With support for 
Keyword: NATIONWIDE
Reverse Whois » KEYWORD [nationwide ] { 20,824 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | nationwide.com.au | - | - | 21 Aug 2025 | - |
| 2 | nationwide.com | CSC Corporate Domains, Inc. | 4 Mar 1994 | 1 Mar 2025 | 5 Mar 2026 |
| 3 | nationwide.co.uk | - | - | 2 Dec 2024 | 6 Dec 2025 |
| 4 | nationwide.lk | - | - | - | - |
| 5 | nationwide.jobs | CSC Corporate Domains, Inc. | 10 Apr 2018 | - | 1 Apr 2026 |
| 6 | nationwide.wtf | CSC Corporate Domains, Inc. | 28 Jul 2014 | 18 Aug 2021 | 28 Jul 2021 |
| 7 | nationwide.financial | CSC Corporate Domains, Inc. | 28 Jul 2014 | 21 Jul 2025 | 28 Jul 2026 |
| 8 | nationwide.fail | CSC Corporate Domains, Inc. | 28 Jul 2014 | 18 Aug 2021 | 28 Jul 2021 |
| 9 | nationwide.creditcard | CSC Corporate Domains, Inc. | 26 Aug 2014 | 16 Sep 2020 | 26 Aug 2020 |
| 10 | nationwide.credit | CSC Corporate Domains, Inc. | 27 Aug 2014 | 18 Aug 2021 | 27 Aug 2021 |
| 11 | nationwide.claims | CSC Corporate Domains, Inc. | 26 Aug 2014 | - | 26 Aug 2026 |
| 12 | nationwide.insure | CSC Corporate Domains, Inc. | 3 Sep 2014 | - | 3 Sep 2025 |
| 13 | nationwide.finance | CSC Corporate Domains, Inc. | 3 Sep 2014 | - | 3 Sep 2026 |
| 14 | nationwide.digital | CSC Corporate Domains, Inc. | 3 Sep 2014 | - | 3 Sep 2026 |
| 15 | nationwide.accountants | CSC Corporate Domains, Inc. | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 16 | nationwide.loans | CSC Corporate Domains, Inc. | 9 Sep 2014 | - | 9 Sep 2026 |
| 17 | nationwide.dental | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 18 | nationwide.nyc | GoDaddy.com, LLC | 24 Apr 2019 | 30 Apr 2025 | 24 Apr 2026 |
| 19 | nationwide.marketing | GoDaddy.com, LLC | 9 Oct 2014 | 9 Oct 2014 | 9 Oct 2015 |
| 20 | nationwide.market | CSC Corporate Domains, Inc. | 12 Nov 2014 | 11 Oct 2017 | 12 Nov 2018 |
| 21 | nationwide.property | CSC Corporate Domains, Inc. | 25 Nov 2014 | 17 Nov 2024 | 25 Nov 2025 |
| 22 | nationwide.help | CSC Corporate Domains, Inc. | 25 Nov 2014 | 20 Nov 2024 | 25 Nov 2025 |
| 23 | nationwide.red | GMO Internet Inc. | 23 Nov 2014 | 23 Nov 2014 | 23 Nov 2015 |
| 24 | nationwide.business | CSC Corporate Domains, Inc. | 2 Dec 2014 | - | 2 Dec 2025 |
| 25 | nationwide.network | CSC Corporate Domains, Inc. | 2 Dec 2014 | - | 2 Dec 2025 |
| 26 | nationwide.fishing | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 27 | nationwide.services | Crazy Domains FZ-LLC | 4 Jan 2015 | 15 Nov 2024 | 4 Jan 2027 |
| 28 | nationwide.xn--ses554g | Internet Domain Name System Beijing Engineering Re… | 5 Jan 2015 | 5 Jan 2015 | 5 Dec 2016 |
| 29 | nationwide.mortgage | CSC Corporate Domains, Inc. | 13 Jan 2015 | 10 Jan 2017 | 13 Jan 2018 |
| 30 | nationwide.discount | CSC Corporate Domains, Inc. | 12 Jan 2015 | - | 12 Jan 2026 |
| 31 | nationwide.investments | CSC Corporate Domains, Inc. | 8 Jan 2015 | - | 8 Jan 2026 |
| 32 | nationwide.careers | CSC Corporate Domains, Inc. | 24 Feb 2014 | - | 24 Feb 2026 |
| 33 | nationwide.cash | CSC Corporate Domains, Inc. | 16 Jan 2015 | 9 Jan 2025 | 16 Jan 2026 |
| 34 | nationwide.work | CSC Corporate Domains, Inc. | 12 Jun 2018 | 10 Jun 2025 | 12 Jun 2026 |
| 35 | nationwide.florist | GoDaddy.com, LLC | 10 Mar 2015 | 4 Mar 2020 | 10 Mar 2021 |
| 36 | nationwide.porn | CSC Corporate Domains, Inc. | 13 Mar 2015 | 6 Mar 2017 | 13 Mar 2018 |
| 37 | nationwide.adult | CSC Corporate Domains, Inc. | 13 Mar 2015 | 2 May 2015 | 13 Mar 2016 |
| 38 | nationwide.link | Xiamen ChinaSource Internet Service Co., Ltd. | 15 Apr 2022 | 20 May 2023 | 15 Apr 2023 |
| 39 | nationwide.sucks | CSC Corporate Domains, Inc. | 20 Jun 2015 | 23 Jun 2020 | 20 Jun 2021 |
| 40 | nationwide.band | GoDaddy.com, LLC | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2017 |
| 41 | nationwide.click | Name.com, Inc. | 9 Mar 2018 | 14 Mar 2018 | 9 Mar 2019 |
| 42 | nationwide.realtor | Name Share, Inc. | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 43 | nationwide.sex | CSC Corporate Domains, Inc. | 1 Sep 2015 | 25 Jul 2017 | 1 Sep 2018 |
| 44 | nationwide.rocks | eNom, Inc. | 9 Sep 2015 | 13 Mar 2017 | 9 Sep 2017 |
| 45 | nationwide.host | Reserved for non-billable transactions where Regis… | 29 Nov 2015 | - | 29 Nov 2016 |
| 46 | nationwide.love | GoDaddy.com, LLC | 11 Oct 2021 | 11 Oct 2021 | 11 Oct 2022 |
| 47 | nationwide.club | Network Solutions, LLC | 8 Oct 2015 | 12 Oct 2015 | 7 Oct 2016 |
| 48 | nationwide.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2024 | 15 Oct 2025 |
| 49 | nationwide.pro | Dynadot, LLC | 29 May 2021 | 29 May 2021 | 29 May 2022 |
| 50 | nationwide.cars | CSC Corporate Domains, Inc. | 20 Jan 2016 | 13 Jan 2019 | 20 Jan 2020 |
| 51 | nationwide.car | CSC Corporate Domains, Inc. | 20 Jan 2016 | 18 Jan 2019 | 20 Jan 2020 |
| 52 | nationwide.auto | CSC Corporate Domains, Inc. | 20 Jan 2016 | 13 Jan 2019 | 20 Jan 2020 |
| 53 | nationwide.pet | CSC Corporate Domains, Inc. | 17 Feb 2016 | 11 Feb 2025 | 17 Feb 2026 |
| 54 | nationwide.engineer | Mesh Digital Limited | 1 Apr 2016 | 16 May 2017 | 1 Apr 2019 |
| 55 | nationwide.press | NameCheap, Inc. | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 56 | nationwide.vip | GoDaddy.com, LLC | 21 Feb 2025 | 26 Feb 2025 | 21 Feb 2026 |
| 57 | nationwide.mom | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 4 May 2016 | 11 Jun 2017 | 4 May 2017 |
| 58 | nationwide.space | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 8 Jul 2017 | 24 Aug 2017 | 8 Jul 2018 |
| 59 | nationwide.autos | Lexsynergy Limited | 26 May 2016 | 26 May 2016 | 26 May 2017 |
| 60 | nationwide.cloud | Porkbun, LLC | 20 Nov 2017 | 4 Jan 2025 | 20 Nov 2025 |
| 61 | nationwide.rehab | GoDaddy.com, LLC | 31 May 2016 | 31 May 2016 | 31 May 2017 |
| 62 | nationwide.store | CSC Corporate Domains, Inc. | 6 Jun 2016 | 30 May 2025 | 6 Jun 2026 |
| 63 | nationwide.solar | Mesh Digital Limited | 10 Apr 2014 | 6 Jun 2016 | 10 Apr 2017 |
| 64 | nationwide.insurance | CSC Corporate Domains, Inc. | 5 May 2016 | 3 May 2025 | 5 May 2026 |
| 65 | nationwide.top | Dynadot, LLC | 13 Jan 2025 | 13 Jan 2025 | 13 Jan 2026 |
| 66 | nationwide.support | CSC Corporate Domains, Inc. | 23 May 2014 | 16 May 2025 | 23 May 2026 |
| 67 | nationwide.healthcare | CSC Corporate Domains, Inc. | 13 Oct 2014 | 3 Nov 2022 | 13 Oct 2022 |
| 68 | nationwide.sexy | CSC Corporate Domains, Inc. | 25 Feb 2014 | 19 Feb 2019 | 25 Feb 2020 |
| 69 | nationwide.agency | CSC Corporate Domains, Inc. | 22 Apr 2014 | - | 22 Apr 2026 |
| 70 | nationwide.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Oct 2015 | - | 20 Oct 2016 |
| 71 | nationwide.foundation | CSC Corporate Domains, Inc. | 12 May 2014 | 10 May 2025 | 12 May 2026 |
| 72 | nationwide.properties | CSC Corporate Domains, Inc. | 27 May 2014 | 20 May 2022 | 27 May 2022 |
| 73 | nationwide.reviews | CSC Corporate Domains, Inc. | 29 Apr 2014 | - | 29 Apr 2026 |
| 74 | nationwide.london | Minds + Machines Registrar Limited | 27 Aug 2014 | 3 Sep 2015 | 27 Aug 2016 |
| 75 | nationwide.fund | CSC Corporate Domains, Inc. | 11 Aug 2014 | - | 11 Aug 2026 |
| 76 | nationwide.lease | CSC Corporate Domains, Inc. | 15 Jul 2014 | 6 Aug 2021 | 15 Jul 2021 |
| 77 | nationwide.biz | Rebel.com Corp. | 12 Feb 2011 | 29 Mar 2025 | 11 Feb 2026 |
| 78 | nationwide.motorcycles | Lexsynergy Limited | 16 Aug 2016 | 17 Jul 2020 | 16 Aug 2021 |
| 79 | nationwide.info | CSC Corporate Domains, Inc. | 18 Aug 2022 | - | 18 Aug 2026 |
| 80 | nationwide.mobi | CSC Corporate Domains, Inc. | 26 Sep 2006 | - | 26 Sep 2025 |
| 81 | nationwide.net | Tucows Domains Inc. | 4 Apr 1997 | 7 Mar 2025 | 5 Apr 2026 |
| 82 | nationwide.org | CSC Corporate Domains, Inc. | 7 Apr 1998 | 7 Apr 2025 | 6 Apr 2026 |
| 83 | nationwide.tech | CSC Corporate Domains, Inc. | 29 Jul 2015 | 27 Jun 2025 | 29 Jul 2026 |
| 84 | nationwide.xxx | - | 1 Dec 2011 | 30 Jan 2012 | 1 Dec 2021 |
| 85 | nationwide.coop | EnCirca, Inc. | 26 May 2006 | 29 May 2022 | 26 May 2023 |
| 86 | nationwide.tel | CSC Corporate Domains, Inc. | 20 Feb 2009 | 9 May 2021 | 22 Mar 2022 |
| 87 | nationwide.xyz | CSC Corporate Domains, Inc. | 8 Jun 2014 | 30 May 2025 | 8 Jun 2026 |
| 88 | nationwide.bz | Network Solutions, LLC | 8 Oct 2009 | 10 Oct 2016 | 8 Oct 2016 |
| 89 | nationwide.cc | GoDaddy.com, LLC | 23 Feb 2012 | 27 Feb 2025 | 23 Feb 2026 |
| 90 | nationwide.ca | - | 30 May 2022 | 30 May 2022 | 30 May 2023 |
| 91 | nationwide.co | GoDaddy.com, LLC | 13 Sep 2010 | 18 Sep 2024 | 12 Sep 2025 |
| 92 | nationwide.dk | - | 23 May 2000 | - | 30 Jun 2025 |
| 93 | nationwide.me | Dynadot, LLC | 18 Jun 2017 | 22 Jun 2025 | 18 Jun 2026 |
| 94 | nationwide.ws | GoDaddy.com, LLC | 29 Apr 2013 | 30 Apr 2025 | 29 Apr 2026 |
| 95 | nationwide.delivery | Uniregistrar Corp | 8 Nov 2016 | 14 Dec 2017 | 8 Nov 2018 |
| 96 | nationwide.realty | CSC Corporate Domains, Inc. | 17 Apr 2017 | 24 Mar 2025 | 17 Apr 2026 |
| 97 | nationwide.bank | CSC Corporate Domains, Inc. | 15 May 2015 | 7 Jul 2016 | 15 May 2017 |
| 98 | nationwide.com.ph | Deutchdomains, LLC | 30 Jul 2012 | 4 Jul 2016 | 30 Jul 2018 |
| 99 | nationwide.pink | NameCheap, Inc. | 17 Sep 2017 | 17 Sep 2017 | 17 Sep 2018 |
| 100 | nationwide.uk.com | NameCheap, Inc. | 24 May 2025 | 1 Jun 2025 | 24 May 2026 |
| 101 | nationwide.me.uk | - | 13 Sep 2002 | 14 Aug 2025 | 13 Sep 2026 |
| 102 | nationwide.org.uk | - | 6 Mar 1998 | 5 Mar 2025 | 6 Mar 2026 |
| 103 | nationwide.uk | - | 13 Jun 2014 | 7 Jun 2025 | 13 Jun 2026 |
| 104 | nationwide.bet | GoDaddy.com, LLC | 15 May 2018 | 26 Jun 2023 | 15 May 2023 |
| 105 | nationwide.online | Google, Inc. | 4 Aug 2020 | 21 Jul 2025 | 4 Aug 2026 |
| 106 | nationwide.dev | GoDaddy.com, LLC | 28 Feb 2019 | 5 Mar 2019 | 28 Feb 2020 |
| 107 | nationwide.wales | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Mar 2024 | 27 May 2025 | 15 Mar 2026 |
| 108 | nationwide.us | CSC Corporate Domains, Inc. | 19 Apr 2002 | 14 Apr 2025 | 18 Apr 2026 |
| 109 | nationwide.date | CSC Corporate Domains, Inc. | 20 Jun 2018 | 18 May 2025 | 20 Jun 2026 |
| 110 | nationwide.men | CSC Corporate Domains, Inc. | 20 Jun 2018 | 18 May 2025 | 20 Jun 2026 |
| 111 | nationwide.racing | CSC Corporate Domains, Inc. | 20 Jun 2018 | 18 May 2025 | 20 Jun 2026 |
| 112 | nationwide.webcam | CSC Corporate Domains, Inc. | 20 Jun 2018 | 18 May 2025 | 20 Jun 2026 |
| 113 | nationwide.gdn | Lexsynergy Limited | 27 Apr 2019 | 27 Apr 2021 | 27 Apr 2022 |
| 114 | nationwide.global | NameCheap, Inc. | 11 Dec 2020 | 11 Dec 2021 | 11 Dec 2022 |
| 115 | nationwide.site | CSC Corporate Domains, Inc. | 8 Jul 2015 | 6 Jun 2025 | 8 Jul 2026 |
| 116 | nationwide.website | CSC Corporate Domains, Inc. | 26 Aug 2014 | 25 Jul 2025 | 26 Aug 2026 |
| 117 | nationwide.design | CSC Corporate Domains, Inc. | 16 Nov 2020 | 15 Nov 2024 | 16 Nov 2025 |
| 118 | nationwide.vote | Google, Inc. | 17 Feb 2021 | 3 Jun 2025 | 17 Feb 2026 |
| 119 | nationwide.one | Google, Inc. | 28 Jul 2021 | 18 Jul 2025 | 28 Jul 2026 |
| 120 | nationwide.ae | - | - | - | - |
| 121 | nationwide.ai | CSC Corporate Domains, Inc. | 4 Feb 2020 | 4 Nov 2024 | 4 Feb 2026 |
| 122 | nationwide.cn | - | 17 Mar 2003 | - | 17 Mar 2026 |
| 123 | nationwide.jp | - | 1 Sep 2009 | 1 Oct 2024 | 30 Sep 2025 |
| 124 | nationwide.co.kr | - | 4 Jun 2012 | 16 Dec 2021 | 4 Jun 2023 |
| 125 | nationwide.co.nz | - | 1 Jun 1998 | 31 Aug 2024 | - |
| 126 | nationwide.kr | - | 16 Feb 2022 | 16 Feb 2022 | 16 Feb 2023 |
| 127 | nationwide.io | NameCheap, Inc. | 27 Jan 2015 | 9 Apr 2025 | 27 Jan 2025 |
| 128 | nationwide.de | - | - | 27 Jan 2017 | - |
| 129 | nationwide.co.in | GoDaddy.com, LLC | 14 Dec 2024 | 30 May 2025 | 14 Dec 2027 |
| 130 | nationwide.be | - | 10 Jan 2020 | - | - |
| 131 | nationwide.com.br | - | 23 Aug 1999 | 6 Sep 2022 | 23 Aug 2022 |
| 132 | nationwide.name | Dynadot, LLC | - | - | - |
| 133 | nationwide.com.cn | ???????????? | 13 Aug 2004 | - | 13 Aug 2028 |
| 134 | nationwide.app | 1API GmbH | 23 Jul 2020 | 8 Mar 2024 | 23 Jul 2025 |
| 135 | nationwide.associates | CSC Corporate Domains, Inc. | 15 Jul 2014 | 21 Jun 2025 | 15 Jul 2026 |
| 136 | nationwide.com.ng | - | 23 Jan 2022 | 1 Feb 2025 | 23 Jan 2026 |
| 137 | nationwide.bond | NameCheap, Inc. | 27 Mar 2022 | 8 May 2023 | 27 Mar 2023 |
| 138 | nationwide.co.th | - | 21 Mar 2001 | 22 Mar 2022 | 20 Mar 2027 |
| 139 | nationwide.buzz | CSC Corporate Domains, Inc. | 16 Sep 2020 | 17 Aug 2025 | 16 Sep 2026 |
| 140 | nationwide.career | CSC Corporate Domains, Inc. | 7 Aug 2014 | - | 18 Aug 2026 |
| 141 | nationwide.cm | - | 23 May 2010 | 24 May 2025 | 23 May 2026 |
| 142 | nationwide.fun | West263 International Limited | 11 Nov 2024 | 16 Dec 2024 | 11 Nov 2025 |
| 143 | nationwide.llc | GoDaddy.com, LLC | 7 May 2020 | 21 Jun 2025 | 7 May 2030 |
| 144 | nationwide.nz | - | 23 Apr 2019 | 6 Jul 2024 | - |
| 145 | nationwide.in | Dynadot, LLC | 23 Apr 2024 | 16 Aug 2025 | 23 Apr 2028 |
| 146 | nationwide.shop | GoDaddy.com, LLC | 20 Sep 2023 | 7 Mar 2024 | 20 Sep 2025 |
| 147 | nationwide.zip | CSC Corporate Domains, Inc. | 23 May 2023 | - | 23 May 2026 |
| 148 | nationwide.ie | - | 12 Jun 2011 | 23 Jul 2025 | 13 Jun 2026 |
| 149 | nationwide.it | - | 18 Aug 2020 | 4 Sep 2025 | 3 Sep 2025 |
| 150 | nationwide.net.au | - | - | 10 Jul 2024 | - |
| 151 | nationwide.nl | - | 16 Dec 2017 | 11 Oct 2022 | - |
| 152 | nationwide.ru | - | 23 Dec 2005 | - | 23 Dec 2025 |
| 153 | nationwide.cam | Dynadot, LLC | 16 Jun 2024 | 27 Jul 2025 | 16 Jun 2025 |
| 154 | nationwide.baby | Dynadot, LLC | 14 Oct 2024 | 8 Nov 2024 | 14 Oct 2025 |
| 155 | nationwide.id | Reserved | 29 Oct 2022 | 18 Dec 2024 | 29 Oct 2025 |
| 156 | nationwide.se | - | 23 Nov 2020 | 4 Nov 2024 | 23 Nov 2025 |
| 157 | nationwide.ng | - | 1 Nov 2023 | 17 Dec 2024 | 1 Nov 2025 |
| 158 | nationwide.org.in | GoDaddy.com, LLC | 8 Aug 2025 | 13 Aug 2025 | 8 Aug 2026 |
| 159 | nationwideindustrialsupply.com | Network Solutions, LLC | 17 Apr 2006 | 17 Feb 2024 | 17 Apr 2027 |
| 160 | nationwidevehiclecontracts.co.uk | - | 21 May 2002 | 22 May 2025 | 21 May 2026 |
| 161 | nationwide-intermediary.co.uk | - | 6 Oct 2008 | 2 Oct 2024 | 6 Oct 2025 |
| 162 | nationwidechildrens.org | DNC Holdings, Inc. | 28 Feb 2006 | 9 Apr 2025 | 28 Feb 2026 |
| 163 | nationwidehireuk.co.uk | - | 12 Nov 2009 | 13 Oct 2021 | 12 Nov 2030 |
| 164 | nationwidecandy.com | Dynadot, LLC | 10 Oct 2002 | 1 Apr 2025 | 10 Oct 2025 |
| 165 | nationwidecc.com | TurnCommerce, Inc. DBA NameBright.com | 22 Aug 2020 | 16 Aug 2021 | 22 Aug 2025 |
| 166 | nationwidenarrowboatsales.com | 1&1 Internet AG | 10 Feb 2010 | 24 Jun 2024 | 10 Feb 2026 |
| 167 | nationwidehandling.co.uk | - | 8 Oct 2006 | 8 Oct 2024 | 8 Oct 2025 |
| 168 | nationwidepackersandmovers.co.in | - | 25 Oct 2010 | 23 Nov 2016 | 25 Oct 2017 |
| 169 | nationwidelicensingsystem.org | GoDaddy.com, LLC | 9 Jul 2009 | 23 Aug 2024 | 9 Jul 2026 |
| 170 | nationwidedr.com | GoDaddy.com, LLC | 12 Jul 2002 | 12 Jul 2025 | 12 Jul 2026 |
| 171 | nationwidebeauty.com | Easy Street Domains, LLC | 29 Nov 2015 | 30 Nov 2024 | 29 Nov 2025 |
| 172 | nationwidehire.com.au | - | - | 27 May 2025 | - |
| 173 | nationwidesatellite.com | GoDaddy.com, LLC | 26 Aug 2001 | 29 Jan 2024 | 26 Aug 2025 |
| 174 | nationwideadvertising.com | Tucows Domains Inc. | 25 Mar 1999 | 27 Mar 2024 | 25 Mar 2026 |
| 175 | nationwidebank.com | CSC Corporate Domains, Inc. | 17 May 2003 | 13 May 2025 | 17 May 2026 |
| 176 | nationwide2u.com | Above.com Pty Ltd. | 5 Aug 2002 | 27 Jul 2025 | 5 Aug 2026 |
| 177 | nationwidepharmassist.com | Amazon Registrar, Inc. | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 178 | nationwidenationalpartners.com | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2024 | 21 Oct 2025 |
| 179 | nationwideinsurancepublicadjuster.com | GoDaddy.com, LLC | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 180 | nationwideinnovativesolutions.com | CSC Corporate Domains, Inc. | 21 Oct 2014 | 19 Oct 2020 | 21 Oct 2021 |
| 181 | nationwidefieldservicesllc.com | Wild West Domains, LLC | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2016 |
| 182 | nationwideffficefurniture.com | GoDaddy.com, LLC | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 183 | nationwideexcessandsurplusinsurance.com | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2024 | 21 Oct 2025 |
| 184 | nationwidedroneservices.com | GoDaddy.com, LLC | 1 Oct 2019 | 2 Oct 2024 | 1 Oct 2025 |
| 185 | nationwidedirectorsandofficersinsurance.com | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2024 | 21 Oct 2025 |
| 186 | nationwidecommercialinsurance.com | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2024 | 21 Oct 2025 |
| 187 | nationwidecg.com | GoDaddy.com, LLC | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2016 |
| 188 | nationwideautomatedsystemsfraud.com | GoDaddy.com, LLC | 26 Sep 2016 | 27 Sep 2024 | 26 Sep 2025 |
| 189 | nationwide-bathrooms.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 18 Dec 2006 | 11 Dec 2016 | 18 Dec 2018 |
| 190 | nationwide-cars.co.uk | - | 15 Nov 2024 | 28 Mar 2025 | 15 Nov 2025 |
| 191 | nationwide-homes.com | GoDaddy.com, LLC | 18 Feb 1998 | 6 Jan 2025 | 17 Feb 2031 |
| 192 | nationwide-jobs.co.uk | - | 10 Sep 2007 | 6 Sep 2024 | 10 Sep 2025 |
| 193 | nationwide-rewards.co.uk | - | 10 Apr 2014 | 6 Apr 2025 | 10 Apr 2026 |
| 194 | nationwideadvantagemortgage.com | CSC Corporate Domains, Inc. | 7 Nov 2001 | 3 Nov 2024 | 7 Nov 2025 |
| 195 | nationwideappraisals.com | Amazon Registrar, Inc. | 6 Jul 1999 | 22 Jun 2023 | 6 Jul 2028 |
| 196 | nationwidearena.com | CSC Corporate Domains, Inc. | 11 Sep 1998 | 14 Aug 2024 | 10 Sep 2025 |
| 197 | nationwidebarcode.com | GoDaddy.com, LLC | 9 Oct 2008 | 10 Oct 2024 | 9 Oct 2025 |
| 198 | nationwidebusinesses.co.uk | - | 26 Oct 1999 | 25 Oct 2024 | 26 Oct 2025 |
| 199 | nationwidedocs.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Apr 2010 | 13 Jun 2025 | 29 Apr 2026 |
| 200 | nationwideltd.co.uk | - | 4 Aug 1999 | 13 Jun 2024 | 4 Aug 2028 |
| 201 | nationwidemember.com | Wild West Domains, LLC | 16 May 2001 | 12 Sep 2022 | 16 May 2031 |
| 202 | nationwidepaintball.co.uk | - | 2 Mar 2005 | 2 Mar 2024 | 2 Mar 2027 |
| 203 | nationwidestudentloanhelp.com | TLDs LLC dba SRSplus | 7 Mar 2023 | 19 Apr 2024 | 7 Mar 2024 |
| 204 | nationwidevision.com | GoDaddy.com, LLC | 29 Jun 1999 | 30 Jun 2025 | 29 Jun 2026 |
| 205 | nationwidesteamer.com | Tucows Domains Inc. | 23 Oct 2014 | 27 Oct 2015 | 23 Oct 2016 |
| 206 | nationwideinsurancecenter.com | GoDaddy.com, LLC | 22 Oct 2014 | 23 Oct 2016 | 22 Oct 2017 |
| 207 | nationwideebto.com | eNom, Inc. | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 208 | nationwidecpas.com | GoDaddy.com, LLC | 22 Oct 2014 | 23 Oct 2024 | 22 Oct 2026 |
| 209 | nationwidebusinesscenters.com | GoDaddy.com, LLC | 22 Oct 2014 | 3 Jan 2024 | 22 Oct 2023 |
| 210 | nationwidebto.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 211 | nationwidetransportservices.com | GoDaddy.com, LLC | 18 Jul 2009 | 6 Sep 2022 | 18 Jul 2026 |
| 212 | nationwidenationalpartners.org | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2022 | 21 Oct 2022 |
| 213 | nationwidenationalpartners.net | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2022 | 21 Oct 2022 |
| 214 | nationwideexcessandsurplusinsurance.org | CSC Corporate Domains, Inc. | 21 Oct 2014 | 22 Oct 2024 | 21 Oct 2025 |
| 215 | nationwideexcessandsurplusinsurance.net | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2024 | 21 Oct 2025 |
| 216 | nationwidedirectorsandofficersinsurance.org | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2017 | 21 Oct 2018 |
| 217 | nationwidedirectorsandofficersinsurance.net | CSC Corporate Domains, Inc. | - | 16 Sep 2020 | - |
| 218 | nationwidecommercialinsurance.org | CSC Corporate Domains, Inc. | 21 Oct 2014 | 22 Oct 2024 | 21 Oct 2025 |
| 219 | nationwidecommercialinsurance.net | CSC Corporate Domains, Inc. | 21 Oct 2014 | 17 Oct 2024 | 21 Oct 2025 |
| 220 | nationwidewholesaleshop.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 221 | nationwidevalet.com | NameKing.com Inc. | 19 Sep 2005 | 31 Aug 2024 | 19 Sep 2025 |
| 222 | nationwidepw.com | Launchpad, Inc. | 5 Aug 2019 | 5 Aug 2019 | 5 Aug 2020 |
| 223 | nationwidepropertywholesaler.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 224 | nationwideinsuranceparkville.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2017 |
| 225 | nationwiderealty.org | NameCheap, Inc. | 15 Dec 2024 | 20 Dec 2024 | 15 Dec 2025 |
| 226 | nationwidecars.net | 1&1 Internet AG | 22 Oct 2014 | 6 Dec 2017 | 22 Oct 2018 |
| 227 | nationwidefinancialja.com | GoDaddy.com, LLC | 9 May 2015 | 9 May 2015 | 9 May 2016 |
| 228 | nationwideeviction.com | CloudFlare, Inc. | 4 Jan 2010 | 20 Jul 2021 | 4 Jan 2026 |
| 229 | nationwidedesk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 230 | nationwidecanopies.com | GoDaddy.com, LLC | 13 Aug 2018 | 14 Aug 2024 | 13 Aug 2026 |
| 231 | nationwiderecoverysystems.com | register.com, Inc. | 10 Feb 2014 | 11 Jan 2025 | 10 Feb 2027 |
| 232 | nationwidepharmacies.co.uk | - | 16 Jan 2024 | 21 Jul 2025 | 16 Jan 2026 |
| 233 | nationwidesafes.com | GoDaddy.com, LLC | 1 Sep 2005 | 23 Jan 2024 | 1 Mar 2026 |
| 234 | nationwideposting.com | MarkMonitor Inc. | 17 Mar 2004 | 12 Feb 2025 | 16 Mar 2028 |
| 235 | nationwideshingle.com | GoDaddy.com, LLC | 24 May 2013 | 25 May 2015 | 24 May 2016 |
| 236 | nationwide4g.net | Tucows Domains Inc. | 20 Oct 2012 | 24 Oct 2014 | 20 Oct 2015 |
| 237 | nationwidepap.com | GoDaddy.com, LLC | 25 May 2010 | 26 May 2015 | 25 May 2016 |
| 238 | nationwidecpap.com | DropCatch.com 1087 LLC | 11 Jul 2025 | 12 Jul 2025 | 11 Jul 2026 |
| 239 | nationwideconsultingservicesllc.com | GoDaddy.com, LLC | 26 May 2012 | 7 Jun 2015 | 26 May 2016 |
| 240 | nationwidewindshieldrepair.com | GoDaddy.com, LLC | 27 May 2011 | 27 May 2015 | 27 May 2016 |
| 241 | nationwidechaircoverandlinenrentals.com | Domain.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 242 | nationwidegear.com | Annulet LLC | 17 Dec 2016 | 3 Feb 2025 | 17 Dec 2025 |
| 243 | nationwidepaymentsolutions.mobi | GoDaddy.com, LLC | 28 May 2008 | 29 May 2015 | 28 May 2016 |
| 244 | nationwidewildposting.net | GoDaddy.com, LLC | 30 May 2007 | 30 May 2015 | 30 May 2016 |
| 245 | nationwidewebsolutions.com | eNom, Inc. | 29 Oct 2017 | 29 Oct 2017 | 29 Oct 2018 |
| 246 | nationwideinsurance.info | Dynadot, LLC | 26 Dec 2018 | 26 Dec 2018 | 26 Dec 2019 |
| 247 | nationwidejudicialsupport.com | GoDaddy.com, LLC | 31 May 2009 | 31 May 2015 | 31 May 2016 |
| 248 | nationwide-deliveries.com | - | 15 Oct 2016 | 15 Oct 2016 | 15 Oct 2017 |
| 249 | nationwidedriveways.net | Tucows Domains Inc. | 25 Oct 2014 | 29 Oct 2017 | 25 Oct 2017 |
| 250 | nationwidecollisionservices.com | GoDaddy.com, LLC | 12 Jan 2008 | 28 Mar 2008 | 12 Jan 2018 |
| 251 | nationwideunderbridgeaccesscompanynorthcarolina.com | GoDaddy.com, LLC | 26 Oct 2014 | 17 Jun 2016 | 26 Oct 2018 |
| 252 | nationwideunderbridgeaccesscompany.com | GoDaddy.com, LLC | 26 Oct 2014 | 17 Jun 2016 | 26 Oct 2018 |
| 253 | nationwidegrouprealestate.com | Wild West Domains, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 254 | nationwideautomart.com | GoDaddy.com, LLC | 17 Mar 2021 | 15 Apr 2025 | 17 Mar 2026 |
| 255 | nationwidecheerdance.com | GoDaddy.com, LLC | 2 Jun 2010 | 3 Jun 2015 | 2 Jun 2016 |
| 256 | nationwidefreedomsolutions.net | Wild West Domains, LLC | 4 Jun 2010 | 4 Jun 2015 | 4 Jun 2016 |
| 257 | nationwidedish.us | Wild West Domains, LLC | 24 May 2011 | 4 Jun 2013 | 23 May 2015 |
| 258 | nationwideunderbridgeaccesscompany.info | GoDaddy.com, LLC | 26 Oct 2014 | 17 Jun 2016 | 26 Oct 2018 |
| 259 | nationwidemortgagelenders.net | GoDaddy.com, LLC | 23 May 2012 | 23 May 2015 | 23 May 2016 |
| 260 | nationwidecoastalinsurancequote.com | GoDaddy.com, LLC | 27 Oct 2014 | 28 Oct 2016 | 27 Oct 2017 |
| 261 | nationwidecoastalinsurance.com | GoDaddy.com, LLC | 27 Oct 2014 | 28 Oct 2016 | 27 Oct 2017 |
| 262 | nationwideforklift.com | GoDaddy.com, LLC | 4 Dec 2005 | 2 Jan 2025 | 1 Jan 2028 |
| 263 | nationwideforklifts.com | GoDaddy.com, LLC | 4 Dec 2005 | 2 Jan 2025 | 1 Jan 2028 |
| 264 | nationwidemortgage.com | Uniregistrar Corp | 11 Aug 1997 | 5 Jul 2024 | 10 Aug 2032 |
| 265 | nationwideselect.com | GoDaddy.com, LLC | 30 Apr 2008 | 28 Oct 2024 | 27 Oct 2025 |
| 266 | nationwidepark.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Oct 2017 | 5 Oct 2017 | 5 Oct 2022 |
| 267 | nationwidestadium.com | GoDaddy.com, LLC | 16 Mar 2015 | 19 Mar 2015 | 16 Mar 2016 |
| 268 | nationwideministries.com | NameCheap, Inc. | 27 Jul 2022 | 7 Sep 2023 | 27 Jul 2023 |
| 269 | nationwideairlinesflights.com | GoDaddy.com, LLC | 27 Sep 2014 | 21 Apr 2015 | 27 Sep 2015 |
| 270 | nationwideflightdelays.com | GoDaddy.com, LLC | 27 Sep 2014 | 15 Mar 2015 | 27 Sep 2015 |
| 271 | nationwideflightstatus.com | GoDaddy.com, LLC | 27 Sep 2014 | 21 Apr 2015 | 27 Sep 2015 |
| 272 | nationwidesportsbet.com | GoDaddy.com, LLC | 11 Nov 2012 | 10 Nov 2014 | 11 Nov 2015 |
| 273 | nationwidefsbo.com | GoDaddy.com, LLC | 15 Sep 2017 | 16 Sep 2024 | 15 Sep 2025 |
| 274 | nationwidetestingsystems.com | eNom, Inc. | 7 Jan 2011 | 18 Jan 2025 | 7 Jan 2026 |
| 275 | nationwidemortgageconsultant.com | eNom, Inc. | 6 Jan 2011 | 23 Jan 2017 | 6 Jan 2018 |
| 276 | nationwideplastics.com | eNom, Inc. | 29 Nov 2007 | 22 Nov 2024 | 29 Nov 2025 |
| 277 | nationwideinvestigations.com | TurnCommerce, Inc. DBA NameBright.com | 14 Aug 2017 | 8 Aug 2020 | 14 Aug 2025 |
| 278 | nationwidediesel.com | TurnCommerce, Inc. DBA NameBright.com | 14 Apr 2020 | 8 Apr 2021 | 14 Apr 2026 |
| 279 | nationwidebailbonding.com | eNom, Inc. | 13 Mar 2011 | 8 Mar 2017 | 13 Mar 2018 |
| 280 | nationwidenightlife.com | GoDaddy.com, LLC | 29 Jul 2005 | 14 Apr 2015 | 2 Dec 2015 |
| 281 | nationwideunderbridgeaccesscompany.us | GoDaddy.com, LLC | 26 Oct 2014 | 17 Jun 2016 | 25 Oct 2018 |
| 282 | nationwideunderbridgeaccesscompany.org | Namesilo, LLC | 15 Nov 2024 | 22 Nov 2024 | 15 Nov 2025 |
| 283 | nationwideunderbridgeaccesscompany.net | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 284 | nationwidetrade.com | eNom, Inc. | 14 Dec 2006 | 19 Aug 2025 | 14 Dec 2025 |
| 285 | nationwidehvac.com | GoDaddy.com, LLC | 8 Dec 2007 | 28 Feb 2025 | 8 Dec 2025 |
| 286 | nationwideequities.com | eNom, Inc. | 17 Apr 2012 | 21 Aug 2025 | 17 Apr 2026 |
| 287 | nationwideinsuranceagent.com | eNom, Inc. | 17 Jul 2012 | 19 Jul 2025 | 17 Jul 2026 |
| 288 | nationwideit.com | eNom, Inc. | 15 Aug 2007 | 19 Aug 2025 | 15 Aug 2026 |
| 289 | nationwidemortgageservices.com | eNom, Inc. | 10 Jul 2009 | 18 Jul 2017 | 10 Jul 2018 |
| 290 | nationwideorganics.com | DropCatch.com 1334 LLC | 8 Sep 2023 | 9 Sep 2023 | 8 Sep 2025 |
| 291 | nationwidetesting.com | eNom, Inc. | 25 Sep 2009 | 21 Sep 2024 | 25 Sep 2025 |
| 292 | nationwidecapitalfunding.com | eNom, Inc. | 13 Jul 2012 | 19 Jul 2025 | 13 Jul 2026 |
| 293 | nationwidedistributors.com | eNom, Inc. | 21 Apr 2012 | 21 Apr 2025 | 21 Apr 2026 |
| 294 | nationwidehomeretention.com | eNom, Inc. | 17 Apr 2012 | 10 May 2017 | 17 Apr 2018 |
| 295 | nationwidelandtitle.com | eNom, Inc. | 6 Apr 2009 | 19 Apr 2017 | 6 Apr 2018 |
| 296 | nationwidelegalresource.com | eNom, Inc. | 12 Feb 2009 | 13 Feb 2024 | 12 Feb 2025 |
| 297 | nationwidelegalservice.com | GoDaddy.com, LLC | 5 Dec 2010 | 6 Dec 2024 | 5 Dec 2025 |
| 298 | nationwidemanagement.com | eNom, Inc. | 14 Feb 2006 | 22 Feb 2025 | 14 Feb 2026 |
| 299 | nationwidemedicalequipment.com | GoDaddy.com, LLC | 10 Aug 2021 | 14 Oct 2022 | 10 Aug 2026 |
| 300 | nationwideautotransporter.com | eNom, Inc. | 29 Sep 2010 | 21 Dec 2016 | 29 Sep 2017 |
| 301 | nationwidebookkeeping.com | GoDaddy.com, LLC | 1 Apr 2021 | 2 Apr 2025 | 1 Apr 2026 |
| 302 | nationwidebuilder.com | eNom, Inc. | 3 Nov 2011 | 2 Nov 2024 | 3 Nov 2025 |
| 303 | nationwidebusinessservice.com | eNom, Inc. | 12 Jul 2009 | 18 Jul 2017 | 12 Jul 2018 |
| 304 | nationwidebusinessservices.com | GoDaddy.com, LLC | 24 Jul 2021 | 5 Aug 2025 | 24 Jul 2026 |
| 305 | nationwidecheck.com | NameKing.com Inc. | 18 Jul 2020 | 18 Jul 2020 | 18 Jul 2021 |
| 306 | nationwidecommercialfinancing.com | Hostinger, UAB | 17 Sep 2023 | 18 Jul 2024 | 17 Sep 2026 |
| 307 | nationwideinvestmentservices.com | eNom, Inc. | 22 Nov 2011 | 21 Dec 2016 | 22 Nov 2017 |
| 308 | nationwidejobboard.com | eNom, Inc. | 2 Aug 2012 | 23 Jul 2017 | 2 Aug 2017 |
| 309 | nationwidecomputerservice.com | eNom, Inc. | 18 Sep 2011 | 13 Sep 2024 | 18 Sep 2025 |
| 310 | nationwideconnect.com | TurnCommerce, Inc. DBA NameBright.com | 15 Jan 2022 | 22 Aug 2022 | 15 Jan 2026 |
| 311 | nationwidedebtconsolidation.com | 1&1 Internet AG | 25 Sep 2022 | 25 Sep 2022 | 25 Sep 2025 |
| 312 | nationwidedeliverysystems.com | eNom, Inc. | 6 May 2009 | 17 May 2017 | 6 May 2018 |
| 313 | nationwidedentallab.com | - | 3 Mar 2024 | 5 May 2025 | 3 Mar 2025 |
| 314 | nationwidedevelopment.com | eNom, Inc. | 22 Nov 2011 | 22 Nov 2024 | 22 Nov 2025 |
| 315 | nationwideelectricalservices.com | eNom, Inc. | 8 Jan 2012 | 23 Jan 2017 | 8 Jan 2018 |
| 316 | nationwideenvironmentalservices.com | Squarespace Domains LLC | 25 Jun 2024 | 6 Aug 2025 | 25 Jun 2025 |
| 317 | nationwidefinancialadvisors.com | Name.com, Inc. | 21 Nov 2019 | 21 Nov 2019 | 21 Nov 2020 |
| 318 | nationwidefloor.com | eNom, Inc. | 10 Oct 2009 | 10 Oct 2024 | 10 Oct 2025 |
| 319 | nationwidehomehealthcare.com | - | 28 Jan 2025 | 28 Jan 2025 | 28 Jan 2026 |
| 320 | nationwidehomelending.com | eNom, Inc. | 18 Apr 2011 | 6 Aug 2025 | 18 Apr 2026 |
| 321 | nationwidehomesales.com | GoDaddy.com, LLC | 28 Jan 2022 | 28 Jan 2025 | 28 Jan 2026 |
| 322 | nationwideinvestigation.com | GoDaddy.com, LLC | 15 Mar 2023 | 22 Mar 2025 | 15 Mar 2026 |
| 323 | nationwidelendinggroup.com | Google, Inc. | 19 Jul 2024 | 4 Jul 2025 | 19 Jul 2026 |
| 324 | nationwidelimousineservice.com | GoDaddy.com, LLC | 21 Jul 2023 | 22 Jul 2025 | 21 Jul 2027 |
| 325 | nationwidemodification.com | eNom, Inc. | 2 Oct 2010 | 21 Dec 2016 | 2 Oct 2017 |
| 326 | nationwidetruck.com | eNom, Inc. | 18 Aug 2010 | 19 Aug 2025 | 18 Aug 2026 |
| 327 | nationwidewaterproofing.com | DropCatch.com 877 LLC | 16 Jun 2024 | 17 Jun 2024 | 16 Jun 2026 |
| 328 | nationwiderealestatesolutions.com | Launchpad, Inc. | 17 May 2021 | 6 May 2025 | 17 May 2026 |
| 329 | nationwidereferral.com | eNom, Inc. | 25 Sep 2010 | 21 Sep 2024 | 25 Sep 2025 |
| 330 | nationwideyellow.com | eNom, Inc. | 17 Jun 2012 | 30 Aug 2024 | 17 Jun 2024 |
| 331 | nationwidemotor.com | TurnCommerce, Inc. DBA NameBright.com | 23 Mar 2020 | 3 May 2025 | 23 Mar 2025 |
| 332 | nationwideofficesupplies.com | - | 25 Jul 2022 | 7 Sep 2024 | 25 Jul 2024 |
| 333 | nationwidepayrollservice.com | eNom, Inc. | 23 Dec 2010 | 21 Dec 2016 | 23 Dec 2017 |
| 334 | nationwidepest.com | GoDaddy.com, LLC | 4 Nov 2011 | 13 Dec 2024 | 4 Nov 2025 |
| 335 | nationwidepropertymanagement.com | Dynadot, LLC | 19 Jul 2024 | 17 Jul 2025 | 19 Jul 2026 |
| 336 | nationwiderentalcar.com | eNom, Inc. | 5 Jan 2012 | 4 Aug 2025 | 5 Jan 2026 |
| 337 | nationwiderisk.com | eNom, Inc. | 27 Aug 2012 | 14 Aug 2025 | 27 Aug 2026 |
| 338 | nationwidesign.com | eNom, Inc. | 22 Jan 2008 | 30 Jan 2025 | 22 Jan 2026 |
| 339 | nationwidetaxconsultants.com | GoDaddy.com, LLC | 4 Jan 2024 | 4 Jan 2024 | 4 Jan 2026 |
| 340 | nationwidetree.com | Name.com, Inc. | 28 Apr 2022 | 11 Jun 2025 | 28 Apr 2026 |
| 341 | nationwidemortgageservice.com | GoDaddy.com, LLC | 16 Oct 2023 | 17 Oct 2023 | 16 Oct 2024 |
| 342 | nationwidemove.com | eNom, Inc. | 29 Mar 2001 | 20 Mar 2025 | 28 Mar 2026 |
| 343 | nationwidepromotion.com | eNom, Inc. | 18 Jul 2011 | 18 Jul 2017 | 18 Jul 2018 |
| 344 | nationwidepropertyservices.com | GoDaddy.com, LLC | 16 Jul 2009 | 17 Jul 2025 | 16 Jul 2026 |
| 345 | nationwiderealestateservice.com | eNom, Inc. | 11 Apr 2009 | 27 Apr 2017 | 11 Apr 2018 |
| 346 | nationwiderestoration.com | eNom, Inc. | 16 Apr 2002 | 17 Apr 2025 | 16 Apr 2026 |
| 347 | nationwidesecurityservices.com | eNom, Inc. | 1 Jan 2011 | 3 Jan 2025 | 1 Jan 2026 |
| 348 | nationwidetutors.com | Webfusion Ltd. | 24 Jul 2025 | 24 Jul 2025 | 24 Jul 2035 |
| 349 | nationwideprivateinvestigator.com | GoDaddy.com, LLC | 23 Apr 2009 | 29 Mar 2015 | 23 Apr 2016 |
| 350 | nationwiderealestateinvesting.com | GoDaddy.com, LLC | 10 Dec 2010 | 21 Jan 2025 | 10 Dec 2024 |
| 351 | nationwidetire.com | GoDaddy.com, LLC | 25 Feb 1999 | 2 Dec 2024 | 25 Feb 2026 |
| 352 | nationwide4g.com | GoDaddy.com, LLC | 8 Nov 2013 | 13 Feb 2024 | 8 Nov 2026 |
| 353 | nationwidetechnology.com | GoDaddy.com, LLC | 17 Jan 2016 | 20 Sep 2022 | 17 Jan 2026 |
| 354 | nationwiderenewal.com | GoDaddy.com, LLC | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 355 | nationwideprop.com | GoDaddy.com, LLC | 28 Oct 2014 | 30 Oct 2023 | 28 Oct 2025 |
| 356 | nationwidepps.com | DropCatch.com 1151 LLC | 6 Apr 2017 | 6 Apr 2017 | 6 Apr 2018 |
| 357 | nationwidephysicianplacementservices.com | GoDaddy.com, LLC | 28 Oct 2014 | 20 Apr 2015 | 28 Oct 2016 |
| 358 | nationwidemovingus.com | GoDaddy.com, LLC | 28 Oct 2014 | 11 Aug 2016 | 28 Oct 2017 |
| 359 | nationwidemobilelivescan.com | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 360 | nationwidebailbonds.com | GoDaddy.com, LLC | 14 Jan 2018 | 4 Jan 2025 | 14 Jan 2026 |
| 361 | nationwidecareerfairs.com | Domain.com, LLC | 6 Aug 2016 | 5 Aug 2025 | 6 Aug 2026 |
| 362 | nationwidemedicalsupply.com | Epik Inc. | 14 Oct 2004 | 3 Jan 2024 | 14 Oct 2025 |
| 363 | nationwidemovingquotes.com | GoDaddy.com, LLC | 10 May 2023 | 22 Jul 2024 | 10 May 2024 |
| 364 | nationwidetech.com | DropCatch.com 1526 LLC | 7 Feb 2025 | 8 Feb 2025 | 7 Feb 2026 |
| 365 | nationwide9inn.com | GoDaddy.com, LLC | 8 Jul 2013 | 2 May 2015 | 8 Jul 2015 |
| 366 | nationwideinstalls.com | Dynadot, LLC | 23 Dec 2022 | 22 Aug 2025 | 23 Dec 2025 |
| 367 | nationwideusa.com | Dynadot, LLC | 28 Apr 2011 | 17 Aug 2025 | 28 Apr 2026 |
| 368 | nationwideautomotive.com | GoDaddy.com, LLC | 7 Feb 2005 | 20 Mar 2025 | 7 Feb 2026 |
| 369 | nationwideexecutivesearch.com | eNom, Inc. | 30 Oct 2010 | 18 Nov 2014 | 30 Oct 2015 |
| 370 | nationwideloans.org | GoDaddy.com, LLC | 18 Apr 2013 | 17 Mar 2015 | 18 Apr 2016 |
| 371 | nationwideinsurance.me | NameCheap, Inc. | 20 Jul 2023 | 31 Aug 2024 | 20 Jul 2024 |
| 372 | nationwideautoservice.com | eNom, Inc. | 4 Oct 2009 | 4 Oct 2024 | 4 Oct 2025 |
| 373 | nationwidedistributor.com | Google, Inc. | 10 Oct 2008 | 25 Sep 2024 | 10 Oct 2025 |
| 374 | nationwidecorporation.com | eNom, Inc. | 13 Nov 2010 | 8 Nov 2024 | 13 Nov 2025 |
| 375 | nationwidechurch.com | TurnCommerce, Inc. DBA NameBright.com | 10 Feb 2021 | 23 Mar 2025 | 10 Feb 2025 |
| 376 | nationwidecustomhome.com | eNom, Inc. | 24 Feb 2011 | 22 Feb 2017 | 24 Feb 2018 |
| 377 | nationwideinsuranceservice.com | eNom, Inc. | 4 Jan 2012 | 23 Jan 2017 | 4 Jan 2018 |
| 378 | nationwidevanrental.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jun 2011 | 30 Jul 2020 | 18 Jun 2020 |
| 379 | nationwidecable.com | eNom, Inc. | 29 Jul 2010 | 5 Aug 2025 | 29 Jul 2026 |
| 380 | nationwidedata.com | eNom, Inc. | 16 May 2010 | 26 May 2025 | 16 May 2026 |
| 381 | nationwidemortgagecompany.com | eNom, Inc. | 24 Dec 2012 | 27 Dec 2024 | 24 Dec 2025 |
| 382 | nationwidehomecare.com | Moniker Online Services LLC | 23 Mar 2007 | 21 Mar 2025 | 23 Mar 2026 |
| 383 | nationwidebuick.com | GoDaddy.com, LLC | 7 Nov 2011 | 19 Jan 2025 | 7 Nov 2024 |
| 384 | nationwidecadillac.com | GoDaddy.com, LLC | 31 Mar 2011 | 12 Apr 2024 | 31 Mar 2025 |
| 385 | nationwidechevrolet.com | GoDaddy.com, LLC | 14 Feb 2011 | 11 Jan 2025 | 14 Feb 2026 |
| 386 | nationwideseats.com | GoDaddy.com, LLC | 20 Jul 2021 | 20 Jul 2021 | 20 Jul 2022 |
| 387 | nationwidemovingstorage.com | - | 23 Jul 2024 | 1 Sep 2025 | 1 Aug 2025 |
| 388 | nationwidevison.com | GoDaddy.com, LLC | 27 Jan 2013 | 8 Jan 2025 | 27 Jan 2026 |
| 389 | nationwidephotography.com | GoDaddy.com, LLC | 20 Jul 2005 | 21 Jul 2025 | 20 Jul 2027 |
| 390 | nationwidedeptdirect.com | Key-Systems GmbH | 12 Aug 2013 | 18 Aug 2015 | 12 Aug 2017 |
| 391 | nationwidedebtrecovery.com | eNom, Inc. | 19 Mar 2000 | 13 Mar 2025 | 19 Mar 2026 |
| 392 | nationwidesales.com | GoDaddy.com, LLC | 15 Apr 1999 | 15 Apr 2024 | 15 Apr 2027 |
| 393 | nationwidemachinery.com | GoDaddy.com, LLC | 29 Jul 2009 | 29 Jul 2025 | 29 Jul 2026 |
| 394 | nationwideadvocacy.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2025 | 28 May 2026 |
| 395 | nationwideautoloan.com | Network Solutions, LLC | 20 Mar 2010 | 22 Jun 2024 | 20 Mar 2026 |
| 396 | nationwidegeothermal.com | GoDaddy.com, LLC | 11 Aug 2009 | 4 May 2015 | 11 Aug 2016 |
| 397 | nationwidedoctors.net | GoDaddy.com, LLC | 26 May 2008 | 1 Jun 2015 | 26 May 2016 |
| 398 | nationwidemovingandstorage.com | Namesilo, LLC | 24 Sep 2023 | 25 Sep 2024 | 24 Sep 2025 |
| 399 | nationwide411.com | NameCheap, Inc. | 12 Oct 2023 | 25 Sep 2024 | 12 Oct 2025 |
| 400 | nationwidesecuritysystem.com | GoDaddy.com, LLC | 4 Jan 2022 | 17 Mar 2024 | 4 Jan 2024 |
| 401 | nationwidesupportservices.com | TurnCommerce, Inc. DBA NameBright.com | 29 Oct 2014 | 11 Dec 2024 | 29 Oct 2024 |
| 402 | nationwidepcrepair.com | eNom, Inc. | 29 Oct 2014 | 30 Oct 2014 | 29 Oct 2015 |
| 403 | nationwidehomevalue.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2023 | 29 Oct 2026 |
| 404 | nationwidepromos.com | GoDaddy.com, LLC | 11 May 2005 | 12 May 2025 | 11 May 2027 |
| 405 | nationwidemessenger.com | GoDaddy.com, LLC | 18 Oct 2019 | 19 Oct 2024 | 18 Oct 2025 |
| 406 | nationwideautomobiles.com | GoDaddy.com, LLC | 14 Nov 2006 | 15 Nov 2023 | 14 Nov 2025 |
| 407 | nationwidediscount.com | eNom, Inc. | 18 Sep 1998 | 13 Sep 2024 | 17 Sep 2025 |
| 408 | nationwidediscounts.com | Sharkweek Domains LLC | 6 Dec 2022 | 19 Feb 2024 | 6 Dec 2023 |
| 409 | nationwidehealthcoverage.com | GoDaddy.com, LLC | 3 Feb 2020 | 5 Mar 2025 | 3 Feb 2026 |
| 410 | nationwideplan.com | NameKing.com Inc. | 11 Aug 2022 | 11 Aug 2025 | 11 Aug 2026 |
| 411 | nationwidetreeservice.com | eNom, Inc. | 23 Sep 2024 | 23 Sep 2024 | 23 Sep 2025 |
| 412 | nationwidedebtpartners.com | GoDaddy.com, LLC | 2 Oct 2009 | 29 Jan 2015 | 2 Oct 2015 |
| 413 | nationwided.com | GoDaddy.com, LLC | 14 Jun 2012 | 25 May 2025 | 14 Jun 2026 |
| 414 | nationwideconsumercredit.com | eNom, Inc. | 18 Aug 2013 | 19 Aug 2025 | 18 Aug 2026 |
| 415 | nationwidelitigation.com | eNom, Inc. | 31 Aug 2013 | 26 Aug 2025 | 31 Aug 2026 |
| 416 | nationwidesports.com | eNom, Inc. | 17 Sep 1999 | 16 Sep 2024 | 17 Sep 2025 |
| 417 | nationwiderugs.com | GoDaddy.com, LLC | 6 Nov 2006 | 17 Oct 2024 | 17 Oct 2025 |
| 418 | nationwidemortgagebankers.com | GoDaddy.com, LLC | 2 Nov 2012 | 4 Apr 2024 | 2 Nov 2028 |
| 419 | nationwideguards.com | DropCatch.com 1382 LLC | 21 Jun 2025 | 22 Jun 2025 | 21 Jun 2026 |
| 420 | nationwidepaint.com | GoDaddy.com, LLC | 9 Mar 2021 | 13 Apr 2025 | 9 Mar 2026 |
| 421 | nationwideshortsale.com | Wix.com Ltd. | 14 Aug 2023 | 16 Jul 2025 | 14 Aug 2027 |
| 422 | nationwidereproductions.com | register.com, Inc. | 30 Oct 2014 | 30 Sep 2016 | 30 Oct 2017 |
| 423 | nationwiderehabbers.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2016 | 31 Oct 2018 |
| 424 | nationwiderehabber.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2016 |
| 425 | nationwiderealtyaz.com | Wild West Domains, LLC | 30 Oct 2014 | 31 Oct 2016 | 30 Oct 2017 |
| 426 | nationwidequicksale.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2016 |
| 427 | nationwideprivatelenders.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2016 | 31 Oct 2018 |
| 428 | nationwideprivatelender.com | GoDaddy.com, LLC | 25 May 2023 | 6 Aug 2024 | 25 May 2024 |
| 429 | nationwidemerchantprogram.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2016 | 31 Oct 2018 |
| 430 | nationwidelandlords.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2016 | 31 Oct 2018 |
| 431 | nationwidelandlord.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2016 | 31 Oct 2018 |
| 432 | nationwidefidelitybond.com | Amazon Registrar, Inc. | 30 Oct 2014 | 25 Sep 2024 | 30 Oct 2025 |
| 433 | nationwidedebtsettlement.mobi | GoDaddy.com, LLC | 15 Nov 2010 | 16 Nov 2016 | 15 Nov 2018 |
| 434 | nationwidedebtsettlement.net | GoDaddy.com, LLC | 27 Nov 2010 | 28 Nov 2016 | 27 Nov 2018 |
| 435 | nationwidedebtsettlement.org | GoDaddy.com, LLC | 15 Nov 2010 | 30 Dec 2024 | 15 Nov 2025 |
| 436 | nationwidedebtsettlement.us | GoDaddy.com, LLC | 15 Nov 2010 | 4 Nov 2016 | 14 Nov 2017 |
| 437 | nationwidecreditcardhelp.us | GoDaddy.com, LLC | 2 Feb 2011 | 2 Feb 2017 | 1 Feb 2019 |
| 438 | nationwidecreditcardrelief.com | GoDaddy.com, LLC | 2 Feb 2011 | 25 Apr 2015 | 2 Feb 2016 |
| 439 | nationwidecreditcardrelief.org | GoDaddy.com, LLC | 2 Feb 2011 | 3 Feb 2017 | 2 Feb 2019 |
| 440 | nationwidecreditcardrelief.us | GoDaddy.com, LLC | 2 Feb 2011 | 2 Feb 2017 | 1 Feb 2019 |
| 441 | nationwidedebtsettlement.biz | GoDaddy.com, LLC | 15 Nov 2010 | 15 Nov 2016 | 14 Nov 2017 |
| 442 | nationwidedebtsettlement.ca | - | 15 Nov 2010 | 16 Nov 2016 | 15 Nov 2018 |
| 443 | nationwidedebtsettlement.info | GoDaddy.com, LLC | 15 Nov 2010 | 16 Nov 2016 | 15 Nov 2018 |
| 444 | nationwidecreditcardhelp.com | GoDaddy.com, LLC | 2 Feb 2011 | 25 Apr 2015 | 2 Feb 2016 |
| 445 | nationwidecreditcardhelp.org | GoDaddy.com, LLC | 2 Feb 2011 | 3 Feb 2017 | 2 Feb 2019 |
| 446 | nationwidetaxsettlement.org | GoDaddy.com, LLC | 28 Oct 2010 | 29 Oct 2016 | 28 Oct 2017 |
| 447 | nationwidetaxsettlement.us | GoDaddy.com, LLC | 28 Oct 2010 | 28 Oct 2016 | 27 Oct 2017 |
| 448 | nationwidehomebuyer.net | GoDaddy.com, LLC | 18 Sep 2023 | 5 Jan 2024 | 18 Sep 2025 |
| 449 | nationwidecanhelp.com | GoDaddy.com, LLC | 23 Apr 2011 | 23 Apr 2011 | 23 Apr 2021 |
| 450 | nationwidepeople.biz | Tucows Domains Inc. | 30 Nov 2004 | 3 Dec 2022 | 29 Nov 2022 |
| 451 | nationwideindustrialsolutions.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2016 |
| 452 | nationwideindustrialservices.com | GoDaddy.com, LLC | 13 Feb 2019 | 13 Feb 2025 | 13 Feb 2026 |
| 453 | nationwidebundle.com | Tucows Domains Inc. | 28 Oct 2011 | 1 Nov 2014 | 28 Oct 2015 |
| 454 | nationwide-public-claims-adjuster.com | Launchpad, Inc. | 18 Sep 2013 | 17 Sep 2016 | 18 Sep 2017 |
| 455 | nationwidepublicity.com | GoDaddy.com, LLC | 22 May 2005 | 23 May 2025 | 22 May 2026 |
| 456 | nationwidesalesteam.com | GoDaddy.com, LLC | 20 Jan 2012 | 28 Apr 2015 | 20 Jan 2016 |
| 457 | nationwide-fleet.com | GoDaddy.com, LLC | 14 Feb 2010 | 20 Feb 2024 | 14 Feb 2026 |
| 458 | nationwideofficefurniture.com | GoDaddy.com, LLC | 26 Mar 2012 | 27 Mar 2025 | 26 Mar 2027 |
| 459 | nationwidesurplus.com | GoDaddy.com, LLC | 16 Nov 2004 | 8 Sep 2022 | 16 Nov 2028 |
| 460 | nationwidewholesales.com | GoDaddy.com, LLC | 22 Jul 2012 | 22 Apr 2015 | 22 Jul 2016 |
| 461 | nationwideautorecycling.com | GoDaddy.com, LLC | 11 Oct 2004 | 11 Nov 2024 | 11 Oct 2033 |
| 462 | nationwidecoins.com | GoDaddy.com, LLC | 10 Dec 2008 | 11 Dec 2024 | 10 Dec 2026 |
| 463 | nationwidesmartridequote.com | DNC Holdings, Inc. | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 464 | nationwidetrends.com | NameCheap, Inc. | 22 Aug 2018 | 23 Jul 2025 | 22 Aug 2026 |
| 465 | nationwideautotrans.com | Eranet International Limited | 11 Sep 2023 | 23 Oct 2024 | 11 Sep 2024 |
| 466 | nationwideautosales.net | GoDaddy.com, LLC | 2 Jul 2008 | 16 Jul 2025 | 2 Jul 2026 |
| 467 | nationwideautofinders.com | GoDaddy.com, LLC | 24 Jun 2009 | 18 Feb 2023 | 24 Jun 2029 |
| 468 | nationwidelocalinsurance.com | DNC Holdings, Inc. | 12 Dec 2013 | 28 Nov 2017 | 12 Dec 2018 |
| 469 | nationwideautoshipping.com | GoDaddy.com, LLC | 10 Mar 2009 | 10 Mar 2025 | 10 Mar 2026 |
| 470 | nationwidecrab.com | GoDaddy.com, LLC | 8 Jun 2005 | 9 Jun 2025 | 8 Jun 2026 |
| 471 | nationwidelobster.com | GoDaddy.com, LLC | 8 Jun 2005 | 9 Jun 2025 | 8 Jun 2026 |
| 472 | nationwideseafood.com | GoDaddy.com, LLC | 8 Jun 2005 | 9 Jun 2025 | 8 Jun 2026 |
| 473 | nationwideshrimp.com | GoDaddy.com, LLC | 8 Jun 2005 | 9 Jun 2025 | 8 Jun 2026 |
| 474 | nationwidecarsales.net | GoDaddy.com, LLC | 16 Mar 2005 | 15 Aug 2025 | 14 Aug 2027 |
| 475 | nationwideimportparts.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Sep 2006 | 26 Oct 2024 | 19 Sep 2025 |
| 476 | nationwideclassifieds.net | NameCheap, Inc. | 21 Mar 2022 | 19 Feb 2025 | 21 Mar 2026 |
| 477 | nationwidetrailershop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Oct 2010 | 10 Oct 2024 | 9 Oct 2025 |
| 478 | nationwidebath.com | Tucows Domains Inc. | 30 Jan 2011 | 7 Mar 2025 | 30 Jan 2026 |
| 479 | nationwidenetworker.com | GoDaddy.com, LLC | 22 Dec 2011 | 28 Apr 2015 | 22 Dec 2015 |
| 480 | nationwide-kia.com | FastDomain Inc. | 20 May 2013 | 5 May 2025 | 20 May 2026 |
| 481 | nationwideav.com | GoDaddy.com, LLC | 29 Mar 1997 | 6 Oct 2024 | 5 Oct 2025 |
| 482 | nationwidemonument.com | Google, Inc. | 17 Sep 2013 | 2 Sep 2024 | 17 Sep 2025 |
| 483 | nationwidesavingsbank.com | GoDaddy.com, LLC | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2016 |
| 484 | nationwidepropertysolution.com | GoDaddy.com, LLC | 3 Jan 2022 | 4 Jan 2025 | 3 Jan 2026 |
| 485 | nationwidebankingsolutions.com | GoDaddy.com, LLC | 1 Nov 2014 | 2 Nov 2016 | 1 Nov 2018 |
| 486 | nationwideblast.com | DROPCATCH.COM 751 LLC | 10 Jul 2022 | 20 Sep 2023 | 10 Jul 2023 |
| 487 | nationwidebiweekly.com | DropCatch.com 938 LLC | 21 Dec 2024 | 22 Dec 2024 | 21 Dec 2025 |
| 488 | nationwidehostingservice.com | eNom, Inc. | 6 May 2003 | 4 Apr 2016 | 6 May 2018 |
| 489 | nationwidehousingcorporation.com | GoDaddy.com, LLC | 19 Jul 2011 | 27 Jul 2023 | 19 Jul 2026 |
| 490 | nationwideonyourside.com | CSC Corporate Domains, Inc. | 12 Oct 2001 | 30 Aug 2024 | 12 Oct 2025 |
| 491 | nationwideracing.com | GoDaddy.com, LLC | 21 Oct 2019 | 5 Nov 2024 | 21 Oct 2025 |
| 492 | nationwidewheelchairlift.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 May 2001 | 25 Apr 2017 | 22 May 2018 |
| 493 | nationwidefinancial.com | CSC Corporate Domains, Inc. | 16 Jan 1997 | 13 Jan 2025 | 17 Jan 2026 |
| 494 | nationwidewarranty.com | GoDaddy.com, LLC | 11 Dec 2006 | 13 Aug 2025 | 11 Dec 2025 |
| 495 | nationwidecoin.com | GoDaddy.com, LLC | 29 Sep 2016 | 29 Sep 2022 | 29 Sep 2026 |
| 496 | nationwideflooring.com | GoDaddy.com, LLC | 23 Sep 2014 | 2 Jul 2024 | 23 Sep 2025 |
| 497 | nationwideagribusiness.com | CSC Corporate Domains, Inc. | 12 Oct 2000 | 30 Aug 2024 | 12 Oct 2025 |
| 498 | nationwidecashstores.com | GoDaddy.com, LLC | 29 Sep 2010 | 24 Apr 2015 | 29 Sep 2015 |
| 499 | nationwidelaw.com | GoDaddy.com, LLC | 6 May 2003 | 21 Apr 2025 | 6 May 2026 |
| 500 | nationwidetonerdepot.com | Tucows Domains Inc. | 15 Feb 2005 | 19 Feb 2017 | 15 Feb 2017 |
| 501 | nationwide-healthcare.com | GoDaddy.com, LLC | 27 Aug 2023 | 31 Aug 2023 | 27 Aug 2025 |
| 502 | nationwidehomewarranty.com | GoDaddy.com, LLC | 8 Mar 2007 | 16 Feb 2025 | 8 Mar 2026 |
| 503 | nationwidemortgages.net | eNom, Inc. | 1 Oct 2002 | 28 May 2024 | 1 Oct 2026 |
| 504 | nationwidenanny.com | GoDaddy.com, LLC | 17 Mar 2003 | 18 Mar 2025 | 17 Mar 2026 |
| 505 | nationwide-realty.net | GoDaddy.com, LLC | 14 Oct 2022 | 14 Oct 2022 | 14 Oct 2027 |
| 506 | nationwidearea.com | NamesHere LLC | 16 Apr 2019 | 18 May 2024 | 16 Apr 2024 |
| 507 | nationwidechurchdirectory.com | eNom, Inc. | 10 Feb 2011 | 9 Feb 2025 | 10 Feb 2026 |
| 508 | nationwidemortgage.net | GoDaddy.com, LLC | 26 Apr 2003 | 4 Sep 2022 | 26 Apr 2027 |
| 509 | nationwide420.com | GoDaddy.com, LLC | 11 May 2010 | 12 May 2025 | 11 May 2026 |
| 510 | nationwide-trailer-parts.co.uk | - | 9 Jun 2009 | 8 Jun 2023 | 9 Jun 2030 |
| 511 | nationwideonline.com | Go Canada Domains, LLC | 14 Aug 2009 | 18 Aug 2025 | 14 Aug 2026 |
| 512 | nationwideindustrialsolutions.net | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 513 | nationwideindustrialservices.net | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 514 | nationwide-saturated.org | GMO Internet Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 515 | nationwideforeclosurehomes.com | GoDaddy.com, LLC | 8 Apr 2005 | 14 Apr 2015 | 8 Apr 2016 |
| 516 | nationwidecarbuyers.com | GoDaddy.com, LLC | 6 Oct 2012 | 7 Oct 2024 | 6 Oct 2025 |
| 517 | nationwide-mortgage-funding.com | GoDaddy.com, LLC | 21 Aug 2003 | 5 Jul 2013 | 21 Aug 2015 |
| 518 | nationwideappraisers.com | GoDaddy.com, LLC | 2 Feb 2006 | 27 Jan 2025 | 26 Jan 2026 |
| 519 | nationwidesavings.net | GoDaddy.com, LLC | 1 Nov 2014 | 2 Nov 2016 | 1 Nov 2018 |
| 520 | nationwidepropertysolutions.net | Google, Inc. | 24 May 2023 | 24 May 2023 | 24 May 2024 |
| 521 | nationwidehomesct.com | FastDomain Inc. | 10 Jun 2014 | 13 Jul 2015 | 10 Jun 2016 |
| 522 | nationwidedoors.com | GoDaddy.com, LLC | 25 Oct 2001 | 28 Feb 2025 | 25 Oct 2025 |
| 523 | nationwidepatents.com | Fabulous.com Pty Ltd. | 11 Jun 2010 | 20 Jul 2025 | 11 Jun 2026 |
| 524 | nationwide-legal.com | GoDaddy.com, LLC | 14 Feb 2014 | 25 Jan 2025 | 14 Feb 2026 |
| 525 | nationwidemed.com | eNom, Inc. | 30 Apr 2010 | 6 May 2025 | 30 Apr 2026 |
| 526 | nationwideautowatch.com | CSC Corporate Domains, Inc. | 28 Oct 2005 | 24 Oct 2024 | 28 Oct 2025 |
| 527 | nationwidewarrantsearch.com | TurnCommerce, Inc. DBA NameBright.com | 2 Jul 2011 | 3 Aug 2024 | 2 Jul 2024 |
| 528 | nationwidehospicecare.com | GoDaddy.com, LLC | 2 Nov 2014 | 14 Jan 2025 | 2 Nov 2024 |
| 529 | nationwidehealthservices.com | register.com, Inc. | 24 Oct 2008 | 15 Oct 2024 | 24 Oct 2025 |
| 530 | nationwideintercom.com | GoDaddy.com, LLC | 8 Jun 2012 | 8 Jun 2015 | 8 Jun 2016 |
| 531 | nationwiderenttobuyhomes.com | Wild West Domains, LLC | 9 Jun 2014 | 10 Jun 2015 | 9 Jun 2016 |
| 532 | nationwide-install.com | GoDaddy.com, LLC | 29 Mar 2014 | 30 Mar 2025 | 29 Mar 2026 |
| 533 | nationwideministry.com | eNom, Inc. | 26 Oct 2005 | 25 Oct 2024 | 26 Oct 2025 |
| 534 | nationwidenotaryregistry.com | GoDaddy.com, LLC | 5 May 2011 | 28 Apr 2024 | 5 May 2029 |
| 535 | nationwideincorporatingservices.info | GoDaddy.com, LLC | 8 Jun 2011 | 9 Jun 2015 | 8 Jun 2016 |
| 536 | nationwidewholesaledirect.com | Media Elite Holdings Limited | 16 Feb 2021 | 1 Sep 2023 | 16 Feb 2030 |
| 537 | nationwidecollection.net | Network Solutions, LLC | 7 Oct 2009 | 8 Aug 2025 | 7 Oct 2026 |
| 538 | nationwide-propertyservices.com | GoDaddy.com, LLC | 7 Jun 2011 | 12 Jun 2015 | 7 Jun 2016 |
| 539 | nationwideincorporatingservices.biz | GoDaddy.com, LLC | 8 Jun 2011 | 8 Jun 2015 | 7 Jun 2015 |
| 540 | nationwide-service.co.uk | - | 4 Jan 2013 | 31 Dec 2024 | 4 Jan 2026 |
| 541 | nationwideprotest.com | DropCatch.com 1489 LLC | 26 Feb 2024 | 8 Apr 2025 | 26 Feb 2025 |
| 542 | nationwideincorporatingservices.com | GoDaddy.com, LLC | 8 Jun 2011 | 9 Jun 2015 | 8 Jun 2016 |
| 543 | nationwidemedicalreview.com | Wild West Domains, LLC | 30 Aug 2005 | 23 Jun 2025 | 30 Aug 2025 |
| 544 | nationwide-insurance-quotes.com | GoDaddy.com, LLC | 7 Sep 2016 | 3 Aug 2025 | 7 Sep 2026 |
| 545 | nationwidekitchensupply.com | GoDaddy.com, LLC | 8 Jun 2013 | 9 Jun 2015 | 8 Jun 2016 |
| 546 | nationwideincorporatingservices.net | GoDaddy.com, LLC | 8 Jun 2011 | 9 Jun 2015 | 8 Jun 2016 |
| 547 | nationwideplastics.net | GoDaddy.com, LLC | 20 Apr 2004 | 20 Apr 2025 | 20 Apr 2026 |
| 548 | nationwidedrafting.com | Network Solutions, LLC | 26 Jun 2000 | 28 Apr 2025 | 26 Jun 2026 |
| 549 | nationwideaccountant.com | GoDaddy.com, LLC | 12 May 2014 | 13 May 2025 | 12 May 2026 |
| 550 | nationwidehomeschool.com | Wild West Domains, LLC | 3 Mar 2012 | 4 Mar 2025 | 3 Mar 2026 |
| 551 | nationwideautosearch.com | GoDaddy.com, LLC | 27 Sep 2020 | 27 Sep 2020 | 27 Sep 2021 |
| 552 | nationwideorders.com | Google, Inc. | 2 May 2013 | 18 Apr 2025 | 2 May 2026 |
| 553 | nationwidedebtresolution.com | GoDaddy.com, LLC | 11 Apr 2023 | 12 Apr 2025 | 11 Apr 2027 |
| 554 | nationwidegetaway.com | - | 25 Feb 2009 | 10 May 2025 | 25 Feb 2025 |
| 555 | nationwiderecyclingstl.com | GoDaddy.com, LLC | 16 Feb 2012 | 30 Apr 2023 | 16 Feb 2023 |
| 556 | nationwidelicensing.com | GoDaddy.com, LLC | 22 Dec 1999 | 3 Sep 2022 | 22 Dec 2025 |
| 557 | nationwidepools.com | GoDaddy.com, LLC | 21 Mar 2000 | 21 Aug 2025 | 20 Aug 2026 |
| 558 | nationwidemedicaldirect.com | GoDaddy.com, LLC | 20 Jul 2012 | 14 Sep 2022 | 20 Jul 2027 |
| 559 | nationwidedisabilitylawyers.com | GoDaddy.com, LLC | 16 Dec 2024 | 16 Dec 2024 | 16 Dec 2025 |
| 560 | nationwideprescriptionconnection.com | eNom, Inc. | 21 Nov 2013 | 20 Nov 2024 | 21 Nov 2025 |
| 561 | nationwidevillas.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 562 | nationwidevilla.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 563 | nationwidestudentalliance.com | eNom, Inc. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 564 | nationwidervloans.com | NameCheap, Inc. | 1 Sep 2021 | - | 1 Sep 2022 |
| 565 | nationwidervloan.com | GoDaddy.com, LLC | 7 Dec 2022 | 7 Dec 2022 | 7 Dec 2023 |
| 566 | nationwidepavingandsealcoating.com | FastDomain Inc. | 31 Jan 2017 | 31 Jan 2017 | 31 Jan 2018 |
| 567 | nationwide-entertainmentguide.com | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2016 | 4 Nov 2017 |
| 568 | nationwidelocalquote.com | DNC Holdings, Inc. | 12 Dec 2013 | 18 May 2015 | 12 Dec 2015 |
| 569 | nationwidehomes.org | GoDaddy.com, LLC | 21 Dec 2013 | 4 Feb 2025 | 21 Dec 2025 |
| 570 | nationwideguitars.com | Network Solutions, LLC | 17 Sep 2004 | 19 Jul 2025 | 17 Sep 2027 |
| 571 | nationwidepersonals.ca | - | 16 Oct 2008 | 30 Nov 2024 | 16 Oct 2025 |
| 572 | nationwidetravelers.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jun 2022 | 22 Jul 2025 | 11 Jun 2026 |
| 573 | nationwidelocalagents.com | DNC Holdings, Inc. | 12 Dec 2013 | 18 May 2015 | 12 Dec 2015 |
| 574 | nationwideboiler.com | Network Solutions, LLC | 17 Apr 1996 | 18 Feb 2024 | 18 Apr 2029 |
| 575 | nationwidemortgageresolution.com | Dynadot, LLC | 2 Oct 2015 | 3 Oct 2015 | 2 Oct 2016 |
| 576 | nationwideradiojm.com | Tucows Domains Inc. | 30 Apr 2007 | 15 Apr 2025 | 30 Apr 2026 |
| 577 | nationwidespecialtyinsurance.com | CSC Corporate Domains, Inc. | 27 Oct 2011 | 23 Oct 2024 | 27 Oct 2025 |
| 578 | nationwidehubcaps.net | Tucows Domains Inc. | 10 Aug 2005 | 12 Jul 2025 | 10 Aug 2026 |
| 579 | nationwideenergypartners.com | Amazon Registrar, Inc. | 10 May 2002 | 15 Aug 2025 | 10 May 2026 |
| 580 | nationwidevinyl.com | GoDaddy.com, LLC | 2 Dec 2010 | 20 Jan 2025 | 2 Dec 2025 |
| 581 | nationwide-battery.com | GoDaddy.com, LLC | 30 Jul 2007 | 31 Jul 2024 | 30 Jul 2026 |
| 582 | nationwidecranetraining.com | Tucows Domains Inc. | 30 Apr 2008 | 1 Apr 2025 | 30 Apr 2026 |
| 583 | nationwidepeople.org | Tucows Domains Inc. | 1 Dec 2004 | 5 Dec 2022 | 1 Dec 2023 |
| 584 | nationwidepeople.info | Tucows Domains Inc. | 30 Nov 2004 | 4 Dec 2022 | 30 Nov 2023 |
| 585 | nationwide-appraisal.com | GoDaddy.com, LLC | 30 Sep 2009 | 1 Oct 2024 | 30 Sep 2029 |
| 586 | nationwidedisc.com | Google, Inc. | 10 Jun 2004 | 2 Jun 2025 | 10 Jun 2026 |
| 587 | nationwidebestbuys.com | FastDomain Inc. | 15 Jan 2014 | 9 Jan 2015 | 15 Jan 2016 |
| 588 | nationwidecashservices.com | GoDaddy.com, LLC | 20 Sep 2010 | 24 Apr 2015 | 20 Sep 2015 |
| 589 | nationwidemobility.net | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 31 Mar 2017 | 12 Jun 2025 | 31 Mar 2025 |
| 590 | nationwidedliveries.com | 1&1 Internet AG | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 591 | nationwidedegrees.com | GoDaddy.com, LLC | 2 Nov 2020 | 2 Nov 2024 | 2 Nov 2025 |
| 592 | nationwidecarandcommercial.com | Tucows Domains Inc. | 4 Nov 2014 | 8 Nov 2015 | 4 Nov 2016 |
| 593 | nationwideauto.com | Network Solutions, LLC | 30 Oct 1996 | 26 Sep 2023 | 29 Oct 2027 |
| 594 | nationwideusedautoparts.com | GoDaddy.com, LLC | 10 Nov 2008 | 6 Nov 2024 | 10 Nov 2033 |
| 595 | nationwidedebtdirect.com | CSC Corporate Domains, Inc. | 30 Mar 2011 | 26 Mar 2025 | 30 Mar 2026 |
| 596 | nationwidebingo.com | GoDaddy.com, LLC | 29 Nov 2004 | 10 Aug 2025 | 9 Aug 2026 |
| 597 | nationwideautoexchange.com | GoDaddy.com, LLC | 28 Nov 2019 | 29 Nov 2024 | 28 Nov 2025 |
| 598 | nationwideautomobilebuyer.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 599 | nationwideautomobilebuyers.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 600 | nationwidepremierdisability.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2025 | 18 Aug 2026 |
| 601 | nationwidetattoos.com | Tucows Domains Inc. | 17 Aug 2014 | 21 Aug 2018 | 17 Aug 2018 |
| 602 | nationwideautocarriers.org | GoDaddy.com, LLC | 13 Jun 2012 | 25 Jun 2015 | 13 Jun 2016 |
| 603 | nationwidecashexpress.com | GoDaddy.com, LLC | 15 Jun 2012 | 16 Jun 2015 | 15 Jun 2016 |
| 604 | nationwidefirstresponders.com | GoDaddy.com, LLC | 15 Jun 2013 | 27 Jun 2015 | 15 Jun 2016 |
| 605 | nationwidewearables.com | eNom, Inc. | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 606 | nationwideunsecuredloans.com | GMO Internet Inc. | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 607 | nationwidepaincenter.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2016 |
| 608 | nationwidecleanersinternational.com | Webfusion Ltd. | 5 Nov 2014 | 19 Nov 2024 | 5 Nov 2026 |
| 609 | nationwide-mobility.com | Webfusion Ltd. | 5 Nov 2014 | 29 Oct 2023 | 5 Nov 2025 |
| 610 | nationwide-cleaners-international.com | Webfusion Ltd. | 5 Nov 2014 | 19 Nov 2024 | 5 Nov 2026 |
| 611 | nationwideautonetwork.com | GoDaddy.com, LLC | 10 Mar 2017 | 10 Mar 2017 | 10 Mar 2018 |
| 612 | nationwidewelcomecenter.com | GoDaddy.com, LLC | 16 Jun 2012 | 17 Jun 2015 | 16 Jun 2016 |
| 613 | nationwide-exchange.com | Wild West Domains, LLC | 21 Mar 2024 | 21 Mar 2024 | 21 Mar 2029 |
| 614 | nationwideg.com | NameCheap, Inc. | 29 Oct 2024 | 29 Oct 2024 | 29 Oct 2025 |
| 615 | nationwidejobrecruitment.com | GoDaddy.com, LLC | 17 Jun 2014 | 18 Jun 2015 | 17 Jun 2016 |
| 616 | nationwidesupplementinsurance.com | GoDaddy.com, LLC | 17 Jun 2013 | 18 Jun 2015 | 17 Jun 2016 |
| 617 | nationwidepings.com | GoDaddy.com, LLC | 29 Jun 2013 | 19 Jun 2015 | 18 Jun 2016 |
| 618 | nationwidecommercialdebtcollector.com | GoDaddy.com, LLC | 19 Jun 2011 | 19 Jun 2015 | 19 Jun 2016 |
| 619 | nationwidevape.com | eNom, Inc. | 18 Apr 2025 | 18 Apr 2025 | 18 Apr 2026 |
| 620 | nationwidecareercenter.com | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 621 | nationwideexecutivecoach.com | GoDaddy.com, LLC | 19 Jun 2009 | 20 Jun 2015 | 19 Jun 2016 |
| 622 | nationwidecarhire.com | GoDaddy.com, LLC | 29 Mar 2006 | 13 May 2025 | 29 Mar 2026 |
| 623 | nationwide-permit.com | GoDaddy.com, LLC | 19 Aug 2014 | 6 Jul 2016 | 19 Aug 2017 |
| 624 | nationwideabstrax.com | 1&1 Internet AG | 19 Aug 2014 | 18 Mar 2025 | 19 Aug 2026 |
| 625 | nationwideabstrax.net | 1&1 Internet AG | 19 Aug 2014 | 6 Dec 2017 | 19 Aug 2018 |
| 626 | nationwidecellservice.com | GoDaddy.com, LLC | 19 Aug 2014 | 20 Aug 2016 | 19 Aug 2017 |
| 627 | nationwideloansnow.com | Wild West Domains, LLC | 2 Mar 2022 | 13 Apr 2025 | 2 Mar 2025 |
| 628 | nationwideoverspraysolutions.com | Google, Inc. | 17 Jul 2018 | 2 Jul 2025 | 17 Jul 2026 |
| 629 | nationwidepartners.org | GoDaddy.com, LLC | 4 Nov 2014 | 19 Dec 2024 | 4 Nov 2025 |
| 630 | nationwidepartner.org | GoDaddy.com, LLC | 4 Nov 2014 | 8 Oct 2017 | 4 Nov 2019 |
| 631 | nationwiderent.com | GoDaddy.com, LLC | 24 Jun 2015 | 25 Jun 2025 | 24 Jun 2026 |
| 632 | nationwideweddingphotography.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 633 | nationwideth.com | GoDaddy.com, LLC | 6 Nov 2014 | 1 Oct 2023 | 6 Nov 2028 |
| 634 | nationwidesportsradio.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 635 | nationwidephonelookup.com | Dynadot9 LLC | 23 Jan 2016 | 25 Nov 2017 | 23 Jan 2019 |
| 636 | nationwidebottle.com | GoDaddy.com, LLC | 6 Nov 2014 | 7 Nov 2024 | 6 Nov 2026 |
| 637 | nationwidecontracts.com | TurnCommerce, Inc. DBA NameBright.com | 9 Feb 2019 | 3 Feb 2021 | 9 Feb 2026 |
| 638 | nationwidediamondgroup.com | TurnCommerce, Inc. DBA NameBright.com | 20 Aug 2014 | 1 Oct 2024 | 20 Aug 2024 |
| 639 | nationwidehamboneaward.com | Moniker Online Services LLC | 20 Aug 2014 | 20 Aug 2025 | 20 Aug 2026 |
| 640 | nationwideloansnow.info | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2016 |
| 641 | nationwidemuffler.com | - | 13 Apr 2021 | 27 May 2025 | 13 Apr 2025 |
| 642 | nationwidepropertyanalytics.com | GoDaddy.com, LLC | 20 Aug 2014 | 19 Aug 2016 | 20 Aug 2017 |
| 643 | nationwidepropertyvaluations.com | Register.it SPA | 20 Sep 2022 | 22 Nov 2023 | 20 Sep 2023 |
| 644 | nationwide-loans.com | eNom, Inc. | 28 Jun 2025 | 28 Jun 2025 | 28 Jun 2026 |
| 645 | nationwide-mortgages.com | Webfusion Ltd. | 12 Dec 2019 | 12 Dec 2019 | 12 Dec 2020 |
| 646 | nationwideequipmentsalesandrentals.com | 1&1 Internet AG | 12 Jan 2015 | 11 Jun 2017 | 12 Jan 2018 |
| 647 | nationwideairsolutions.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2017 |
| 648 | nationwideatmservices.com | GoDaddy.com, LLC | 21 Aug 2014 | 2 Oct 2024 | 21 Aug 2024 |
| 649 | nationwidecontainers-tn.com | eNom, Inc. | 21 Aug 2014 | 23 Jul 2016 | 21 Aug 2017 |
| 650 | nationwidecontainerstn.com | eNom, Inc. | 21 Aug 2014 | 23 Jul 2016 | 21 Aug 2017 |
| 651 | nationwideacademy.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2025 | 7 Feb 2026 |
| 652 | nationwideannuities.net | GKG.NET, INC. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 653 | nationwidearenaschedule.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 654 | nationwidedecorinstallation.com | GoDaddy.com, LLC | 6 Feb 2015 | 3 Feb 2025 | 6 Feb 2026 |
| 655 | nationwidefixtureinstallations.com | GoDaddy.com, LLC | 6 Feb 2015 | 3 Feb 2025 | 6 Feb 2026 |
| 656 | nationwidemillworkinstallation.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2017 |
| 657 | nationwidemillworkinstallations.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 658 | nationwidepartyrental.com | GoDaddy.com, LLC | 6 Feb 2015 | 12 Jun 2024 | 6 Feb 2029 |
| 659 | nationwideretaildecorinstallation.com | GoDaddy.com, LLC | 6 Feb 2015 | 3 Feb 2025 | 6 Feb 2026 |
| 660 | nationwideretailfixtureinstallation.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2017 |
| 661 | nationwideretailinstallation.com | GoDaddy.com, LLC | 6 Feb 2015 | 3 Feb 2025 | 6 Feb 2026 |
| 662 | nationwiderolloutinstallation.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2017 |
| 663 | nationwidesignage.com | GoDaddy.com, LLC | 6 Aug 2025 | 6 Aug 2025 | 6 Aug 2027 |
| 664 | nationwidewallpaperinstallation.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2017 |
| 665 | nationwidefleamarket.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 666 | nationwideheirs.com | GoDaddy.com, LLC | 28 Feb 2015 | 18 Sep 2022 | 28 Feb 2029 |
| 667 | nationwideheirs.net | GoDaddy.com, LLC | 28 Feb 2015 | 19 Nov 2024 | 28 Feb 2025 |
| 668 | nationwideheirs.org | GoDaddy.com, LLC | 28 Feb 2015 | 2 Feb 2025 | 28 Feb 2025 |
| 669 | nationwiderxconnection.com | Tucows Domains Inc. | 25 Feb 2014 | 1 Mar 2017 | 25 Feb 2017 |
| 670 | nationwiderxconnection.net | Tucows Domains Inc. | 25 Feb 2014 | 1 Mar 2017 | 25 Feb 2017 |
| 671 | nationwideprivatemoneygroup.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 672 | nationwideprivatemoneyexchange.com | GoDaddy.com, LLC | 7 Nov 2014 | 8 Nov 2016 | 7 Nov 2018 |
| 673 | nationwideprivatelendinggroup.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 674 | nationwideprivatelending.com | GoDaddy.com, LLC | 24 Mar 2020 | 25 Mar 2024 | 24 Mar 2026 |
| 675 | nationwideprivatebanking.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 676 | nationwideprivatebankers.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 677 | nationwideprivatebanker.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 678 | nationwidebankplc.com | BlastDomains LLC | 21 Jan 2015 | 22 Jan 2017 | 21 Jan 2018 |
| 679 | nationwideautobuyers.com | FastDomain Inc. | 5 Dec 2008 | 20 Nov 2024 | 5 Dec 2025 |
| 680 | nationwidecoinandbullionreserve.com | Above.com Pty Ltd. | 22 Aug 2014 | 10 Jul 2017 | 22 Aug 2018 |
| 681 | nationwideeventservices.com | GoDaddy.com, LLC | 30 Oct 2024 | 30 Oct 2024 | 30 Oct 2025 |
| 682 | nationwidefundingnow.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 683 | nationwideswhoswho.com | 1API GmbH | 11 Nov 2016 | 27 Mar 2017 | 11 Nov 2017 |
| 684 | nationwidetrainers.com | 1&1 Internet AG | 22 Aug 2014 | 16 Mar 2018 | 22 Aug 2026 |
| 685 | nationwiderent.net | GoDaddy.com, LLC | 24 Jun 2015 | 25 Jun 2025 | 24 Jun 2026 |
| 686 | nationwideautoinsurance.mobi | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 687 | nationwideautoinsurance.us | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 22 Aug 2015 |
| 688 | nationwideautoinsurancerates.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 689 | nationwideautomobileinsurance.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 690 | nationwideclaimsinc.com | Wild West Domains, LLC | 4 Jul 2021 | 4 Jul 2021 | 4 Jul 2022 |
| 691 | nationwidehomeinsurance.us | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 22 Aug 2015 |
| 692 | nationwidehomeinsurancequotes.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 693 | nationwidehomeinsurancerates.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 694 | nationwideinsuranceagents.us | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 22 Aug 2015 |
| 695 | nationwideinsuranceauto.com | GoDaddy.com, LLC | 17 Aug 2020 | 17 Aug 2020 | 17 Aug 2021 |
| 696 | nationwideinsurancecompany.mobi | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 697 | nationwideinsurancecompany.us | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 22 Aug 2015 |
| 698 | nationwideinsurancecomplaints.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 699 | nationwideinsurancediscounts.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 700 | nationwideloanapp.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 701 | nationwidemoneyservices.com | DropCatch.com 391 LLC | 23 Aug 2014 | 24 Aug 2017 | 23 Aug 2018 |
| 702 | nationwideplastering.com | Azdomainz LLC | 21 Nov 2017 | 21 Nov 2017 | 21 Nov 2018 |
| 703 | nationwiderentersinsurance.com | DNSPod, Inc. | 17 Sep 2020 | 17 Sep 2020 | 17 Sep 2021 |
| 704 | nationwideconnections.net | Google, Inc. | 9 Jul 2024 | 24 Jun 2025 | 9 Jul 2026 |
| 705 | nationwideconstructioninc.com | Tucows Domains Inc. | 8 Nov 2014 | 11 Oct 2024 | 8 Nov 2025 |
| 706 | nationwide-offshores.com | Gandi SAS | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 707 | nationwideattorneymarkets.com | Tucows Domains Inc. | 13 Aug 2014 | 15 Jul 2017 | 13 Aug 2018 |
| 708 | nationwideva.com | GoDaddy.com, LLC | 12 Aug 2014 | 13 Aug 2025 | 12 Aug 2026 |
| 709 | nationwidebarristersdirect.com | Easyspace LTD | 24 Aug 2014 | 26 Jul 2016 | 24 Aug 2017 |
| 710 | nationwidebdg.com | 1&1 Internet AG | 13 Aug 2014 | 29 Apr 2020 | 13 Aug 2026 |
| 711 | nationwidecreditsolutions.net | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2016 |
| 712 | nationwidedeliveres.com | register.com, Inc. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 713 | nationwidesportseducation.info | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 714 | nationwidesportseducation.net | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 715 | nationwidesportseducation.org | GoDaddy.com, LLC | 13 Aug 2014 | 27 Sep 2024 | 13 Aug 2026 |
| 716 | nationwidebarristersaccess.com | Easyspace LTD | 25 Aug 2014 | 25 Jul 2017 | 25 Aug 2018 |
| 717 | nationwidebusinessandtax.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2016 |
| 718 | nationwidebusinessandtaxservice.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2016 |
| 719 | nationwidedigital.info | Network Solutions, LLC | 25 Aug 2014 | 3 Jun 2025 | 25 Aug 2029 |
| 720 | nationwidedigital.net | Network Solutions, LLC | 25 Aug 2014 | 26 Jun 2024 | 25 Aug 2029 |
| 721 | nationwidedigital.org | Network Solutions, LLC | 25 Aug 2014 | 2 Aug 2024 | 25 Aug 2029 |
| 722 | nationwidehealthcaresolutions.net | GoDaddy.com, LLC | 25 Aug 2014 | 26 Aug 2016 | 25 Aug 2018 |
| 723 | nationwidenunley.com | NameCheap, Inc. | 1 Mar 2022 | - | 1 Mar 2023 |
| 724 | nationwidereplacement.com | Webfusion Ltd. | 26 Aug 2014 | 19 Aug 2016 | 26 Aug 2018 |
| 725 | nationwidebusinessesforsale.com | GoDaddy.com, LLC | 9 Nov 2014 | 28 Oct 2016 | 9 Nov 2017 |
| 726 | nationwidecommerciallending.com | NameCheap, Inc. | 25 Aug 2025 | 25 Aug 2025 | 25 Aug 2026 |
| 727 | nationwidecommerciallending.net | Launchpad, Inc. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 728 | nationwidecommerciallending.org | Launchpad, Inc. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 729 | nationwidemedicareplans.com | GoDaddy.com, LLC | 26 Nov 2018 | 26 Nov 2024 | 26 Nov 2025 |
| 730 | nationwidewealthlocators.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 731 | nationwideautocarrier.com | Cosmotown, Inc. | 22 Aug 2025 | 22 Aug 2025 | 22 Aug 2026 |
| 732 | nationwidecityguides.com | Domain.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 733 | nationwidedivorcealternatives.com | register.com, Inc. | 27 Aug 2014 | 29 Nov 2016 | 27 Aug 2017 |
| 734 | nationwidevetchannel.com | Moniker Online Services LLC | 27 Aug 2014 | 27 Aug 2025 | 27 Aug 2026 |
| 735 | nationwidemarijuanaloans.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2016 | 11 Nov 2017 |
| 736 | nationwideinsuranceharlan.com | register.com, Inc. | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 737 | nationwideinterventionprocessingservices.org | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 738 | nationwidelegalservicesgroup.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 739 | nationwideautogroup.net | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 740 | nationwidehypnosis.com | Domaininfo AB, aka domaininfo.com | 9 Apr 2018 | 2 Apr 2025 | 9 Apr 2026 |
| 741 | nationwidetaxhelp.net | GoDaddy.com, LLC | 4 Dec 2018 | 4 Dec 2018 | 4 Dec 2019 |
| 742 | nationwidetaxhelp.org | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 743 | nationwidewealthadvisor.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2018 |
| 744 | nationwidewealthadvisors.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2018 |
| 745 | nationwidewealthbuilder.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2018 |
| 746 | nationwidewealthbuilders.com | GoDaddy.com, LLC | 16 Jan 2024 | 17 Jan 2025 | 16 Jan 2026 |
| 747 | nationwidesnap.com | GoDaddy.com, LLC | 16 Aug 2014 | 13 Aug 2015 | 16 Aug 2017 |
| 748 | nationwidemarijuanaloans.net | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2016 | 11 Nov 2017 |
| 749 | nationwidemarijuanaloans.info | GoDaddy.com, LLC | 11 Nov 2014 | 12 Nov 2016 | 11 Nov 2017 |
| 750 | nationwidecreditrepairs.info | GoDaddy.com, LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 751 | nationwideventuregroup.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2016 |
| 752 | nationwidesignsupply.com | Tucows Domains Inc. | 8 Nov 2006 | 12 Nov 2014 | 8 Nov 2015 |
| 753 | nationwidejointventurenetwork.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2016 |
| 754 | nationwidejointventuregroup.com | GoDaddy.com, LLC | 11 Nov 2014 | 12 Nov 2016 | 11 Nov 2018 |
| 755 | nationwidejointventureexchange.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2016 |
| 756 | nationwideaccountingusa.com | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 757 | nationwidemove.us | GoDaddy.com, LLC | 10 Nov 2014 | 10 Nov 2016 | 9 Nov 2017 |
| 758 | nationwideemployment.info | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 759 | nationwidestudentsalliance.com | eNom, Inc. | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 760 | nationwideresidualincome.com | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 761 | nationwidecavityclaim.com | Register.it SPA | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 762 | nationwidebgrp.com | OnlineNIC, Inc. | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 763 | nationwide-ronthapa.com | Tucows Domains Inc. | 8 Sep 2012 | 12 Sep 2014 | 8 Sep 2015 |
| 764 | nationwide-sophisticated.org | GMO Internet Inc. | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 765 | nationwidefoamadhesive.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 766 | nationwidegraniteandmarble.com | Key-Systems GmbH | 9 Sep 2013 | 14 Oct 2017 | 9 Sep 2018 |
| 767 | nationwideinterpretations.com | DropCatch.com 526 LLC | 29 Nov 2019 | 30 Nov 2019 | 29 Nov 2020 |
| 768 | nationwidelaunch.com | GoDaddy.com, LLC | 27 May 2019 | 27 May 2019 | 27 May 2020 |
| 769 | nationwidetranslations.com | GoDaddy.com, LLC | 6 Aug 2020 | 9 Apr 2023 | 6 Aug 2023 |
| 770 | nationwidechauffer.com | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 771 | nationwidedisc.org | GoDaddy.com, LLC | 28 Aug 2014 | 29 Aug 2017 | 28 Aug 2018 |
| 772 | nationwidediscountcard.com | GoDaddy.com, LLC | 27 Nov 2021 | 28 Nov 2021 | 27 Nov 2022 |
| 773 | nationwidegunpermits.com | GoDaddy.com, LLC | 27 Sep 2020 | 27 Sep 2024 | 27 Sep 2025 |
| 774 | nationwidemobileapps.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2016 |
| 775 | nationwidewealthmanagement.net | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2018 |
| 776 | nationwide-propertysolutions.com | Tucows Domains Inc. | 8 Sep 2013 | 13 Sep 2014 | 8 Sep 2015 |
| 777 | nationwidebidsale.com | GoDaddy.com, LLC | 12 Sep 2014 | 15 Aug 2016 | 12 Sep 2017 |
| 778 | nationwideclassaction.com | Tucows Domains Inc. | 8 Sep 2013 | 13 Sep 2014 | 8 Sep 2015 |
| 779 | nationwideforvets.com | Network Solutions, LLC | 12 Sep 2014 | 5 Mar 2017 | 12 Sep 2017 |
| 780 | nationwidepawsprogram.com | Network Solutions, LLC | 12 Sep 2014 | 5 Mar 2017 | 12 Sep 2017 |
| 781 | nationwiderentdirect.com | Wild West Domains, LLC | 12 Sep 2014 | 13 Sep 2024 | 12 Sep 2034 |
| 782 | nationwidecoinandbullionreserve.org | Wild West Domains, LLC | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 783 | nationwidebranding.com | Name.com, Inc. | 31 Mar 2020 | 14 May 2025 | 31 Mar 2026 |
| 784 | nationwidepropertyvalues.com | GoDaddy.com, LLC | 19 Nov 2020 | 19 Nov 2020 | 19 Nov 2021 |
| 785 | nationwidesignservice.biz | Tucows Domains Inc. | 27 Aug 2012 | 30 Aug 2014 | 26 Aug 2014 |
| 786 | nationwideoutdoor.com | GoDaddy.com, LLC | 12 Sep 2007 | 17 Jun 2025 | 12 Sep 2025 |
| 787 | nationwidebusinessdevelopmentgroup.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 788 | nationwidefundingnow.info | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 789 | nationwideroof.com | eNom, Inc. | 2 Aug 1999 | 19 Aug 2025 | 2 Aug 2026 |
| 790 | nationwidemachining.com | Tucows Domains Inc. | 11 Nov 2013 | 15 Nov 2014 | 11 Nov 2015 |
| 791 | nationwideprivateclient.info | CSC Corporate Domains, Inc. | 15 Sep 2014 | 11 Sep 2024 | 15 Sep 2025 |
| 792 | nationwidealarms.com | Namesilo, LLC | 14 Sep 2014 | 15 Sep 2024 | 14 Sep 2025 |
| 793 | nationwidefundingtoday.com | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 794 | nationwidefundingtoday.info | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 795 | nationwidenewsmedia.com | GoDaddy.com, LLC | 14 Sep 2014 | 15 Sep 2014 | 14 Sep 2016 |
| 796 | nationwidetransporttraining.com | Tucows Domains Inc. | 11 Sep 2007 | 27 Aug 2024 | 11 Sep 2025 |
| 797 | nationwidetraveling.com | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 798 | nationwideprivateclient.net | CSC Corporate Domains, Inc. | 15 Sep 2014 | 11 Sep 2024 | 15 Sep 2025 |
| 799 | nationwideprivateclient.org | CSC Corporate Domains, Inc. | 15 Sep 2014 | 16 Sep 2024 | 15 Sep 2025 |
| 800 | nationwideprivateclient.us | CSC Corporate Domains, Inc. | 15 Sep 2014 | 10 Sep 2024 | 14 Sep 2025 |
| 801 | nationwide-mutual.com | GoDaddy.com, LLC | 1 Sep 2014 | 2 Sep 2016 | 1 Sep 2017 |
| 802 | nationwide-rates.com | GoDaddy.com, LLC | 1 Sep 2014 | 2 Sep 2016 | 1 Sep 2017 |
| 803 | nationwideantiqueautoappraisals.com | eNom, Inc. | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 804 | nationwidecollectibleautoappraisals.com | eNom, Inc. | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 805 | nationwidehtc.com | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 806 | nationwideloanrecovery.com | Tucows Domains Inc. | 29 Aug 2013 | 2 Sep 2014 | 29 Aug 2015 |
| 807 | nationwideservicedogs.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 808 | nationwideperformance.com | GoDaddy.com, LLC | 20 Jul 2015 | 4 Aug 2025 | 20 Jul 2026 |
| 809 | nationwidepremiumautowholesale.com | GoDaddy.com, LLC | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 810 | nationwidetransferllc.net | Wild West Domains, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 811 | nationwideemployment.net | DomainPeople, Inc. | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 812 | nationwideautowarrantyquote.com | 1&1 Internet AG | 15 Sep 2014 | 16 Jul 2025 | 15 Sep 2025 |
| 813 | nationwidecirclethanks.com | Network Solutions, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 814 | nationwideprivateclient.biz | CSC Corporate Domains, Inc. | 15 Sep 2014 | 15 Sep 2024 | 14 Sep 2025 |
| 815 | nationwideprivateclient.com | CSC Corporate Domains, Inc. | 15 Sep 2014 | 19 Aug 2024 | 15 Sep 2025 |
| 816 | nationwidevitamin.com | Google, Inc. | 10 Feb 2020 | 26 Jan 2025 | 10 Feb 2026 |
| 817 | nationwiderealestatereferrals.com | GoDaddy.com, LLC | 15 Oct 2021 | 27 Dec 2024 | 15 Oct 2024 |
| 818 | nationwideaudit.com | TurnCommerce, Inc. DBA NameBright.com | 15 Nov 2014 | 9 Nov 2020 | 15 Nov 2025 |
| 819 | nationwidecommercialcapital.com | Google, Inc. | 5 Apr 2023 | 21 Mar 2025 | 5 Apr 2026 |
| 820 | nationwide-ins.com | Tucows Domains Inc. | 30 Jan 2020 | 12 Mar 2021 | 30 Jan 2021 |
| 821 | nationwidecreditresult.com | GoDaddy.com, LLC | 4 Sep 2014 | 5 Jan 2016 | 4 Sep 2019 |
| 822 | nationwidemoversguide.com | Dynadot, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 823 | nationwide1031exchange.com | NameCheap, Inc. | 15 Feb 2024 | 24 Jan 2025 | 15 Feb 2026 |
| 824 | nationwidediscmastering.com | GoDaddy.com, LLC | 17 Sep 2014 | 10 Sep 2016 | 17 Sep 2017 |
| 825 | nationwidekraftaffiliate.com | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 826 | nationwideequip.com | eNom, Inc. | 21 Jul 2016 | 19 Jun 2017 | 21 Jul 2018 |
| 827 | nationwidemarketingpartners.com | Network Solutions, LLC | 13 Aug 2023 | 25 Sep 2024 | 13 Aug 2024 |
| 828 | nationwideautosusa.com | Wild West Domains, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 829 | nationwidecbd.com | DropCatch.com 605 LLC | 23 Jun 2023 | 13 Feb 2025 | 23 Jun 2026 |
| 830 | nationwidemastering.com | GoDaddy.com, LLC | 17 Sep 2014 | 10 Sep 2016 | 17 Sep 2017 |
| 831 | nationwiderealtyandfinancing.com | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2016 | 17 Sep 2017 |
| 832 | nationwidetranny.net | GoDaddy.com, LLC | 17 Sep 2014 | 19 Jun 2017 | 23 Oct 2020 |
| 833 | nationwide88.com | GoDaddy.com, LLC | 7 Dec 2021 | 7 Dec 2021 | 7 Dec 2022 |
| 834 | nationwidegreatplacetowork.com | Nobel Networks | 5 Aug 2011 | 4 Sep 2014 | 5 Aug 2015 |
| 835 | nationwidetaxresolution.com | GoDaddy.com, LLC | 28 Oct 2021 | 13 Nov 2024 | 28 Oct 2026 |
| 836 | nationwidefence.net | register.com, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 837 | nationwideindustrialrealestate.com | eNom, Inc. | 18 Sep 2014 | 5 Sep 2024 | 15 Sep 2025 |
| 838 | nationwidestudentservices.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2016 |
| 839 | nationwideestate.net | Moniker Online Services LLC | 18 Sep 2014 | 19 Sep 2017 | 18 Sep 2018 |
| 840 | nationwidemovinggroup.com | GoDaddy.com, LLC | 18 Sep 2014 | 19 Sep 2024 | 18 Sep 2025 |
| 841 | nationwidewatercare.com | Tucows Domains Inc. | 15 Sep 2013 | 18 Sep 2014 | 15 Sep 2015 |
| 842 | nationwidemanagementgroup.com | GoDaddy.com, LLC | 18 Sep 2014 | 19 Sep 2024 | 18 Sep 2025 |
| 843 | nationwide-cleaning.com | GoDaddy.com, LLC | 21 Jun 2020 | 2 Aug 2023 | 21 Jun 2023 |
| 844 | nationwideplastic.com | TurnCommerce, Inc. DBA NameBright.com | 18 Sep 2014 | 19 Oct 2024 | 18 Sep 2025 |
| 845 | nationwidegroupinternational.com | GoDaddy.com, LLC | 5 Sep 2014 | 6 Sep 2016 | 5 Sep 2017 |
| 846 | nationwidemultifamilysolutions.com | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 847 | nationwidefd.com | FastDomain Inc. | 19 Sep 2014 | 15 May 2023 | 19 Sep 2029 |
| 848 | nationwidefix-itguys.com | GoDaddy.com, LLC | 19 Sep 2014 | 20 Sep 2016 | 19 Sep 2018 |
| 849 | nationwideonsiterentals.com | GoDaddy.com, LLC | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2016 |
| 850 | nationwidesiterentals.com | GoDaddy.com, LLC | 19 Sep 2014 | 18 Aug 2016 | 19 Sep 2018 |
| 851 | nationwideaccountancy.com | Acens Technologies, S.L.U. | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 852 | nationwidewebdesigns.com | Wild West Domains, LLC | 11 Nov 2017 | 11 Nov 2017 | 11 Nov 2018 |
| 853 | nationwidecollege.com | GoDaddy.com, LLC | 11 Mar 2016 | 11 Mar 2016 | 11 Mar 2017 |
| 854 | nationwidemonitoring.com | Annulet LLC | 6 Dec 2016 | 23 Jan 2025 | 6 Dec 2025 |
| 855 | nationwidefix-itguys.net | GoDaddy.com, LLC | 19 Sep 2014 | 20 Sep 2016 | 19 Sep 2018 |
| 856 | nationwidehousesolutions.com | GoDaddy.com, LLC | 17 Mar 2022 | 29 Mar 2024 | 17 Mar 2025 |
| 857 | nationwidecashbackusa.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2017 |
| 858 | nationwide-bcg.com | Tucows Domains Inc. | 6 Sep 2014 | 10 Sep 2015 | 6 Sep 2016 |
| 859 | nationwide-business-capital-group.com | - | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2017 |
| 860 | nationwideinsurancelongisland.com | GoDaddy.com, LLC | 6 Sep 2014 | 7 Sep 2016 | 6 Sep 2017 |
| 861 | nationwidetileandstone.info | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 862 | nationwideremovalservices.com | - | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2017 |
| 863 | nationwidetileandstone.com | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 864 | nationwide-re.com | eNom, Inc. | 20 Sep 2014 | 2 Sep 2025 | 15 Sep 2026 |
| 865 | nationwidebusinesslender.com | GoDaddy.com, LLC | 20 Sep 2014 | 2 Jan 2025 | 1 Jan 2026 |
| 866 | nationwideremovalservice.com | GoDaddy.com, LLC | 12 Nov 2018 | 12 Nov 2018 | 12 Nov 2019 |
| 867 | nationwidetileandstone.net | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 868 | nationwidecarpetcleaning.net | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 869 | nationwidetileandstone.org | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 870 | nationwidetaxonline.com | GoDaddy.com, LLC | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 871 | nationwidecoinandbullionreserve.net | Wild West Domains, LLC | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 872 | nationwidehistology.com | Tucows Domains Inc. | 6 Sep 2011 | 8 Sep 2022 | 6 Sep 2027 |
| 873 | nationwideticketsource.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2016 |
| 874 | nationwidestudent-alliance.com | Network Solutions, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 875 | nationwideprepaidcellular.com | TPP Wholesale Pty Ltd. | 19 Nov 2014 | 15 Sep 2016 | 19 Nov 2017 |
| 876 | nationwidecorporatesearch.com | Network Solutions, LLC | 30 Sep 2014 | 11 Jun 2024 | 30 Sep 2026 |
| 877 | nationwideselfstorages.com | GoDaddy.com, LLC | 30 Sep 2014 | 30 Sep 2014 | 30 Sep 2015 |
| 878 | nationwidemoulding.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2024 | 2 Oct 2026 |
| 879 | nationwide-investments.com | eNom, Inc. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 880 | nationwide-mortgageinfo.com | Launchpad, Inc. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 881 | nationwidecosmetics.com | GoDaddy.com, LLC | 25 May 2025 | 25 May 2025 | 25 May 2026 |
| 882 | nationwidetranslators.com | GoDaddy.com, LLC | 9 Sep 2014 | 10 Sep 2016 | 9 Sep 2017 |
| 883 | nationwidedocprep.net | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 884 | nationwidejobstrk.us | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 1 Oct 2015 |
| 885 | nationwidemoulding.org | GoDaddy.com, LLC | 2 Oct 2014 | 3 Oct 2017 | 2 Oct 2018 |
| 886 | nationwideenergyandpower.com | eNom, Inc. | 3 Oct 2014 | 14 Nov 2024 | 3 Oct 2024 |
| 887 | nationwidehomefinders.com | GMO Internet Inc. | 3 Oct 2014 | 11 Jan 2018 | 3 Oct 2018 |
| 888 | nationwidepowerandenergy.com | eNom, Inc. | 3 Oct 2014 | 14 Nov 2024 | 3 Oct 2024 |
| 889 | nationwide-bankrupcy.com | GoDaddy.com, LLC | 3 Oct 2014 | 25 Aug 2016 | 3 Oct 2017 |
| 890 | nationwidebrands.com | Wild West Domains, LLC | 3 Oct 2014 | 18 Oct 2024 | 3 Oct 2025 |
| 891 | nationwidecontractingservices.com | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 892 | nationwideequipmentusa.com | GoDaddy.com, LLC | 12 Jan 2017 | 12 Jan 2025 | 12 Jan 2027 |
| 893 | nationwideloanservicing.com | Fabulous.com Pty Ltd. | 31 Aug 2009 | 3 Oct 2015 | 31 Aug 2016 |
| 894 | nationwidetowingwa.com | Crazy Domains FZ-LLC | 3 Oct 2014 | 14 Oct 2017 | 3 Oct 2017 |
| 895 | nationwidecashback.com | Wild West Domains, LLC | 31 May 2016 | 22 Sep 2022 | 31 May 2026 |
| 896 | nationwidecladdingcleaning.com | GoDaddy.com, LLC | 10 Sep 2014 | 11 Sep 2016 | 10 Sep 2018 |
| 897 | nationwidestairlifts.com | Tucows Domains Inc. | 8 Apr 2022 | 8 Apr 2025 | 8 Apr 2026 |
| 898 | nationwideunlimitedinc.com | Tucows Domains Inc. | 11 Sep 2014 | 15 Sep 2015 | 11 Sep 2016 |
| 899 | nationwidedigitalmarketingsolution.com | CSC Corporate Domains, Inc. | 1 Oct 2014 | 9 May 2021 | 1 Oct 2021 |
| 900 | nationwidelrosales.com | Tucows Domains Inc. | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 901 | nationwidemoulding.info | GoDaddy.com, LLC | 2 Oct 2014 | 3 Oct 2019 | 2 Oct 2020 |
| 902 | nationwidereliefnow.com | GoDaddy.com, LLC | 2 Oct 2014 | 3 Oct 2016 | 2 Oct 2017 |
| 903 | nationwidedigitalmarketing.com | CSC Corporate Domains, Inc. | 1 Oct 2014 | 28 Aug 2024 | 1 Oct 2025 |
| 904 | nationwidedigitalsolution.com | CSC Corporate Domains, Inc. | 1 Oct 2014 | 9 May 2021 | 1 Oct 2021 |
| 905 | nationwideuni.com | GoDaddy.com, LLC | 1 Oct 2014 | 26 Apr 2016 | 1 Oct 2017 |
| 906 | nationwidemoulding.net | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2018 | 2 Oct 2019 |
| 907 | nationwide-callcenter.com | GoDaddy.com, LLC | 4 Oct 2014 | 5 Oct 2024 | 4 Oct 2026 |
| 908 | nationwidemobilerepair.com | Tucows Domains Inc. | 1 Oct 2010 | 5 Oct 2014 | 1 Oct 2015 |
| 909 | nationwidetalentscouts.com | Hostinger, UAB | 28 Jul 2023 | 28 Jul 2025 | 28 Jul 2025 |
| 910 | nationwideticketsource.us | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 17 Nov 2016 |
| 911 | nationwidekidscharacters.org | Network Solutions, LLC | 10 Jan 2018 | 31 Jan 2018 | 10 Jan 2019 |
| 912 | nationwidecommercial.us | FastDomain Inc. | 10 Oct 2013 | 18 Nov 2014 | 9 Oct 2014 |
| 913 | nationwidecashbackusa.net | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2017 |
| 914 | nationwidejobsfinder.com | eNom, Inc. | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 915 | nationwide-party.info | GMO Internet Inc. | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 916 | nationwideonlinebackgroundcheck.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 917 | nationwiderepaircentres.com | Tucows Domains Inc. | 1 Oct 2010 | 5 Oct 2014 | 1 Oct 2015 |
| 918 | nationwidehousebuyer.com | GoDaddy.com, LLC | 4 Jan 2018 | 4 Jan 2023 | 4 Jan 2028 |
| 919 | nationwidecreditrepairs.com | GoDaddy.com, LLC | 8 Jul 2020 | 13 Jul 2025 | 8 Jul 2026 |
| 920 | nationwidetiresautomotive.com | - | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2017 |
| 921 | nationwidecancerresearch.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 922 | nationwidecheapproperties.com | Internet.bs Corp. | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 923 | nationwidehomefinancing.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 924 | nationwidehousefinders.com | GoDaddy.com, LLC | 22 Sep 2014 | 27 Sep 2016 | 22 Sep 2017 |
| 925 | nationwide-background-check.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 926 | nationwidepropertybuyers.com | Wild West Domains, LLC | 12 Mar 2024 | 7 Oct 2024 | 12 Mar 2027 |
| 927 | nationwidemeals.com | GoDaddy.com, LLC | 19 Feb 2020 | 1 Apr 2024 | 19 Feb 2024 |
| 928 | nationwidelocksny.com | register.com, Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 929 | nationwidewholesaleproperties.com | Domain.com, LLC | 8 Mar 2021 | 21 Feb 2025 | 8 Mar 2026 |
| 930 | nationwidepromo.com | GoDaddy.com, LLC | 27 Mar 2020 | 28 Mar 2023 | 27 Mar 2026 |
| 931 | nationwideaccessadvisor.com | Webfusion Ltd. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2016 |
| 932 | nationwidecourtreporting.net | Tucows Domains Inc. | 23 Sep 2014 | 27 Sep 2017 | 23 Sep 2017 |
| 933 | nationwidemaidservice.com | GoDaddy.com, LLC | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 934 | nationwideinsurancemn.com | Wild West Domains, LLC | 6 Oct 2014 | 4 Nov 2015 | 6 Oct 2017 |
| 935 | nationwidetransmissions.org | register.com, Inc. | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 936 | nationwidecollisionrepair.com | register.com, Inc. | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2016 |
| 937 | nationwidemovemanagement.com | GoDaddy.com, LLC | 7 Oct 2014 | 8 Oct 2024 | 7 Oct 2025 |
| 938 | nationwidemovemanagement.net | GoDaddy.com, LLC | 7 Oct 2014 | 8 Oct 2024 | 7 Oct 2025 |
| 939 | nationwidemovemanagementgroup.com | GoDaddy.com, LLC | 7 Oct 2014 | 8 Oct 2024 | 7 Oct 2025 |
| 940 | nationwidemovemanagementgroup.net | GoDaddy.com, LLC | 7 Oct 2014 | 29 May 2015 | 7 Oct 2017 |
| 941 | nationwidemovemanagementgroup.org | GoDaddy.com, LLC | 7 Oct 2014 | 31 Aug 2016 | 7 Oct 2018 |
| 942 | nationwideadvocates.com | GoDaddy.com, LLC | 27 Sep 2014 | 1 May 2025 | 27 Sep 2026 |
| 943 | nationwideretailsolutions.com | Tucows Domains Inc. | 24 Sep 2008 | 27 Sep 2014 | 24 Sep 2015 |
| 944 | nationwide-retail-solutions.com | Tucows Domains Inc. | 24 Sep 2008 | 27 Sep 2014 | 24 Sep 2015 |
| 945 | nationwideguard.com | TurnCommerce, Inc. DBA NameBright.com | 12 Dec 2021 | 23 Aug 2022 | 12 Dec 2025 |
| 946 | nationwidetitlesearch.com | GoDaddy.com, LLC | 6 Oct 2021 | 7 Oct 2023 | 6 Oct 2025 |
| 947 | nationwidehealthcpr.com | Network Solutions, LLC | 24 Sep 2014 | 24 Oct 2023 | 24 Sep 2026 |
| 948 | nationwidescreeds.com | Tucows Domains Inc. | 24 Sep 2014 | 25 Aug 2017 | 24 Sep 2018 |
| 949 | nationwidetg.com | NameCheap, Inc. | 16 Sep 2024 | 16 Sep 2024 | 16 Sep 2025 |
| 950 | nationwidesupportsffa.com | CSC Corporate Domains, Inc. | 21 Nov 2014 | 17 Nov 2024 | 21 Nov 2025 |
| 951 | nationwidemarketingcrm.com | GoDaddy.com, LLC | 6 Apr 2018 | 7 Apr 2025 | 6 Apr 2026 |
| 952 | nationwideecigs.com | Webfusion Ltd. | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2016 |
| 953 | nationwideautocarriers.info | GoDaddy.com, LLC | 9 Oct 2014 | 9 Oct 2014 | 9 Oct 2015 |
| 954 | nationwideautotransport.info | GoDaddy.com, LLC | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 955 | nationwidetransferllc.org | Wild West Domains, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 956 | nationwideadvocates.org | GoDaddy.com, LLC | 27 Sep 2014 | 12 Feb 2015 | 27 Sep 2017 |
| 957 | nationwiderxadvocates.com | GoDaddy.com, LLC | 27 Sep 2014 | 9 Dec 2024 | 27 Sep 2024 |
| 958 | nationwiderxadvocates.org | GoDaddy.com, LLC | 27 Sep 2014 | 29 Aug 2017 | 27 Sep 2018 |
| 959 | nationwidetg.net | GoDaddy.com, LLC | 21 Nov 2014 | 22 Nov 2016 | 21 Nov 2017 |
| 960 | nationwidetg.info | GoDaddy.com, LLC | 21 Nov 2014 | 22 Nov 2017 | 21 Nov 2018 |
| 961 | nationwidemarketinggrp.com | GoDaddy.com, LLC | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 962 | nationwidephilippines.com | GoDaddy.com, LLC | 22 Nov 2014 | 23 Nov 2024 | 22 Nov 2025 |
| 963 | nationwidelifeinternational.com | GoDaddy.com, LLC | 22 Nov 2014 | 23 Nov 2024 | 22 Nov 2025 |
| 964 | nationwidecivilprocess.com | GoDaddy.com, LLC | 29 Sep 2014 | 30 Sep 2024 | 29 Sep 2025 |
| 965 | nationwidecivilprocessserver.com | GoDaddy.com, LLC | 29 Sep 2014 | 30 Sep 2024 | 29 Sep 2025 |
| 966 | nationwidecivilprocessservers.com | GoDaddy.com, LLC | 29 Sep 2014 | 30 Sep 2024 | 29 Sep 2025 |
| 967 | nationwidemarketinggroupllc.com | GoDaddy.com, LLC | 29 Sep 2014 | 30 Sep 2024 | 29 Sep 2026 |
| 968 | nationwide5g.com | GoDaddy.com, LLC | 12 Apr 2018 | 5 Jan 2025 | 5 Jan 2026 |
| 969 | nationwidelocalbusinesstraining.com | GoDaddy.com, LLC | 29 Sep 2014 | 30 Sep 2018 | 29 Sep 2019 |
| 970 | nationwidetg.org | GoDaddy.com, LLC | 21 Nov 2014 | 22 Nov 2017 | 21 Nov 2018 |
| 971 | nationwidestudentalliance.org | GoDaddy.com, LLC | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2019 |
| 972 | nationwideprocessservice.org | Launchpad, Inc. | 21 Nov 2014 | 6 Nov 2017 | 21 Nov 2018 |
| 973 | nationwide-cash.info | GoDaddy.com, LLC | 10 Oct 2014 | 11 Oct 2014 | 10 Oct 2015 |
| 974 | nationwideassetrecovery.net | NameCheap, Inc. | 27 Feb 2024 | 11 May 2025 | 27 Feb 2025 |
| 975 | nationwidehillsboro457.com | CSC Corporate Domains, Inc. | 10 Oct 2014 | 30 Aug 2024 | 10 Oct 2025 |
| 976 | nationwideoptics.com | DreamHost, LLC | 28 Jul 2023 | 29 Jul 2025 | 28 Jul 2026 |
| 977 | nationwideservicesonline.com | Interweb Advertising D.B.A. Profile Builder | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 978 | nationwidefls.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 979 | nationwidetaxillc.com | GoDaddy.com, LLC | 27 Jul 2023 | 27 Jul 2023 | 27 Jul 2025 |
| 980 | nationwidehotel.com | TurnCommerce, Inc. DBA NameBright.com | 5 Jan 2017 | 13 Feb 2025 | 5 Jan 2026 |
| 981 | nationwidecarappraisals.com | eNom, Inc. | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 982 | nationwidetransferllc.com | DropCatch.com 856 LLC | 29 Dec 2016 | 30 Dec 2017 | 29 Dec 2018 |
| 983 | nationwidetruckappraisals.com | eNom, Inc. | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 984 | nationwidepartybusrentals.com | GoDaddy.com, LLC | 26 Sep 2014 | 20 Sep 2016 | 26 Sep 2017 |
| 985 | nationwidepartybusrental.com | GoDaddy.com, LLC | 26 Sep 2014 | 20 Sep 2016 | 26 Sep 2017 |
| 986 | nationwideluxuryrealtors.com | Wild West Domains, LLC | 25 Sep 2014 | 27 Jun 2016 | 25 Sep 2017 |
| 987 | nationwideindustrialroofing.com | GoDaddy.com, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 988 | nationwidefund.com | TurnCommerce, Inc. DBA NameBright.com | 15 Dec 2015 | 6 Apr 2022 | 15 Dec 2025 |
| 989 | nationwidedatadesigns.com | eNom, Inc. | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 990 | nationwidecommunitycare.com | Tucows Domains Inc. | 27 Sep 2014 | 1 Oct 2018 | 27 Sep 2018 |
| 991 | nationwidecomfort.com | GoDaddy.com, LLC | 25 Sep 2014 | 24 Oct 2024 | 25 Sep 2025 |
| 992 | nationwide-satellite-internet-access.com | Tucows Domains Inc. | 23 Sep 2003 | 26 Sep 2014 | 23 Sep 2015 |
| 993 | nationwidein.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 994 | nationwidelead.com | NameCheap, Inc. | 20 May 2025 | 14 Jun 2025 | 20 May 2026 |
| 995 | nationwideoffice.com | GoDaddy.com, LLC | 15 Feb 2025 | 15 Feb 2025 | 15 Feb 2026 |
| 996 | nationwidesportstickets.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 997 | nationwidesalesanddelivery.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 998 | nationwiderentalgroup.com | register.com, Inc. | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2017 |
| 999 | nationwidelist.com | TurnCommerce, Inc. DBA NameBright.com | 21 Dec 2020 | 2 Mar 2025 | 21 Dec 2024 |
| 1000 | nationwideguttermaintenance.com | Tucows Domains Inc. | 21 Nov 2011 | 25 Nov 2014 | 21 Nov 2015 |
Displaying 1,000 out of 20,824 domains starting with the keyword "NATIONWIDE". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=nationwide
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |