10 Apr 2013 | 10 Apr 2024 | 10 Apr 2026 |
| 708 | negevtrail.com | EPAG Domainservices GmbH | 30 Aug 2013 | 7 Sep 2024 | 30 Aug 2025 |
| 709 | negevnectars.com | NameCheap, Inc. | 19 Jun 2025 | 20 Jun 2025 | 19 Jun 2026 |
| 710 | negerikunews.com | Key-Systems GmbH | 18 Aug 2020 | 18 Aug 2020 | 18 Aug 2021 |
| 711 | negevjeeptours.com | Beijing Lanhai Jiye Technology Co., Ltd | 9 Feb 2021 | 9 Feb 2021 | 9 Feb 2022 |
| 712 | negeso-cms.com | Realtime Register B.V. | 6 Oct 2010 | 17 Nov 2025 | 6 Oct 2025 |
| 713 | negerinnenwebcamsex.com | Key-Systems GmbH | 1 Jun 2014 | 6 Jul 2016 | 1 Jun 2017 |
| 714 | negewi.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 5 Aug 2022 | 27 Apr 2023 | 5 Aug 2023 |
| 715 | negemlawfirm.com | Nordreg AB | 22 Jun 2004 | 16 May 2025 | 22 Jun 2026 |
| 716 | negenreport.com | GoDaddy.com, LLC | 3 Jan 2006 | 4 Jan 2016 | 3 Jan 2017 |
| 717 | negetirsin.com | GoDaddy.com, LLC | 8 Feb 2018 | 8 Feb 2025 | 8 Feb 2026 |
| 718 | negems.com | Wix.com Ltd. | 25 Jan 2000 | 26 Dec 2024 | 25 Jan 2027 |
| 719 | negerikedua.com | Web Commerce Communications Limited dba WebNic.cc | 9 Jun 2014 | 28 Dec 2014 | 9 Jun 2026 |
| 720 | negembickham.com | GoDaddy.com, LLC | 10 Nov 2009 | 15 Aug 2014 | 10 Nov 2016 |
| 721 | negeric.com | CloudFlare, Inc. | 20 Oct 2014 | 20 Sep 2025 | 20 Oct 2026 |
| 722 | negentien95.com | Tucows Domains Inc. | 2 Feb 2014 | 4 Jan 2017 | 2 Feb 2018 |
| 723 | negeorgialegal.com | GoDaddy.com, LLC | 9 Jun 2011 | 10 Jun 2014 | 9 Jun 2017 |
| 724 | negeridongeng.com | - | 8 Jan 2022 | 8 Jan 2022 | 8 Jan 2027 |
| 725 | negestipress.com | eNom, Inc. | 12 Aug 2014 | 15 Aug 2016 | 12 Aug 2016 |
| 726 | negentig.com | TurnCommerce, Inc. DBA NameBright.com | 1 Apr 2007 | 12 May 2025 | 1 Apr 2025 |
| 727 | negeorgiarealestate.com | GoDaddy.com, LLC | 7 Oct 2021 | 19 Dec 2023 | 7 Oct 2023 |
| 728 | negev4x4.com | eNom, Inc. | 18 Sep 2023 | 18 Sep 2023 | 18 Sep 2024 |
| 729 | negevrideguide.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Apr 2014 | 10 Mar 2016 | 9 Apr 2018 |
| 730 | negevspaceport.com | Misk.com, Inc. | 12 Apr 2010 | 3 Jun 2010 | 12 Apr 2020 |
| 731 | negerikita.com | - | 24 Jun 2011 | 3 Feb 2025 | 24 Jun 2026 |
| 732 | negeeks.com | 1&1 Internet AG | 3 Feb 2025 | 6 Jul 2025 | 3 Feb 2026 |
| 733 | negecon.com | GoDaddy.com, LLC | 9 Feb 2014 | 22 Mar 2016 | 9 Feb 2017 |
| 734 | negertal.com | Hetzner Online AG | 10 Apr 2003 | 25 Nov 2025 | 10 Apr 2026 |
| 735 | negesysbarter.com | GoDaddy.com, LLC | 30 Jan 2014 | 30 Jan 2014 | 30 Jan 2017 |
| 736 | negevdiamonds.com | Gandi SAS | 11 Nov 2012 | 25 Dec 2024 | 11 Nov 2024 |
| 737 | negev-tp.com | GoDaddy.com, LLC | 12 Apr 2013 | 15 Dec 2024 | 12 Apr 2027 |
| 738 | negendecirkel.com | DomainHood LLC | 1 Jul 2012 | 2 Jul 2017 | 1 Jul 2018 |
| 739 | negeriperi.com | HiChina Zhicheng Technology Limited | 2 May 2020 | 3 May 2020 | 2 May 2021 |
| 740 | negevgas.com | DNC Holdings, Inc. | 11 May 2022 | 23 Jun 2023 | 11 May 2023 |
| 741 | negenmaandendump.com | Tucows Domains Inc. | 18 May 2012 | 19 Apr 2016 | 18 May 2017 |
| 742 | negeen.com | Hostinger, UAB | 25 Dec 2005 | 17 Nov 2025 | 25 Dec 2026 |
| 743 | negeoinc.com | GoDaddy.com, LLC | 17 Mar 2010 | 7 Sep 2022 | 17 Mar 2026 |
| 744 | negerisembilanmalaysia.com | Dynadot7 LLC | 19 Nov 2021 | 20 Nov 2021 | 19 Nov 2022 |
| 745 | negepec.com | Amazon Registrar, Inc. | 2 Feb 2010 | 29 Dec 2024 | 2 Feb 2026 |
| 746 | negen-connect.com | GoDaddy.com, LLC | 8 Mar 2012 | 8 Mar 2025 | 8 Mar 2026 |
| 747 | negeri-senja.com | - | 26 May 2025 | 29 Jan 2026 | 26 May 2026 |
| 748 | negenealogist.com | GoDaddy.com, LLC | 30 Jun 2011 | 1 Jul 2023 | 30 Jun 2026 |
| 749 | negemworthington.com | register.com, Inc. | 8 Oct 2010 | 9 Oct 2025 | 8 Oct 2026 |
| 750 | negenstraatjesonline.com | Tucows Domains Inc. | 16 Mar 2011 | 15 Feb 2017 | 16 Mar 2018 |
| 751 | negesy.com | DropCatch.com 421 LLC | 22 Nov 2018 | 22 Nov 2018 | 22 Nov 2019 |
| 752 | negesys.com | Dynadot, LLC | 11 Aug 2021 | 12 Aug 2024 | 11 Aug 2025 |
| 753 | negevshekel.com | GoDaddy.com, LLC | 20 May 2013 | 26 Apr 2025 | 20 May 2026 |
| 754 | negeoservices.com | Network Solutions, LLC | 11 May 2012 | 27 Apr 2017 | 11 May 2018 |
| 755 | negeendesigns.com | Squarespace Domains LLC | 19 Nov 2007 | 4 Nov 2025 | 19 Nov 2026 |
| 756 | negenelf.com | The Registrar Company B.V. | 10 Apr 2014 | 11 Apr 2017 | 10 Apr 2018 |
| 757 | negeorgiapreps.com | CSC Corporate Domains, Inc. | 6 Aug 2009 | 4 Jan 2017 | 6 Aug 2018 |
| 758 | negevdesignbuild.com | GoDaddy.com, LLC | 30 Jul 2008 | 31 Jul 2025 | 30 Jul 2026 |
| 759 | negerzoenen.com | NameCheap, Inc. | 6 May 2019 | 6 May 2019 | 6 May 2020 |
| 760 | negemappraisals.com | GoDaddy.com, LLC | 6 Dec 2011 | 7 Dec 2023 | 6 Dec 2028 |
| 761 | negerikubagus.com | Tucows Domains Inc. | 4 Feb 2014 | 8 Feb 2025 | 4 Feb 2026 |
| 762 | negevrockart.com | Dynadot, LLC | 27 Apr 2011 | 5 Apr 2015 | 27 Apr 2017 |
| 763 | negelink.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 May 2013 | 1 May 2025 | 8 May 2026 |
| 764 | negent.com | HiChina Zhicheng Technology Limited | 29 Dec 2008 | 8 Dec 2025 | 29 Dec 2026 |
| 765 | negearthlights.com | eNom, Inc. | 25 Jan 2002 | 18 Jan 2025 | 25 Jan 2027 |
| 766 | negeorgiaschoolofmusicanddance.com | eNom, Inc. | 19 Jul 2014 | 31 Aug 2016 | 19 Jul 2016 |
| 767 | negemcpa.com | GoDaddy.com, LLC | 30 Nov 2011 | 1 Dec 2025 | 30 Nov 2026 |
| 768 | negema.com | Key-Systems GmbH | 25 Sep 2008 | 28 Nov 2025 | 25 Sep 2026 |
| 769 | negelein.com | 1&1 Internet AG | 30 Sep 2003 | 16 Mar 2018 | 30 Sep 2026 |
| 770 | neges.com | GoDaddy.com, LLC | 21 Sep 1999 | 2 Sep 2025 | 21 Sep 2026 |
| 771 | negemlabri.com | GoDaddy.com, LLC | 12 Apr 2011 | 13 Apr 2025 | 12 Apr 2027 |
| 772 | negenis.com | Shanghai Meicheng Technology Information Co., Ltd | 22 Dec 2017 | 22 Dec 2017 | 22 Dec 2018 |
| 773 | negester.com | Hetzner Online AG | 31 May 2011 | 25 Nov 2025 | 31 May 2026 |
| 774 | negerikreatif.com | Name.com, Inc. | 26 Aug 2013 | 23 Aug 2025 | 26 Aug 2026 |
| 775 | negerisendiri.com | PT Ardh Global Indonesia | 29 Nov 2012 | 22 Nov 2025 | 29 Nov 2026 |
| 776 | negendank.com | TurnCommerce, Inc. DBA NameBright.com | 20 Dec 2018 | 1 Mar 2025 | 20 Dec 2024 |
| 777 | negersex.com | TurnCommerce, Inc. DBA NameBright.com | 9 Jul 2018 | 10 Aug 2024 | 9 Jul 2024 |
| 778 | negeeklake.com | GoDaddy.com, LLC | 10 Apr 2013 | 10 Apr 2024 | 10 Apr 2026 |
| 779 | negerito.com | Hetzner Online AG | 31 Aug 2007 | 25 Nov 2025 | 31 Aug 2026 |
| 780 | negergy.com | enom383, Incorporated | 8 Oct 2023 | 21 Nov 2024 | 8 Oct 2024 |
| 781 | negevtrek.com | Dynadot7 LLC | 28 Feb 2022 | 10 Apr 2023 | 28 Feb 2023 |
| 782 | negens.com | Register.it SPA | 19 Jul 2006 | 23 Jun 2025 | 21 May 2026 |
| 783 | neger-porno.com | PSI-USA, Inc. dba Domain Robot | 14 Oct 2010 | 4 May 2018 | 14 Oct 2018 |
| 784 | negevenergy.com | DropCatch.com 954 LLC | 8 Nov 2024 | 9 Nov 2024 | 8 Nov 2026 |
| 785 | negetive.com | NameCheap, Inc. | 16 Feb 2021 | 29 Jan 2025 | 16 Feb 2026 |
| 786 | negerinnensex.com | Mijn InternetOplossing B.V. | 25 May 2004 | 27 May 2017 | 25 May 2018 |
| 787 | negeripelangi.com | Web Commerce Communications Limited dba WebNic.cc | 24 Nov 2009 | 9 Sep 2025 | 25 Nov 2026 |
| 788 | negenmaandenmooi.com | Key-Systems GmbH | 31 Aug 2009 | 2 Sep 2017 | 31 Aug 2018 |
| 789 | negevseeds.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Aug 2017 | 7 Aug 2017 | 7 Aug 2019 |
| 790 | negevecovillage.com | Key-Systems GmbH | 19 Dec 2007 | 18 Dec 2025 | 19 Dec 2026 |
| 791 | negel.com | - | 6 Jul 2009 | 13 Nov 2025 | 6 Jul 2027 |
| 792 | negemworthingtonlaw.com | eNom, Inc. | 9 Apr 2013 | 30 Oct 2017 | 9 Apr 2018 |
| 793 | negeyilmazmakina.com | EPAG Domainservices GmbH | 24 Mar 2009 | 25 Mar 2017 | 24 Mar 2018 |
| 794 | negerkeks.com | DropCatch.com 1084 LLC | 15 Nov 2017 | 25 Apr 2020 | 15 Nov 2026 |
| 795 | negentigpluswijnen.com | Metaregistrar BV Applications | 24 May 2012 | 23 May 2024 | 24 May 2024 |
| 796 | negenminds.com | Domain.com, LLC | 28 Feb 2014 | 13 Feb 2017 | 28 Feb 2018 |
| 797 | negeek.com | GoDaddy.com, LLC | 10 Apr 2013 | 10 Apr 2024 | 10 Apr 2026 |
| 798 | negentek.com | GoDaddy.com, LLC | 5 Jun 2014 | 5 May 2025 | 5 Jun 2026 |
| 799 | negevshekelnosatzki.com | GoDaddy.com, LLC | 20 May 2013 | 26 Apr 2025 | 20 May 2026 |
| 800 | neged.com | GoDaddy.com, LLC | 12 May 2003 | 12 May 2025 | 12 May 2026 |
| 801 | negenstegen.com | Tucows Domains Inc. | 20 Jun 2014 | 22 May 2017 | 20 Jun 2018 |
| 802 | negenterprises.com | Network Solutions, LLC | 13 Jan 2009 | 5 Mar 2017 | 13 Jan 2018 |
| 803 | negeorgiahomeinspections.com | DNC Holdings, Inc. | 12 May 2022 | 24 Jun 2023 | 12 May 2023 |
| 804 | negerin.com | SafeNames Ltd. | 11 Nov 1998 | 1 Dec 2025 | 10 Nov 2027 |
| 805 | negeorgiahousing.com | Network Solutions, LLC | 6 Jul 2006 | 13 Jun 2022 | 6 Jul 2027 |
| 806 | negeorgiak9club.com | DropCatch.com 1269 LLC | 6 Mar 2020 | 6 Mar 2020 | 6 Mar 2021 |
| 807 | negerkuesse.com | Mesh Digital Limited | 25 Oct 2006 | 24 Oct 2017 | 25 Oct 2018 |
| 808 | negerek.com | Reg2C.com Inc. | 19 Dec 2022 | 23 Nov 2025 | 19 Dec 2026 |
| 809 | negeenatsummit.com | - | 18 Sep 2016 | 18 Sep 2016 | 18 Sep 2017 |
| 810 | negefi123.win | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Sep 2016 | 20 Sep 2017 | 18 Sep 2017 |
| 811 | negenborn.net | Hosting Concepts B.V. dba Openprovider | 21 Jun 1999 | 18 Dec 2025 | 21 Jun 2026 |
| 812 | negerimadani.com | Web Commerce Communications Limited dba WebNic.cc | 27 May 2024 | 27 May 2024 | 27 May 2026 |
| 813 | negevcreativehouse.com | 1&1 Internet AG | 21 Sep 2016 | 26 Sep 2016 | 21 Sep 2018 |
| 814 | negetube.com | FastDomain Inc. | 22 Sep 2016 | 16 Sep 2017 | 22 Sep 2018 |
| 815 | negesbandafoundation.org | Launchpad, Inc. | 23 Sep 2016 | 12 Oct 2017 | 23 Sep 2019 |
| 816 | negeribunga.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Sep 2016 | 19 Aug 2025 | 25 Sep 2026 |
| 817 | negeriakhirat.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2021 | 8 Jan 2021 | 8 Jan 2022 |
| 818 | negezdinbe.com | GoDaddy.com, LLC | 26 Sep 2018 | 26 Sep 2018 | 26 Sep 2019 |
| 819 | negender.com | NameCheap, Inc. | 8 Feb 2022 | - | 8 Feb 2023 |
| 820 | negernetwork.info | Cronon AG | 1 Oct 2016 | 1 Oct 2016 | 1 Oct 2017 |
| 821 | neger.us | Uniregistrar Corp | 7 Oct 2016 | 22 Feb 2017 | 6 Oct 2017 |
| 822 | negentropy.info | NameCheap, Inc. | 5 Aug 2024 | - | 5 Aug 2025 |
| 823 | negenmaanden.info | Metaregistrar BV Applications | 13 Jul 2009 | 12 Jul 2025 | 13 Jul 2025 |
| 824 | negele.info | Vautron Rechenzentrum AG | 23 Jun 2002 | 24 Jun 2025 | 23 Jun 2026 |
| 825 | negev2.info | GoDaddy.com, LLC | 24 Nov 2013 | 23 Aug 2015 | 24 Nov 2016 |
| 826 | negete.info | FastDomain Inc. | 27 Aug 2012 | 13 Aug 2019 | 27 Aug 2020 |
| 827 | negelebau.info | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Jun 2006 | 8 Jun 2025 | 8 Jun 2026 |
| 828 | negemlaw.info | GoDaddy.com, LLC | 10 Oct 2013 | 24 Nov 2025 | 10 Oct 2026 |
| 829 | negen.info | Metaregistrar BV Applications | 8 Oct 2025 | - | 8 Oct 2026 |
| 830 | negetygoryqyter.info | Reserved for non-billable transactions where Regis… | 7 Feb 2013 | 7 Feb 2020 | 7 Feb 2021 |
| 831 | negerzoen.info | Key-Systems GmbH | 28 Mar 2006 | 28 Mar 2017 | 28 Mar 2018 |
| 832 | negenborn.info | 1&1 Internet AG | 20 Nov 2004 | 20 Nov 2017 | 20 Nov 2018 |
| 833 | negev1.info | GoDaddy.com, LLC | 24 Nov 2013 | 23 Aug 2015 | 24 Nov 2016 |
| 834 | negerkekse.info | Cronon AG | 12 Sep 2004 | 12 Sep 2016 | 12 Sep 2017 |
| 835 | negenezepu.info | GoDaddy.com, LLC | 23 Apr 2012 | 7 Jun 2025 | 23 Apr 2026 |
| 836 | negernboetel.info | Cronon AG | 3 May 2023 | 3 Nov 2025 | 14 Sep 2026 |
| 837 | negerkeks.info | Cronon AG | 12 Sep 2004 | 12 Sep 2016 | 12 Sep 2017 |
| 838 | negevtactical.info | GoDaddy.com, LLC | 9 Apr 2013 | 14 May 2016 | 9 Apr 2019 |
| 839 | negerinnen.info | Key-Systems GmbH | 7 Mar 2006 | 27 Nov 2025 | 7 Mar 2026 |
| 840 | negemlaw.mobi | GoDaddy.com, LLC | 10 Oct 2013 | 21 Nov 2025 | 10 Oct 2025 |
| 841 | negeriweb.net | CV. Jogjacamp | 11 Oct 2016 | 17 Nov 2017 | 11 Oct 2017 |
| 842 | negeyj.racing | Todaynic.com Inc. | 12 Oct 2016 | 12 Oct 2017 | 11 Oct 2017 |
| 843 | negerihost.net | - | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 844 | negeenthejewel.org | GoDaddy.com, LLC | 4 Jan 2019 | 28 Jul 2024 | 4 Jan 2029 |
| 845 | negentropia.net | 1&1 Internet AG | 15 Oct 2006 | 6 Dec 2017 | 15 Oct 2026 |
| 846 | negeriwaai.net | Metaregistrar BV Applications | 22 Feb 2013 | 23 Feb 2025 | 22 Feb 2026 |
| 847 | negenweb.net | Network Solutions, LLC | 29 Jul 2013 | 30 May 2025 | 29 Jul 2026 |
| 848 | negenit.net | Name.com, Inc. | 27 Nov 2007 | 3 Nov 2023 | 27 Nov 2028 |
| 849 | negeorgiapreps.net | CSC Corporate Domains, Inc. | 6 Aug 2009 | 4 Jan 2017 | 6 Aug 2018 |
| 850 | negemlawfirm.net | Domain.com, LLC | 25 Mar 2014 | 15 Sep 2015 | 25 Mar 2017 |
| 851 | negersex.net | Namesilo, LLC | 9 Jul 2018 | 10 Jul 2018 | 9 Jul 2019 |
| 852 | negemlaw.net | GoDaddy.com, LLC | 10 Oct 2013 | 11 Oct 2023 | 10 Oct 2028 |
| 853 | negee.net | GMO Internet Inc. | 28 Dec 2009 | 28 Nov 2025 | 28 Dec 2026 |
| 854 | negerkekse.net | Cronon AG | 12 Sep 2004 | 12 Sep 2004 | 11 Sep 2016 |
| 855 | neges.net | eNom, Inc. | 12 May 2014 | 25 Jul 2024 | 12 May 2024 |
| 856 | negenet.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Apr 2006 | 2 Mar 2022 | 1 Apr 2026 |
| 857 | negerin.net | Key-Systems GmbH | 24 Aug 2020 | 11 Jul 2023 | 24 Aug 2023 |
| 858 | negen.net | TurnCommerce, Inc. DBA NameBright.com | 20 Mar 2018 | 10 Nov 2025 | 20 Mar 2026 |
| 859 | negele.net | united-domains AG | 25 Mar 1999 | 6 Dec 2025 | 25 Mar 2026 |
| 860 | negeoresearch.net | FastDomain Inc. | 12 Apr 2012 | 27 Mar 2017 | 12 Apr 2018 |
| 861 | negerkeks.net | Cronon AG | 12 Sep 2004 | 12 Sep 2004 | 11 Sep 2016 |
| 862 | negetirelim.net | FBS Inc. | 3 May 2012 | 2 May 2016 | 3 May 2017 |
| 863 | negerihijau.net | Tucows Domains Inc. | 3 Jun 2013 | 7 Jun 2018 | 3 Jun 2018 |
| 864 | negeso.net | Realtime Register B.V. | 22 Sep 2012 | 23 Sep 2025 | 22 Sep 2026 |
| 865 | negev.net | Porkbun, LLC | 11 Jul 2025 | 11 Jul 2025 | 11 Jul 2026 |
| 866 | negendank.net | Hetzner Online AG | 25 Jan 2004 | 25 Nov 2025 | 25 Jan 2026 |
| 867 | negendanck.net | 1&1 Internet AG | 10 Mar 2006 | 3 Feb 2022 | 10 Mar 2026 |
| 868 | negentropy.net | register.com, Inc. | 5 Jan 2000 | 6 Dec 2025 | 5 Jan 2027 |
| 869 | negevtactical.net | GoDaddy.com, LLC | 9 Apr 2013 | 21 Apr 2016 | 9 Apr 2019 |
| 870 | neger.net | - | 4 Oct 2020 | 27 Oct 2024 | 4 Oct 2026 |
| 871 | negele-automation.net | 1&1 Internet AG | 5 Jan 2010 | 6 Jan 2020 | 5 Jan 2027 |
| 872 | negete.net | Launchpad, Inc. | 5 May 2023 | 6 May 2025 | 5 May 2026 |
| 873 | negers.net | Tucows Domains Inc. | 25 Dec 2006 | 6 Mar 2024 | 25 Dec 2023 |
| 874 | negema.net | Google, Inc. | 12 Nov 2021 | 28 Oct 2025 | 12 Nov 2026 |
| 875 | negerinnensexlijn.net | Key-Systems GmbH | 1 Nov 2011 | 1 Nov 2017 | 1 Nov 2018 |
| 876 | negentec.net | Beijing Lanhai Jiye Technology Co., Ltd | 27 Jul 2019 | 2 Dec 2025 | 27 Jul 2026 |
| 877 | negerito.net | Hetzner Online AG | 31 Aug 2007 | 25 Nov 2025 | 31 Aug 2026 |
| 878 | negeorgialegal.net | GoDaddy.com, LLC | 9 Jun 2011 | 10 Jun 2014 | 9 Jun 2017 |
| 879 | negenealogy.net | GoDaddy.com, LLC | 2 Feb 2011 | 8 Sep 2022 | 2 Feb 2026 |
| 880 | negeso-cms.net | Realtime Register B.V. | 24 Feb 2021 | 24 Feb 2021 | 24 Feb 2022 |
| 881 | negester.net | Hetzner Online AG | 31 May 2011 | 25 Nov 2025 | 31 May 2026 |
| 882 | negeengrill.net | Network Solutions, LLC | 2 Apr 2009 | 6 Apr 2016 | 1 Apr 2017 |
| 883 | negentropolis.com | Hostinger, UAB | 25 Apr 2023 | 29 Mar 2025 | 25 Apr 2026 |
| 884 | negelco.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 30 Jun 2022 | 2 Jul 2025 | 30 Jun 2026 |
| 885 | negeo.org | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 5 Apr 2023 | 15 Jun 2024 | 5 Apr 2024 |
| 886 | negev.org | Launchpad, Inc. | 27 Apr 2001 | 17 Apr 2025 | 27 Apr 2026 |
| 887 | negenetics.org | GoDaddy.com, LLC | 27 Nov 2007 | 9 Dec 2025 | 27 Nov 2026 |
| 888 | negele.org | PSI-USA, Inc. dba Domain Robot | 12 May 2003 | 26 Jun 2025 | 12 May 2026 |
| 889 | negenborn.org | Cronon AG | 16 Dec 2023 | 16 Dec 2025 | 16 Dec 2026 |
| 890 | negeographyed.org | FastDomain Inc. | 15 Nov 2011 | 17 Sep 2013 | 15 Nov 2019 |
| 891 | negentropos.org | RegistryGate GmbH | 15 Oct 2010 | 16 Oct 2017 | 15 Oct 2018 |
| 892 | negete.org | Key-Systems GmbH | 3 Jul 2012 | 26 Nov 2025 | 3 Jul 2026 |
| 893 | neger.org | Moniker Online Services LLC | 25 Sep 2002 | 25 Nov 2025 | 25 Sep 2026 |
| 894 | negeriku.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Mar 2014 | 29 Mar 2024 | 29 Mar 2025 |
| 895 | negeventures.org | eNom, Inc. | 29 Mar 2011 | 17 Feb 2016 | 29 Mar 2017 |
| 896 | negetirelim.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 3 May 2012 | 24 Jun 2017 | 3 May 2018 |
| 897 | negentropic.org | GoDaddy.com, LLC | 19 Nov 2001 | 3 Jan 2026 | 19 Nov 2026 |
| 898 | negenweb.org | GoDaddy.com, LLC | 25 Jul 2006 | 28 Aug 2025 | 25 Jul 2026 |
| 899 | negetivenomore.org | GoDaddy.com, LLC | 22 Oct 2006 | 3 Dec 2017 | 22 Oct 2018 |
| 900 | negendecirkel.org | Tucows Domains Inc. | 22 Jul 2010 | 22 Jun 2017 | 22 Jul 2018 |
| 901 | negewene.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 May 2007 | 28 Apr 2025 | 2 May 2026 |
| 902 | negenit.org | Name.com, Inc. | 27 Nov 2007 | 8 Nov 2023 | 27 Nov 2028 |
| 903 | negenealogy.org | GoDaddy.com, LLC | 14 Aug 2011 | 1 Aug 2017 | 14 Aug 2018 |
| 904 | negevtactical.org | GoDaddy.com, LLC | 9 Apr 2013 | 14 May 2016 | 9 Apr 2019 |
| 905 | negeoscience.org | Domain.com, LLC | 16 Jun 2011 | 23 May 2025 | 16 Jun 2026 |
| 906 | negelebau.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Jun 2006 | 24 Jul 2025 | 8 Jun 2026 |
| 907 | negeorgiamustangclub.org | Tucows Domains Inc. | 3 Feb 2006 | 19 Mar 2024 | 3 Feb 2026 |
| 908 | negeripelangi.org | Web Commerce Communications Limited dba WebNic.cc | 8 Sep 2011 | 16 Oct 2025 | 8 Sep 2026 |
| 909 | negeorgialibraries.org | Network Solutions, LLC | 14 Oct 2004 | 26 Nov 2024 | 14 Oct 2029 |
| 910 | negeorge.org | TierraNet Inc. d/b/a DomainDiscover | 9 Apr 2013 | 8 Apr 2023 | 9 Apr 2027 |
| 911 | negev-initiative.org | Netowl, Inc. | 16 May 2006 | 15 Mar 2016 | 16 May 2017 |
| 912 | negea.org | Network Solutions, LLC | 18 Sep 2009 | 19 Sep 2016 | 18 Sep 2017 |
| 913 | negerkeks.org | Cronon AG | 12 Sep 2004 | 13 Sep 2016 | 12 Sep 2017 |
| 914 | negerkekse.org | Cronon AG | 12 Sep 2004 | 13 Sep 2016 | 12 Sep 2017 |
| 915 | negerikreatif.org | Name.com, Inc. | 26 Aug 2013 | 1 Aug 2016 | 26 Aug 2017 |
| 916 | negeertwilders.org | NameWeb BVBA | 21 May 2014 | 19 May 2017 | 21 May 2018 |
| 917 | negevconference2014.org | Network Solutions, LLC | 9 Apr 2014 | 21 Apr 2016 | 9 Apr 2017 |
| 918 | negesfoundation.org | DreamHost, LLC | 25 Sep 2005 | 29 Aug 2025 | 25 Sep 2026 |
| 919 | negeorgiagme.org | Network Solutions, LLC | 23 Mar 2012 | 23 May 2012 | 23 Mar 2017 |
| 920 | negensprong.org | Hosting Concepts B.V. dba Openprovider | 19 Jul 2013 | 9 Sep 2016 | 19 Jul 2017 |
| 921 | negeorgialegal.org | GoDaddy.com, LLC | 9 Jun 2011 | 10 Jun 2014 | 9 Jun 2017 |
| 922 | negentropie.org | 1&1 Internet AG | 30 Mar 2001 | 13 Oct 2017 | 30 Mar 2018 |
| 923 | negedneshek.org | - | 21 Nov 2025 | 26 Nov 2025 | 21 Nov 2026 |
| 924 | negelleborenaconcern.org | Domain.com, LLC | 27 Dec 2013 | 8 Jun 2017 | 27 Dec 2019 |
| 925 | negevsolar.org | GoDaddy.com, LLC | 4 Jun 2008 | 5 Jun 2016 | 4 Jun 2017 |
| 926 | negeriwaai.org | Metaregistrar BV Applications | 22 Feb 2013 | 4 Jun 2025 | 22 Feb 2026 |
| 927 | negemlaw.org | GoDaddy.com, LLC | 10 Oct 2013 | 2 Jul 2024 | 10 Oct 2028 |
| 928 | negentropy.org | NameCheap, Inc. | 19 May 2020 | 23 Jan 2023 | 19 May 2030 |
| 929 | negericerdas.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Oct 2016 | 27 Nov 2017 | 22 Oct 2018 |
| 930 | negerinforrelatie.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 931 | negerdating.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 932 | negejk.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 3 Aug 2016 | 2 Jun 2017 |
| 933 | negei.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 1 Aug 2016 | 2 Jun 2017 |
| 934 | negerxchattachefsutbildning.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 12 Oct 2016 | 2 Jun 2017 |
| 935 | negerpikkeaissatoup1.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 5 Sep 2016 | 2 Jun 2017 |
| 936 | negevskyla.xyz | NameCheap, Inc. | 3 Jun 2016 | 28 Jun 2016 | 3 Jun 2017 |
| 937 | negev.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 6 Dec 2024 | 7 Dec 2025 | 6 Dec 2026 |
| 938 | negeg.xyz | Uniregistrar Corp | 3 Jun 2016 | 23 Sep 2016 | 3 Jun 2017 |
| 939 | negevrest.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Jun 2016 | 29 Jul 2016 | 3 Jun 2017 |
| 940 | negerbnc.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 941 | negerinnenjeeerste.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 942 | negentropy.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 14 Feb 2025 | 1 Mar 2025 | 14 Feb 2026 |
| 943 | negerinsexdate.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 944 | negerpiksvanerting.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 5 Sep 2016 | 1 Jun 2017 |
| 945 | negerinnentexelbdsm.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 946 | negerkvinderstrippergammelfar.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 5 Sep 2016 | 2 Jun 2017 |
| 947 | negeridiawan.xyz | NameCheap, Inc. | 3 Jun 2016 | 29 Jun 2016 | 3 Jun 2017 |
| 948 | negeriagung.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 949 | negerinnendatingsites.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 950 | negerinnenanalrelatieprobleem.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 951 | negerinen.be | - | 20 Dec 2015 | - | - |
| 952 | negerinnensex.be | - | 10 Mar 2004 | - | - |
| 953 | negerslet.be | Cronon AG | 6 Mar 2015 | - | - |
| 954 | negensprong-koekelare.be | One.com A/S | 11 Nov 2005 | - | - |
| 955 | negeso.asia | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Sep 2014 | 26 Sep 2017 | 24 Sep 2018 |
| 956 | negele.ch | - | - | - | - |
| 957 | negerijemantenlamtim.com | CV. Rumahweb Indonesia | 25 Oct 2016 | - | 25 Oct 2017 |
| 958 | negeritualamtim.com | CV. Rumahweb Indonesia | 26 Oct 2016 | - | 26 Oct 2017 |
| 959 | negerikatonlamtim.com | CV. Rumahweb Indonesia | 25 Oct 2016 | - | 25 Oct 2017 |
| 960 | negenborn.cc | Cronon AG | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2018 |
| 961 | negerber.ch | - | - | - | - |
| 962 | negerviertel.de | - | - | 7 Nov 2008 | - |
| 963 | negele-messtechnik.de | - | - | 7 May 2018 | - |
| 964 | negele.de | - | - | 6 Mar 2023 | - |
| 965 | negerkoepp.de | - | - | 1 Dec 2007 | - |
| 966 | negendank-patent.de | - | - | 6 Dec 2007 | - |
| 967 | neger.de | - | - | 11 Aug 2018 | - |
| 968 | negele-hartmetall.de | - | - | 17 Aug 2018 | - |
| 969 | negesti.de | - | - | 21 Apr 2017 | - |
| 970 | negerschwaenze.de | - | - | 23 May 2018 | - |
| 971 | negele-kuechenprofi.de | - | - | 13 Aug 2018 | - |
| 972 | negerfotzen.de | - | - | 4 Aug 2014 | - |
| 973 | negefis.de | - | - | 7 Feb 2012 | - |
| 974 | negele-elektrotechnik.de | - | - | 25 Mar 2022 | - |
| 975 | negenharrie.de | - | - | 15 Nov 2010 | - |
| 976 | negerkalle.de | - | - | 13 Nov 2007 | - |
| 977 | negeso-cms.de | - | - | 14 Apr 2015 | - |
| 978 | negel-tautz.de | - | - | 21 Jan 2025 | - |
| 979 | negerkeks.de | - | - | 6 Dec 2025 | - |
| 980 | negerinnensexdating.eu | - | - | - | - |
| 981 | negerluder.dk | - | 20 Feb 2009 | - | 28 Feb 2017 |
| 982 | negele-hartmetall.eu | - | - | - | - |
| 983 | negeso-cms.fr | Realtime Register B.V. | 26 May 2011 | 22 May 2016 | - |
| 984 | negerjoe.dk | - | 12 Jun 2009 | - | 30 Jun 2017 |
| 985 | negerpik.dk | - | 24 Jun 2009 | - | 30 Jun 2018 |
| 986 | negerbabes.dk | - | 20 Feb 2009 | - | 28 Feb 2018 |
| 987 | negeso.fr | Realtime Register B.V. | 7 Feb 2012 | 7 Feb 2016 | 2 Jul 2017 |
| 988 | negeso-cms.it | - | 6 Oct 2025 | 7 Oct 2025 | 6 Oct 2026 |
| 989 | negen.com.pl | - | 19 Apr 2017 | 11 Dec 2017 | 19 Apr 2018 |
| 990 | negeriagunglamtimkab.com | Namesilo, LLC | 4 Jul 2020 | 26 Jun 2025 | 4 Jul 2026 |
| 991 | negeriagunglamtim.com | CV. Rumahweb Indonesia | 28 Oct 2016 | - | 28 Oct 2017 |
| 992 | negentropy.co.uk | - | 1 Jan 2012 | 27 Mar 2025 | 1 Jan 2026 |
| 993 | negerate.com | - | 31 Oct 2016 | 31 Oct 2016 | 31 Oct 2017 |
| 994 | negesco.net | 1&1 Internet AG | 2 Nov 2016 | 6 Dec 2017 | 2 Nov 2018 |
| 995 | negesco.org | 1&1 Internet AG | 2 Nov 2016 | 3 Nov 2017 | 2 Nov 2018 |
| 996 | negesco.com | FastDomain Inc. | 2 Nov 2016 | 18 Oct 2025 | 2 Nov 2026 |
| 997 | negesco.online | 1&1 Internet AG | 2 Nov 2016 | 21 Dec 2016 | 2 Nov 2018 |
| 998 | negenzes.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 999 | negenfinsexbutik.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 5 Sep 2016 | 2 Jun 2017 |
| 1000 | negenvier.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
Displaying 1,000 out of 3,466 domains starting with the keyword "NEGE". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=nege
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |