With support for 
Keyword: MYLITTLEPARA
Reverse Whois » KEYWORD [mylittlepara ] { 25 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | mylittlepara.com | Online SAS | 17 Dec 2024 | 4 Dec 2025 | 17 Dec 2026 |
| 2 | mylittleparadise.net | Squarespace Domains LLC | 26 Mar 2024 | 6 Apr 2026 | 26 Mar 2027 |
| 3 | mylittleparasite.com | Crazy Domains FZ-LLC | 24 May 2015 | 16 May 2025 | 24 May 2026 |
| 4 | mylittleparadiseinternationalinc.com | - | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2017 |
| 5 | mylittleparadiseatnewlifeinc.com | - | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2017 |
| 6 | mylittleparadise.com | TurnCommerce, Inc. DBA NameBright.com | 19 Dec 2011 | 13 Dec 2020 | 19 Dec 2026 |
| 7 | mylittleparadis.com | OVH sas | 25 Jan 2013 | 10 Jan 2017 | 25 Jan 2018 |
| 8 | mylittleparables.com | FastDomain Inc. | 7 Nov 2016 | 7 Nov 2017 | 7 Nov 2018 |
| 9 | mylittleparadise.cat | Acens Technologies, S.L.U. | 22 Mar 2018 | - | 22 Mar 2019 |
| 10 | mylittleparadice.com | Key-Systems GmbH | 12 Mar 2020 | 11 Mar 2026 | 12 Mar 2027 |
| 11 | mylittleparadiseadventure.com | Google, Inc. | 10 Mar 2022 | 11 Mar 2024 | 10 Mar 2025 |
| 12 | mylittleparadiseadventures.com | Google, Inc. | 10 Mar 2022 | 11 Mar 2024 | 10 Mar 2025 |
| 13 | mylittleparadise.info | GoDaddy.com, LLC | 28 Mar 2023 | 29 Mar 2026 | 28 Mar 2027 |
| 14 | mylittleparadiso.com | GoDaddy.com, LLC | 10 Aug 2023 | 20 Sep 2024 | 10 Aug 2024 |
| 15 | mylittleparadise.online | Domain.com, LLC | 29 Jan 2024 | 19 Jan 2026 | 29 Jan 2027 |
| 16 | mylittleparadise.org | Domain.com, LLC | 29 Jan 2024 | 19 Jan 2026 | 29 Jan 2027 |
| 17 | mylittleparadise.shop | Tucows Domains Inc. | 21 Aug 2023 | 3 Oct 2023 | 21 Aug 2024 |
| 18 | mylittleparadise.de | - | - | 20 Feb 2026 | - |
| 19 | mylittleparadise.biz | Tucows Domains Inc. | 1 Aug 2024 | 11 Sep 2025 | 1 Aug 2025 |
| 20 | mylittleparalegal.com | DomainTact LLC | 16 Aug 2024 | 2 Jan 2026 | 16 Aug 2026 |
| 21 | mylittleparadiserentals.org | NameCheap, Inc. | 25 Feb 2025 | 31 Jan 2026 | 25 Feb 2027 |
| 22 | mylittleparadise.rentals | NameCheap, Inc. | 25 Feb 2025 | 26 Jan 2026 | - |
| 23 | mylittleparadiserentals.com | NameCheap, Inc. | 25 Feb 2025 | 26 Jan 2026 | 25 Feb 2027 |
| 24 | mylittleparadiserentals.net | NameCheap, Inc. | 25 Feb 2025 | 26 Jan 2026 | 25 Feb 2027 |
| 25 | mylittleparadiseofhappiness.com | Tucows Domains Inc. | 11 Apr 2025 | 29 Mar 2026 | 11 Apr 2026 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=mylittlepara
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |