With support for 
Keyword: MENY
Reverse Whois » KEYWORD [meny ] { 4,772 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | meny.no | - | 1 Oct 2010 | 16 Jan 2012 | - |
| 2 | meny.co.il | - | - | 11 Apr 2011 | 30 Apr 2018 |
| 3 | meny.dk | - | 22 Apr 1997 | - | 30 Jun 2025 |
| 4 | meny.catering | - | 4 Jul 2014 | 4 Jul 2014 | 4 Jul 2015 |
| 5 | meny.cool | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Sep 2014 | 6 Jan 2017 | 10 Sep 2017 |
| 6 | meny.pizza | Domeneshop AS dba domainnameshop.com | 6 Jan 2021 | 7 Jan 2021 | 6 Jan 2022 |
| 7 | meny.ninja | Tucows Domains Inc. | 29 Dec 2014 | 10 Jan 2017 | 29 Dec 2017 |
| 8 | meny.top | Hosting Concepts B.V. dba Openprovider | 15 May 2025 | 16 May 2025 | 15 May 2026 |
| 9 | meny.gratis | GoDaddy.com, LLC | 22 Jul 2015 | 2 Mar 2025 | 22 Jul 2025 |
| 10 | meny.xyz | Tucows Domains Inc. | 4 Feb 2021 | 10 Mar 2025 | 4 Feb 2026 |
| 11 | meny.link | Hostinger, UAB | 26 Dec 2020 | 27 Dec 2023 | 26 Dec 2024 |
| 12 | meny.com | MarkMonitor Inc. | 4 Feb 1996 | 19 Nov 2024 | 5 Feb 2027 |
| 13 | meny.win | West263 International Limited | 5 Jan 2017 | 27 Sep 2017 | 4 Jan 2018 |
| 14 | meny.wang | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Oct 2015 | - | 28 Oct 2016 |
| 15 | meny.fr | - | 25 Jan 2005 | 13 Feb 2017 | 13 Feb 2018 |
| 16 | meny.club | NameCheap, Inc. | 14 Sep 2020 | - | 14 Sep 2021 |
| 17 | meny.money | GoDaddy.com, LLC | 28 Jul 2016 | 8 Sep 2017 | 28 Jul 2017 |
| 18 | meny.info | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Dec 2024 | 4 Jan 2025 | 30 Dec 2025 |
| 19 | meny.mobi | eNom, Inc. | 5 Jan 2009 | 4 Feb 2025 | 5 Jan 2026 |
| 20 | meny.net | Epik Inc. | 12 Jul 2001 | 3 Nov 2021 | 12 Jul 2025 |
| 21 | meny.org | Realtime Register B.V. | 5 Oct 2004 | 19 Nov 2024 | 5 Oct 2025 |
| 22 | meny.online | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 26 Jun 2019 | 26 Jun 2024 | 26 Jun 2024 |
| 23 | meny.men | Porkbun, LLC | 23 May 2023 | 27 May 2024 | 23 May 2025 |
| 24 | meny.co.uk | - | 28 Jan 2024 | 28 Jan 2025 | 28 Jan 2025 |
| 25 | meny.restaurant | NameCheap, Inc. | 22 Apr 2020 | 27 Apr 2020 | 22 Apr 2021 |
| 26 | meny.digital | - | 12 Feb 2025 | 28 Apr 2025 | 12 Feb 2026 |
| 27 | meny.network | NameCheap, Inc. | 8 Mar 2020 | 13 Mar 2020 | 8 Mar 2021 |
| 28 | meny.works | Name.com, Inc. | 31 May 2020 | 31 May 2020 | 31 May 2021 |
| 29 | meny.rest | NameCheap, Inc. | 4 Feb 2024 | 19 Mar 2025 | 4 Feb 2025 |
| 30 | meny.asia | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 24 May 2018 | 29 Apr 2025 | 24 May 2026 |
| 31 | meny.wiki | NameCheap, Inc. | 14 Sep 2020 | 14 Sep 2020 | 14 Sep 2021 |
| 32 | meny.host | Limited Liability Company "Registrar of domain nam… | 12 Nov 2019 | 1 Nov 2020 | 12 Nov 2020 |
| 33 | meny.wine | Porkbun, LLC | 6 Jan 2021 | 6 Jan 2021 | 6 Jan 2022 |
| 34 | meny.vin | Domeneshop AS dba domainnameshop.com | 6 Jan 2021 | 7 Jan 2021 | 6 Jan 2022 |
| 35 | meny.tech | Domeneshop AS dba domainnameshop.com | 6 Jan 2021 | 7 Jan 2021 | 6 Jan 2022 |
| 36 | meny.pro | GoDaddy.com, LLC | 29 May 2024 | 3 Jun 2024 | 29 May 2025 |
| 37 | meny.cloud | Domeneshop AS dba domainnameshop.com | 21 Apr 2021 | 21 Apr 2021 | 21 Apr 2022 |
| 38 | meny.media | Nordreg AB | 5 Jun 2021 | 5 Jun 2021 | 5 Jun 2022 |
| 39 | meny.store | One.com A/S | 9 Jun 2021 | 3 Apr 2025 | 9 Jun 2025 |
| 40 | meny.menu | Porkbun, LLC | 10 Nov 2021 | 30 Oct 2024 | 10 Nov 2025 |
| 41 | meny.properties | GoDaddy.com, LLC | 1 Feb 2022 | 3 Sep 2024 | 1 Feb 2027 |
| 42 | meny.city | DNSPod, Inc. | 28 Aug 2022 | 4 Jul 2024 | 28 Aug 2025 |
| 43 | meny.app | CloudFlare, Inc. | 29 Sep 2024 | 6 Oct 2024 | 29 Sep 2025 |
| 44 | meny.com.br | - | 8 May 2020 | 7 May 2024 | 8 May 2026 |
| 45 | meny.cc | Dynadot, LLC | 31 Aug 2023 | 10 Nov 2024 | 31 Aug 2024 |
| 46 | meny.dev | Google, Inc. | 18 Oct 2021 | 9 Oct 2024 | 18 Oct 2025 |
| 47 | meny.it | - | 25 Sep 2023 | 11 Oct 2024 | 25 Sep 2025 |
| 48 | meny.co.jp | - | 4 Nov 2019 | 1 Dec 2024 | - |
| 49 | meny.nl | - | 17 Sep 2014 | 24 Apr 2023 | - |
| 50 | meny.vip | Xin Net Technology Corporation | 19 May 2016 | 19 May 2025 | 19 May 2025 |
| 51 | meny.us | GoDaddy.com, LLC | 17 Jul 2008 | 22 Jul 2024 | 16 Jul 2025 |
| 52 | meny.in | GoDaddy.com, LLC | 8 Oct 2024 | 13 Oct 2024 | 8 Oct 2025 |
| 53 | meny.ru | - | 9 Feb 2005 | - | 9 Feb 2026 |
| 54 | meny.de | - | - | 1 Feb 2018 | - |
| 55 | meny.hu | - | 17 Mar 2021 | - | - |
| 56 | meny.lol | Tucows Domains Inc. | 10 Jul 2024 | 12 Aug 2024 | 10 Jul 2025 |
| 57 | meny.at | - | - | 27 Jun 2023 | - |
| 58 | meny.website | Hostinger, UAB | 4 Nov 2024 | 9 Nov 2024 | 4 Nov 2025 |
| 59 | meny.fun | - | 6 Nov 2024 | 11 Nov 2024 | 6 Nov 2025 |
| 60 | meny.se | - | 17 Nov 2000 | 2 Oct 2024 | 17 Nov 2025 |
| 61 | meny.cn | - | 1 May 2005 | - | 1 May 2026 |
| 62 | meny.name | Amazon Registrar, Inc. | - | - | - |
| 63 | meny.pt | - | 10 Nov 2024 | - | 10 Nov 2025 |
| 64 | menye.com | HiChina Zhicheng Technology Limited | 25 Feb 2003 | 11 Jan 2024 | 25 Feb 2026 |
| 65 | menya-hanabi.com | Network Solutions, LLC | 29 Mar 2011 | 27 Feb 2025 | 29 Mar 2026 |
| 66 | menya-hanabi.net | GMO Internet Inc. | 8 May 2012 | 8 Apr 2025 | 8 May 2026 |
| 67 | menya-iroha.com | Japan Registry Services Co., Ltd. | 13 Mar 2003 | 5 Feb 2025 | 13 Mar 2026 |
| 68 | menyal.net | MAFF Avenue, Inc | 14 Jul 2023 | 22 Aug 2024 | 14 Jul 2024 |
| 69 | menyala.com | GoDaddy.com, LLC | 22 Apr 2016 | 23 Apr 2025 | 22 Apr 2026 |
| 70 | menya-shono.com | GMO Internet Inc. | 22 May 2006 | 7 May 2025 | 22 May 2026 |
| 71 | menyesha.com | Tucows Domains Inc. | 30 Jun 2022 | 30 Jun 2022 | 30 Jun 2023 |
| 72 | menyoume.com | NameCheap, Inc. | 22 Oct 2014 | 22 Sep 2024 | 22 Oct 2025 |
| 73 | menyberg.com | Domain.com, LLC | 22 Oct 2014 | 7 Nov 2024 | 22 Oct 2029 |
| 74 | menyala.ru | - | 11 Mar 2025 | - | 11 Mar 2026 |
| 75 | menyeshu.ru | - | - | - | - |
| 76 | menya-itto.com | GMO Internet Inc. | 21 Jan 2014 | 12 May 2024 | 21 Jan 2026 |
| 77 | menyohost.com | Wild West Domains, LLC | 19 Oct 2014 | 20 Oct 2024 | 19 Oct 2025 |
| 78 | menyt.com | OVH sas | 24 Oct 2014 | 28 Jun 2023 | 24 Oct 2025 |
| 79 | menyt.net | OVH sas | 24 Oct 2014 | 21 Jun 2023 | 24 Oct 2025 |
| 80 | menyen.com | eNom, Inc. | 23 Jan 2010 | 30 Jan 2025 | 23 Jan 2026 |
| 81 | menyimak.com | eNom, Inc. | 17 Apr 2012 | 10 May 2017 | 17 Apr 2018 |
| 82 | menys.com | CloudFlare, Inc. | 28 Aug 2006 | 18 Dec 2024 | 28 Aug 2025 |
| 83 | menya-yoshikuni.com | Japan Registry Services Co., Ltd. | 13 Feb 2018 | 23 Jan 2025 | 13 Feb 2026 |
| 84 | menyusul.com | Web Commerce Communications Limited dba WebNic.cc | 24 Jan 2025 | 7 Feb 2025 | 24 Jan 2026 |
| 85 | menyusui.com | GoDaddy.com, LLC | 10 May 2009 | 20 Apr 2025 | 10 May 2026 |
| 86 | menyhart.org | united-domains AG | 28 Oct 2014 | 29 Oct 2017 | 28 Oct 2018 |
| 87 | meny-couverture.com | OVH sas | 30 Oct 2014 | 31 Oct 2017 | 30 Oct 2018 |
| 88 | menyasszonyi-csokor.net | GMO Internet Inc. | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 89 | menyeah.com | Launchpad, Inc. | 12 Mar 2020 | 25 Feb 2025 | 12 Mar 2026 |
| 90 | menycam.com | GoDaddy.com, LLC | 6 May 2007 | 18 Jul 2024 | 6 May 2024 |
| 91 | menyampah.com | Tucows Domains Inc. | 4 Jun 2014 | 8 Jun 2015 | 4 Jun 2016 |
| 92 | menypages.com | Tucows Domains Inc. | 1 Nov 2005 | 5 Nov 2014 | 1 Nov 2015 |
| 93 | menyenandzen.com | GoDaddy.com, LLC | 17 Jun 2004 | 17 Jun 2015 | 17 Jun 2016 |
| 94 | menya-gen.com | GMO Internet Inc. | 28 Feb 2024 | 12 Apr 2025 | 28 Feb 2025 |
| 95 | menyanawilliams.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 96 | menyorot-perkapalan-atlantik.com | eNom, Inc. | 6 Nov 2014 | 7 Nov 2014 | 6 Nov 2015 |
| 97 | menyiandralph.net | Tucows Domains Inc. | 18 Aug 2008 | 21 Aug 2014 | 18 Aug 2015 |
| 98 | menyedu.com | Beijing Lanhai Jiye Technology Co., Ltd | 22 Nov 2023 | 23 Nov 2024 | 22 Nov 2025 |
| 99 | menye100.com | Beijing Lanhai Jiye Technology Co., Ltd | 14 Apr 2015 | 15 Apr 2025 | 14 Apr 2026 |
| 100 | menyuu.com | CloudFlare, Inc. | 19 Jun 2023 | 11 Apr 2024 | 19 Jun 2025 |
| 101 | menyonline.info | EuroDNS S.A. | 26 Aug 2014 | 4 Mar 2025 | 26 Aug 2025 |
| 102 | menya-maruyuu.com | GMO Internet Inc. | 10 Nov 2014 | 13 Mar 2016 | 10 Nov 2021 |
| 103 | menya-akaoka.com | GMO Internet Inc. | 14 Aug 2014 | 25 Dec 2015 | 14 Aug 2016 |
| 104 | menyonyo.com | eNom, Inc. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 105 | menya-takumi.com | GMO Internet Inc. | 12 Dec 2017 | 23 Feb 2025 | 12 Dec 2024 |
| 106 | menyontvo-cp.com | Network Solutions, LLC | 10 Nov 2014 | 25 Jan 2018 | 10 Nov 2018 |
| 107 | menytv.com | NameCheap, Inc. | 7 Jan 2020 | - | 7 Jan 2021 |
| 108 | menyenangkancom.com | OnlineNIC, Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 109 | menyhard.com | Key-Systems GmbH | 29 Aug 2014 | 28 Aug 2017 | 29 Aug 2018 |
| 110 | menylcw.biz | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 27 Aug 2015 |
| 111 | menyayka.com | - | 15 Jul 2016 | 15 Jul 2016 | 15 Jul 2017 |
| 112 | menylg.com | Chengdu West Dimension Digital Technology Co., Ltd… | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 113 | menya-sasuke.com | GMO Internet Inc. | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 114 | menya-hakushin.com | Silver Domain Names LLC | 10 May 2020 | 11 May 2020 | 10 May 2021 |
| 115 | menya-ok.com | Marcaria.com International, Inc. | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 116 | menyembuhkanpankreas.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Sep 2014 | 4 Sep 2017 | 3 Sep 2018 |
| 117 | menyanprojects.com | - | 17 Dec 2023 | 18 Jan 2025 | 17 Dec 2024 |
| 118 | menya-gokuu.com | GMO Internet Inc. | 19 Sep 2014 | 24 Aug 2015 | 19 Sep 2015 |
| 119 | menyuqi.com | - | 30 Apr 2022 | 2 May 2023 | 30 Apr 2024 |
| 120 | menyembuhkanjantung.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Sep 2014 | 21 Sep 2017 | 22 Sep 2018 |
| 121 | menya-kaminoshizuku.com | GMO Internet Inc. | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2015 |
| 122 | menye001.com | HiChina Zhicheng Technology Limited | 2 Oct 2014 | 6 Nov 2016 | 2 Oct 2017 |
| 123 | menyebalkan.com | - | 14 Oct 2022 | 16 Dec 2023 | 14 Oct 2023 |
| 124 | menyige.net | Beijing Lanhai Jiye Technology Co., Ltd | 26 Feb 2024 | 25 Mar 2025 | 26 Feb 2026 |
| 125 | menyinggp.com | Entertainment Names, Incorporated | 27 Sep 2024 | 30 Sep 2024 | 27 Sep 2025 |
| 126 | menyonyoyaafrica.com | eNom, Inc. | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 127 | menyvillalba.com | Hostinger, UAB | 21 Mar 2019 | 22 Feb 2025 | 21 Mar 2028 |
| 128 | menyewa-rumah.com | Vautron Rechenzentrum AG | 20 Nov 2014 | 22 Nov 2016 | 20 Nov 2017 |
| 129 | menyaem.com | Regional Network Information Center, JSC dba RU-CE… | 3 May 2022 | 1 May 2025 | 2 May 2026 |
| 130 | menya-haruka.com | GMO Internet Inc. | 21 Nov 2014 | 6 Nov 2024 | 21 Nov 2025 |
| 131 | menyingkap.com | Internet Domain Services BS Corp | 6 Jun 2021 | 6 Jun 2021 | 6 Jun 2022 |
| 132 | menyong.info | Dynadot, LLC | 24 Apr 2024 | 24 Apr 2025 | 24 Apr 2026 |
| 133 | menyazhi.com | 35 Technology Co., Ltd. | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 134 | menye315.net | Domain.com, LLC | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 135 | menyetian.com | Bizcn.com, Inc. | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 136 | menyoucantrust.net | Blacknight Internet Solutions Ltd. | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2016 |
| 137 | menyoz.com | GoDaddy.com, LLC | 14 Oct 2014 | 15 Oct 2024 | 14 Oct 2026 |
| 138 | menyogawear.com | eNom, Inc. | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 139 | menyamakoto.com | GMO Internet Inc. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 140 | menyalkin.pro | Tucows Domains Inc. | 19 Jul 2018 | 23 Jul 2019 | 19 Jul 2020 |
| 141 | menyjobs.com | GoDaddy.com, LLC | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 142 | menyayangi.com | Megazone Corp., dba HOSTING.KR | 29 Nov 2014 | 2 Dec 2017 | 29 Nov 2017 |
| 143 | menyailov.com | PSI-USA, Inc. dba Domain Robot | 1 Sep 2020 | 2 Sep 2020 | 1 Sep 2021 |
| 144 | menya-yoi.com | GMO Internet Inc. | 5 Dec 2014 | 16 Jul 2015 | 5 Dec 2015 |
| 145 | menyebar.com | Snag Your Name LLC | 22 Nov 2017 | 22 Nov 2017 | 22 Nov 2018 |
| 146 | menyrest.com | Nominalia Internet S.L. | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 147 | menyingtang.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Mar 2023 | 6 May 2025 | 4 Mar 2025 |
| 148 | menyanoodlehouse.com | FastDomain Inc. | 16 Dec 2014 | 30 Jan 2025 | 16 Dec 2024 |
| 149 | menyasszonyiruha.com | - | 20 Dec 2014 | 19 Jan 2025 | 20 Dec 2025 |
| 150 | menya-hibuta.com | GMO Internet Inc. | 20 Dec 2014 | 20 Nov 2024 | 20 Dec 2025 |
| 151 | menyalapm.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 152 | menyala.pro | NameCheap, Inc. | 15 Apr 2024 | 21 Apr 2025 | 15 Apr 2026 |
| 153 | menyentuhhati.com | MAFF Inc. | 24 Mar 2021 | 24 Mar 2021 | 24 Mar 2022 |
| 154 | menyakin.com | CloudFlare, Inc. | 31 Dec 2014 | 2 Oct 2024 | 31 Dec 2025 |
| 155 | menye.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Jun 2014 | 30 Mar 2017 | 29 Jun 2018 |
| 156 | menye.xyz | Google, Inc. | 23 Aug 2014 | 14 May 2024 | 23 Aug 2025 |
| 157 | menya.xyz | GMO Internet Inc. | 8 Apr 2024 | 9 Apr 2025 | 8 Apr 2026 |
| 158 | menyi.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 22 Oct 2014 | 19 Apr 2017 | 22 Oct 2018 |
| 159 | menya-tachibana.com | GMO Internet Inc. | 22 Mar 2014 | 11 Aug 2015 | 22 Mar 2016 |
| 160 | menyu.moscow | Limited Liability Company "Registrar of domain nam… | 4 Dec 2014 | 5 Dec 2014 | 4 Dec 2015 |
| 161 | menyayu.moscow | Limited Liability Company "Registrar of domain nam… | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 162 | menyu.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 14 Feb 2025 | 1 Mar 2025 | 14 Feb 2026 |
| 163 | menyai.cash | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 164 | menyai.today | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 165 | menyou.menu | eNom, Inc. | 1 May 2015 | 1 May 2015 | 1 May 2016 |
| 166 | menyeshangcheng.com | Shanghai Meicheng Technology Information Co., Ltd | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 167 | menyol.org | eNom, Inc. | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 168 | menyolhosting.com | eNom, Inc. | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 169 | menyao.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 7 Dec 2016 | 27 Dec 2016 | 6 Dec 2017 |
| 170 | menyu.top | Namesilo, LLC | 15 Jun 2023 | 18 Jul 2024 | 15 Jun 2024 |
| 171 | menyin.top | Zhengzhou Century Connect Electronic Technology De… | 27 Jun 2015 | 28 Jun 2017 | 28 Jun 2017 |
| 172 | menye.pub | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Jan 2018 | 27 Jan 2018 | 25 Jan 2019 |
| 173 | menyan.top | Zhengzhou Century Connect Electronic Technology De… | 27 Jun 2015 | 28 Jun 2017 | 28 Jun 2017 |
| 174 | menyuan.top | Jiangsu Bangning Science and technology Co. Ltd. | 24 Jul 2023 | 27 Aug 2024 | 24 Jul 2024 |
| 175 | menyan.work | Minds + Machines Registrar Limited | 11 Jun 2015 | 11 Jun 2015 | 11 Jun 2016 |
| 176 | menycomputers.com | Tucows Domains Inc. | 16 Aug 2015 | 13 Jul 2024 | 16 Aug 2025 |
| 177 | menyi.top | eName Technology Co., Ltd. | 28 Jul 2015 | 25 Apr 2017 | 28 Jul 2018 |
| 178 | menyashinasoba.club | GMO Internet Inc. | 5 Aug 2015 | 6 Aug 2015 | 4 Aug 2016 |
| 179 | menyuan.link | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 18 Aug 2015 | - | 18 Aug 2016 |
| 180 | menyhartplumbing.net | Tucows Domains Inc. | 23 Jan 2015 | 25 Dec 2024 | 23 Jan 2026 |
| 181 | menyuerugames.com | GoDaddy.com, LLC | 27 Jan 2015 | 1 Feb 2024 | 27 Jan 2034 |
| 182 | menyanthesaurussynonumsantonums.com | Moniker Online Services LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 183 | menyaemu.com | GMO Internet Inc. | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 184 | menyagyutandon.com | GoDaddy.com, LLC | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2017 |
| 185 | menyoutour.com | Internet Domain Services BS Corp | 3 Dec 2015 | 3 Dec 2015 | 3 Dec 2016 |
| 186 | menyashiki-marusho.com | GMO Internet Inc. | 3 Feb 2015 | 5 Jan 2025 | 3 Feb 2026 |
| 187 | menya-kaka.com | Japan Registry Services Co., Ltd. | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 188 | menyasgermansherpards.com | register.com, Inc. | 6 Feb 2015 | 7 Feb 2025 | 6 Feb 2026 |
| 189 | menyu.net | Beijing Lanhai Jiye Technology Co., Ltd | 16 Feb 2025 | 24 Mar 2025 | 16 Feb 2026 |
| 190 | menyuchuang.com | HiChina Zhicheng Technology Limited | 21 Aug 2015 | 5 Sep 2016 | 21 Aug 2017 |
| 191 | menyatukanumat.com | CV. Jogjacamp | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 192 | menyerah.info | Crazy Domains FZ-LLC | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 193 | menyol.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 24 Jan 2019 | 24 Jan 2025 | 24 Jan 2026 |
| 194 | menyajin.com | Tucows Domains Inc. | 25 May 2024 | 25 May 2024 | 25 May 2025 |
| 195 | menya-ozora.com | GMO Internet Inc. | 18 Feb 2015 | 19 Feb 2015 | 18 Feb 2017 |
| 196 | menyai.com | Internet Invest, Ltd. dba Imena.ua | 19 Feb 2015 | 1 May 2025 | 19 Feb 2025 |
| 197 | menymo.com | GoDaddy.com, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 198 | menya-iwate.com | GMO Internet Inc. | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 199 | menyastaffings.com | Tucows Domains Inc. | 28 Feb 2014 | 4 Mar 2015 | 28 Feb 2016 |
| 200 | menythings.com | TurnCommerce, Inc. DBA NameBright.com | 30 Dec 2018 | 8 Feb 2025 | 30 Dec 2024 |
| 201 | menya-inaba.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 202 | menya889.com | GoDaddy.com, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 203 | menyapinsaat.com | Ä°simtescil BiliÅŸim A.Åž. | 7 Mar 2015 | 9 Mar 2025 | 7 Mar 2026 |
| 204 | menyapinsaat.net | Ä°simtescil BiliÅŸim A.Åž. | 7 Mar 2015 | 20 May 2025 | 7 Mar 2025 |
| 205 | menyecn.com | DropCatch.com 624 LLC | 13 Jul 2022 | 23 Sep 2023 | 13 Jul 2023 |
| 206 | menye88888.com | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Jan 2019 | 24 Jan 2019 | 24 Jan 2020 |
| 207 | menyre.com | Google, Inc. | 19 Sep 2016 | 18 Sep 2024 | 19 Sep 2025 |
| 208 | menyou.net | Google, Inc. | 2 Sep 2023 | 18 Aug 2024 | 2 Sep 2025 |
| 209 | menyembuhkansakit.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 210 | menyaogiso.com | GMO Internet Inc. | 18 Mar 2015 | 1 May 2017 | 18 Mar 2021 |
| 211 | menyehatkan.com | Name.com, Inc. | 14 Jun 2021 | 24 May 2024 | 14 Jun 2025 |
| 212 | menya-aoi.mobi | GMO Internet Inc. | 19 Mar 2015 | 2 May 2017 | 19 Mar 2021 |
| 213 | menyembuhkanosteoporosis.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Mar 2015 | 23 Mar 2017 | 21 Mar 2018 |
| 214 | menygirls-show.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Mar 2015 | - | 20 Mar 2016 |
| 215 | menynamel.com | Tucows Domains Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2017 |
| 216 | menya-fukuro.com | GMO Internet Inc. | 21 Nov 2018 | 22 Oct 2024 | 21 Nov 2025 |
| 217 | menyendiri.com | Melbourne IT, Ltd | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 218 | menyolhost.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 219 | menyimak.info | Crazy Domains FZ-LLC | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 220 | menycams.com | Tucows Domains Inc. | 27 Mar 2010 | 31 Mar 2015 | 27 Mar 2016 |
| 221 | menyv.com | GoDaddy.com, LLC | 20 Sep 2021 | 20 Sep 2021 | 20 Sep 2022 |
| 222 | menyfredrik.com | Tucows Domains Inc. | 1 Apr 2015 | 5 Apr 2018 | 1 Apr 2018 |
| 223 | menypodden.com | Tucows Domains Inc. | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2017 |
| 224 | menypodden.biz | Tucows Domains Inc. | 2 Apr 2015 | 2 Apr 2015 | 1 Apr 2016 |
| 225 | menyuanyoucaihua.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 31 Mar 2014 | 3 Apr 2015 | 31 Mar 2016 |
| 226 | menypupin.com | eNom, Inc. | 5 Apr 2015 | 5 Apr 2015 | 5 Apr 2016 |
| 227 | menyago.com | Network Solutions, LLC | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2018 |
| 228 | menyabo.com | HiChina Zhicheng Technology Limited | 24 Jun 2019 | 25 Jun 2020 | 24 Jun 2020 |
| 229 | menynordbyen.com | NameCheap, Inc. | 7 Apr 2015 | 8 Mar 2025 | 7 Apr 2026 |
| 230 | menyhar.com | - | - | - | - |
| 231 | menyan.com | - | 4 Apr 2007 | 5 Sep 2024 | 4 Apr 2026 |
| 232 | menyue.net | HiChina Zhicheng Technology Limited | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2018 |
| 233 | menyai.org | Internet Invest, Ltd. dba Imena.ua | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 234 | menyai.net | Internet Invest, Ltd. dba Imena.ua | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 235 | menyuanbank.com | Bizcn.com, Inc. | 29 Aug 2015 | 21 Jul 2017 | 29 Aug 2018 |
| 236 | menyuamhaiv.com | eNom, Inc. | 29 Aug 2015 | 31 Jul 2016 | 29 Aug 2017 |
| 237 | menya-nakaji.com | GMO Internet Inc. | 10 Apr 2015 | 12 Mar 2025 | 10 Apr 2026 |
| 238 | menyou.com | GoDaddy.com, LLC | 10 Apr 2015 | 23 May 2025 | 10 Apr 2026 |
| 239 | menyferety.com | GoDaddy.com, LLC | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 240 | menyatsutajyuu.com | Tucows Domains Inc. | 26 Jul 2023 | 26 Jul 2023 | 26 Jul 2024 |
| 241 | menyechaoshi.com | Shanghai Meicheng Technology Information Co., Ltd | 5 Sep 2015 | 5 Sep 2015 | 5 Sep 2016 |
| 242 | menyoos.com | NameCheap, Inc. | 14 Dec 2024 | 14 Dec 2024 | 14 Dec 2025 |
| 243 | menya-syo.com | GoDaddy.com, LLC | 15 Apr 2015 | 16 Apr 2025 | 15 Apr 2026 |
| 244 | menyatsukikage.com | GMO Internet Inc. | 16 Apr 2015 | 1 Apr 2025 | 16 Apr 2026 |
| 245 | menyembuhkan.com | Hosting Concepts B.V. dba Openprovider | 17 Apr 2015 | 17 Apr 2024 | 17 Apr 2024 |
| 246 | menya-chikkin.com | GMO Internet Inc. | 20 Apr 2015 | 2 Jul 2024 | 20 Apr 2024 |
| 247 | menyoushouldnotmarry.com | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 248 | menyakeisyou.net | GMO Internet Inc. | 22 Apr 2015 | 24 Mar 2025 | 22 Apr 2026 |
| 249 | menysoul.com | - | - | - | - |
| 250 | meny-smansory.com | GoDaddy.com, LLC | 25 Apr 2015 | 25 Apr 2015 | 25 Apr 2016 |
| 251 | menybernerja.com | - | - | - | - |
| 252 | menys-mansory.com | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 253 | menyewakereta.com | GoDaddy.com, LLC | 30 Apr 2015 | 14 Dec 2024 | 30 Apr 2026 |
| 254 | menyembuhkansakitpinggang.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 May 2015 | 28 Apr 2017 | 1 May 2018 |
| 255 | menyo.net | Ligne Web Services SARL | 22 Nov 2024 | 22 Nov 2024 | 22 Nov 2025 |
| 256 | menyapi.com | Google, Inc. | 5 May 2015 | 25 May 2025 | 5 May 2025 |
| 257 | menyy.com | - | 12 Apr 2025 | 12 Apr 2025 | 12 Apr 2026 |
| 258 | menyembuhkanmigrain.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 May 2015 | 12 May 2017 | 8 May 2018 |
| 259 | menyakatou.com | - | 27 Jul 2021 | 28 Aug 2023 | 27 Jul 2023 |
| 260 | menymart.com | GoDaddy.com, LLC | 8 May 2015 | 9 May 2015 | 8 May 2016 |
| 261 | menya.com | GoDaddy.com, LLC | 11 Aug 2013 | 16 Dec 2024 | 11 Aug 2025 |
| 262 | menyala.info | Limited Liability Company "Registrar of domain nam… | 3 Sep 2022 | 6 Dec 2024 | 3 Sep 2026 |
| 263 | menye888.com | GMO Internet Inc. | 7 Apr 2025 | 7 Apr 2025 | 7 Apr 2026 |
| 264 | menye18.com | Foshan YiDong Network Co., LTD | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 265 | menyak.com | Ä°simtescil BiliÅŸim A.Åž. | 29 Sep 2022 | 5 Feb 2024 | 29 Sep 2033 |
| 266 | menyek.com | NameCheap, Inc. | 25 Feb 2024 | 8 Apr 2025 | 25 Feb 2025 |
| 267 | menya.wang | eName Technology Co., Ltd. | 29 Nov 2016 | 14 Jun 2017 | 29 Nov 2017 |
| 268 | menyuanfengmi.com | HiChina Zhicheng Technology Limited | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 269 | menyakarakara.com | GMO Internet Inc. | 21 Aug 2024 | 21 Aug 2024 | 21 Aug 2025 |
| 270 | menya-kuukan.com | eNom, Inc. | 15 Sep 2015 | 17 Aug 2016 | 15 Sep 2017 |
| 271 | menyesaglik.com | Namesilo, LLC | 2 Jun 2015 | 18 Jul 2017 | 2 Jun 2019 |
| 272 | menya-douraku.com | GMO Internet Inc. | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 273 | menye-sh.com | - | 22 Nov 2024 | 25 Nov 2024 | 22 Nov 2025 |
| 274 | menya-legend.com | PURENIC JAPAN Inc. | 16 Sep 2015 | 20 Jun 2017 | 16 Sep 2018 |
| 275 | menyangrou.com | HiChina Zhicheng Technology Limited | 4 Apr 2020 | 12 May 2023 | 4 Apr 2023 |
| 276 | menyou.org | Tucows Domains Inc. | 18 Dec 2024 | 23 Dec 2024 | 18 Dec 2025 |
| 277 | menyg.com | HiChina Zhicheng Technology Limited | 12 Nov 2018 | 12 Nov 2018 | 12 Nov 2019 |
| 278 | menysports.com | Tucows Domains Inc. | 14 Jun 2015 | 14 Jun 2015 | 14 Jun 2017 |
| 279 | menyfizh.com | Launchpad, Inc. | 17 Jun 2015 | 17 Jun 2017 | 17 Jun 2017 |
| 280 | menyrajetese.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jun 2015 | 20 Jun 2015 | 20 Jun 2016 |
| 281 | menyous.com | GoDaddy.com, LLC | 20 Sep 2015 | 21 Sep 2024 | 20 Sep 2025 |
| 282 | menya-tsubaki.com | GMO Internet Inc. | 21 Jun 2015 | 2 Jul 2017 | 21 Jun 2018 |
| 283 | menyakei.com | GMO Internet Inc. | 22 Jun 2015 | 24 May 2016 | 22 Jun 2017 |
| 284 | menyapa-indonesia.com | Internet Domain Services BS Corp | 19 Apr 2022 | 20 Apr 2025 | 19 Apr 2026 |
| 285 | menyourmarriagematters.com | GoDaddy.com, LLC | 25 Jun 2015 | 26 Jun 2023 | 25 Jun 2028 |
| 286 | menyapa.com | - | 9 Aug 2024 | 23 Aug 2024 | 9 Aug 2025 |
| 287 | menyitianxia.com | GMO Internet Inc. | 27 Mar 2019 | - | 27 Mar 2020 |
| 288 | menyme.com | GoDaddy.com, LLC | 28 May 2020 | 28 May 2020 | 28 May 2021 |
| 289 | menyshaul.com | GoDaddy.com, LLC | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
| 290 | menyasszonyiruha.info | One.com A/S | 29 Jun 2015 | 5 Dec 2024 | 29 Jun 2025 |
| 291 | menyat.com | TurnCommerce, Inc. DBA NameBright.com | 11 Sep 2017 | 21 Oct 2024 | 11 Sep 2024 |
| 292 | menyogapants.com | NameCheap, Inc. | 4 Oct 2023 | 4 Sep 2024 | 4 Oct 2025 |
| 293 | menyexiehui.com | HiChina Zhicheng Technology Limited | 13 Sep 2020 | 13 Sep 2020 | 13 Sep 2021 |
| 294 | menyaono.com | Eranet International Limited | 26 Sep 2022 | 19 Sep 2024 | 26 Sep 2025 |
| 295 | menypanty.com | GoDaddy.com, LLC | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2016 |
| 296 | menypanties.com | GoDaddy.com, LLC | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2016 |
| 297 | menyayu.com | Dynadot, LLC | 27 Dec 2024 | 27 Dec 2024 | 27 Dec 2025 |
| 298 | menybigeye.com | Tucows Domains Inc. | 7 Jul 2014 | 11 Jul 2015 | 7 Jul 2016 |
| 299 | menyasszonyiruhaszalon.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Jul 2015 | 11 Jul 2015 | 11 Jul 2016 |
| 300 | menya-mama.com | GMO Internet Inc. | 10 Jul 2015 | 1 Jul 2017 | 10 Jul 2018 |
| 301 | menya-mama.net | GMO Internet Inc. | 10 Jul 2015 | 1 Jul 2017 | 10 Jul 2018 |
| 302 | menya-mama.info | GMO Internet Inc. | 10 Jul 2015 | 19 Sep 2023 | 10 Jul 2023 |
| 303 | menya-junk.com | GMO Internet Inc. | 21 Jul 2015 | 21 Jun 2017 | 21 Jul 2018 |
| 304 | menyoo.org | GoDaddy.com, LLC | 20 Jul 2015 | 19 Aug 2024 | 20 Jul 2025 |
| 305 | menyascloset.com | register.com, Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 306 | menyapcorlu.com | Google, Inc. | 25 Jul 2015 | 2 Aug 2024 | 25 Jul 2025 |
| 307 | menya.net | - | 27 Feb 2024 | 25 Mar 2025 | 27 Feb 2026 |
| 308 | menydial.net | OVH sas | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2016 |
| 309 | menyapcorlu.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2016 |
| 310 | menyasszonyi-ruha.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 311 | menya-abumi.com | Japan Registry Services Co., Ltd. | 28 Jul 2015 | 15 May 2025 | 28 Jul 2025 |
| 312 | menye.news | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 1 Oct 2015 | 15 Jan 2017 | 1 Oct 2020 |
| 313 | menyunge.com | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 314 | menyamusashi.com | Go France Domains, LLC | 2 Aug 2015 | 3 Aug 2024 | 2 Aug 2025 |
| 315 | menyuanxian.com | Bizcn.com, Inc. | 17 Oct 2017 | 16 Oct 2017 | 17 Oct 2018 |
| 316 | menyonmagz.com | GoDaddy.com, LLC | 5 Dec 2016 | 5 Dec 2016 | 5 Dec 2017 |
| 317 | menyooo.org | Name.com, Inc. | 4 Aug 2015 | 1 Feb 2017 | 4 Aug 2017 |
| 318 | menyooo.net | Name.com, Inc. | 4 Aug 2015 | 12 Jul 2016 | 4 Aug 2017 |
| 319 | menya-ban.com | GMO Internet Inc. | 4 Oct 2015 | 2 Oct 2024 | 4 Oct 2025 |
| 320 | menyaizuhokkawa.xyz | GMO Internet Inc. | 5 Oct 2015 | - | 5 Oct 2016 |
| 321 | menyaba.xyz | GMO Internet Inc. | 5 Oct 2015 | 7 Oct 2015 | 5 Oct 2016 |
| 322 | menyotechcollege.com | eNom, Inc. | 5 Oct 2015 | 6 Sep 2016 | 5 Oct 2017 |
| 323 | menyalka.com | CloudFlare, Inc. | 5 Dec 2024 | 15 Dec 2024 | 5 Dec 2025 |
| 324 | menyun.net | HiChina Zhicheng Technology Limited | 8 Oct 2015 | 6 Sep 2016 | 8 Oct 2017 |
| 325 | menyhartjozsef.com | Key-Systems GmbH | 9 Oct 2015 | 28 Sep 2016 | 9 Oct 2017 |
| 326 | menyuanzx.com | HiChina Zhicheng Technology Limited | 11 Oct 2015 | 11 Oct 2015 | 11 Oct 2016 |
| 327 | menya-yukikaze.com | GMO Internet Inc. | 19 Mar 2020 | 19 Mar 2020 | 19 Mar 2021 |
| 328 | menya-yukikaza.com | GMO Internet Inc. | 11 Oct 2015 | 26 Sep 2016 | 11 Oct 2017 |
| 329 | menye.xin | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 12 Oct 2015 | - | 12 Oct 2016 |
| 330 | menyalka.xyz | Hostinger, UAB | 12 Oct 2015 | 12 Oct 2015 | 12 Oct 2016 |
| 331 | menyuan.site | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Dec 2016 | 30 Dec 2016 | 30 Dec 2017 |
| 332 | menyuan.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Oct 2015 | - | 14 Oct 2016 |
| 333 | menymoons.com | GoDaddy.com, LLC | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 334 | menyembuhkanliver.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Oct 2015 | 17 Oct 2016 | 16 Oct 2017 |
| 335 | menyuan.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 1 Jan 2017 | 2 Jan 2018 | 31 Dec 2017 |
| 336 | menyembuhkandarahrendah.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Oct 2015 | 21 Oct 2016 | 20 Oct 2017 |
| 337 | menyembuhkanjantunglemah.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Oct 2015 | 21 Oct 2016 | 21 Oct 2017 |
| 338 | menyi.net | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 9 Sep 2024 | 9 Sep 2024 | 9 Sep 2025 |
| 339 | menyembuhkanhepatitis.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Oct 2015 | 23 Oct 2017 | 22 Oct 2018 |
| 340 | menyacoiki.com | Key-Systems GmbH | 30 Dec 2020 | 4 Feb 2025 | 30 Dec 2025 |
| 341 | menyembuhkankista.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Oct 2015 | 25 Oct 2016 | 24 Oct 2017 |
| 342 | menyembuhkaninfeksisalurankencing.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Oct 2015 | 25 Oct 2016 | 24 Oct 2017 |
| 343 | menyingkat.biz | Dynadot, LLC | 27 Oct 2015 | 27 Oct 2015 | 26 Oct 2016 |
| 344 | menya-tetsu.com | GMO Internet Inc. | 27 Oct 2015 | 28 Sep 2024 | 27 Oct 2025 |
| 345 | menyingkat.org | Dynadot, LLC | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 346 | menyingkat.net | Dynadot, LLC | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 347 | menyingkat.com | Wild West Domains, LLC | 16 Feb 2021 | 16 Feb 2021 | 16 Feb 2022 |
| 348 | menye.win | Chengdu West Dimension Digital Technology Co., Ltd… | 28 Oct 2015 | 29 Sep 2016 | 27 Oct 2017 |
| 349 | menya-tetsu.net | GMO Internet Inc. | 30 Oct 2015 | 21 Oct 2016 | 30 Oct 2017 |
| 350 | menya-en.info | GMO Internet Inc. | 7 Nov 2013 | 8 Oct 2019 | 7 Nov 2020 |
| 351 | menyw.win | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Oct 2015 | - | 29 Oct 2016 |
| 352 | menyrer.com | Hangzhou Dianshang Internet Technology Co., Ltd | 21 Jun 2019 | 21 Jun 2019 | 21 Jun 2020 |
| 353 | menyou.xyz | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 26 Jan 2023 | 29 Apr 2025 | 26 Jan 2026 |
| 354 | menyong5.com | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 355 | menyasszonyiruha.net | Domain.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 356 | menyu.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Nov 2015 | 5 Nov 2015 | 5 Nov 2016 |
| 357 | menyesal.com | Namesilo, LLC | 25 Feb 2018 | 25 Feb 2018 | 25 Feb 2019 |
| 358 | menya-nanatuboshi.com | eNom, Inc. | 6 Nov 2015 | 23 Oct 2016 | 6 Nov 2017 |
| 359 | menyifan.com | HiChina Zhicheng Technology Limited | 7 Nov 2015 | 23 Sep 2020 | 7 Nov 2026 |
| 360 | menyuan.org | HiChina Zhicheng Technology Limited | 26 Apr 2017 | 26 Jun 2017 | 26 Apr 2018 |
| 361 | menyeastinfection.com | GMO Internet Inc. | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 362 | menyalo24.com | GoDaddy.com, LLC | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2016 |
| 363 | menyeliler.com | Key-Systems GmbH | 16 Dec 2019 | 16 Dec 2019 | 16 Dec 2020 |
| 364 | menyuantong.com | Hangzhou AiMing Network Co., LTD | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2017 |
| 365 | menyuanren.com | Hangzhou AiMing Network Co., LTD | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2017 |
| 366 | menyuanguan.com | Hangzhou AiMing Network Co., LTD | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2017 |
| 367 | menyoo.info | GoDaddy.com, LLC | 20 Nov 2015 | - | 20 Nov 2016 |
| 368 | menye.biz | eName Technology Co., Ltd. | 19 Nov 2015 | 11 Sep 2017 | 18 Nov 2017 |
| 369 | menyoo-app.com | GoDaddy.com, LLC | 6 Oct 2018 | 6 Oct 2018 | 6 Oct 2019 |
| 370 | menyahana88888888.com | GMO Internet Inc. | 20 Nov 2015 | 5 Nov 2016 | 20 Nov 2017 |
| 371 | menyoo.us | GoDaddy.com, LLC | 20 Nov 2015 | 20 Nov 2015 | 19 Nov 2016 |
| 372 | menya-ijambo.org | Domain.com, LLC | 24 Nov 2015 | 9 Dec 2016 | 24 Nov 2017 |
| 373 | menyapanegeriku.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Nov 2015 | 23 Nov 2015 | 23 Nov 2016 |
| 374 | menyusurijalan.com | Namesilo, LLC | 11 Feb 2024 | 25 Mar 2025 | 11 Feb 2026 |
| 375 | menyuan.loan | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Nov 2015 | - | 22 Nov 2016 |
| 376 | menyuan.club | Chengdu West Dimension Digital Technology Co., Ltd… | 28 Mar 2017 | 2 Apr 2017 | 28 Mar 2018 |
| 377 | menya-katsuki.com | GoDaddy.com, LLC | 24 Nov 2015 | 5 Jan 2025 | 24 Nov 2024 |
| 378 | menya-byakko.com | GMO Internet Inc. | 24 Nov 2015 | 9 Nov 2024 | 24 Nov 2025 |
| 379 | menyebang.com | HiChina Zhicheng Technology Limited | 9 Feb 2018 | 9 Feb 2018 | 9 Feb 2019 |
| 380 | menymax.com | GoDaddy.com, LLC | 28 Aug 2019 | 29 Aug 2024 | 28 Aug 2025 |
| 381 | menyie.top | Alpnames Limited | 23 Nov 2015 | 23 Nov 2015 | 23 Nov 2016 |
| 382 | menyi.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Nov 2015 | 30 Nov 2016 | 28 Nov 2017 |
| 383 | menye.club | EJEE Group Holdings Limited | 27 Nov 2015 | 3 Nov 2016 | 26 Nov 2017 |
| 384 | menyewa.com | Web Commerce Communications Limited dba WebNic.cc | 9 May 2024 | 9 May 2024 | 9 May 2026 |
| 385 | menya-sidou.com | Top Pick Names LLC | 27 Aug 2021 | 29 Aug 2021 | 27 Aug 2022 |
| 386 | menyui.org | eNom, Inc. | 27 Nov 2015 | 27 Nov 2015 | 27 Nov 2016 |
| 387 | menyui.net | eNom, Inc. | 27 Nov 2015 | 27 Nov 2015 | 27 Nov 2016 |
| 388 | menyui.com | TurnCommerce, Inc. DBA NameBright.com | 15 Feb 2017 | 9 Feb 2021 | 15 Feb 2026 |
| 389 | menyatu.com | HiChina Zhicheng Technology Limited | 28 Nov 2015 | 30 Mar 2021 | 28 Nov 2025 |
| 390 | menyuan.mobi | West263 International Limited | 30 Nov 2015 | 1 Dec 2015 | 30 Nov 2016 |
| 391 | menyx.com | eNom, Inc. | 23 Mar 2019 | 17 Mar 2025 | 23 Mar 2026 |
| 392 | menyuamhmoob.com | GoDaddy.com, LLC | 15 Mar 2017 | 15 Mar 2017 | 15 Mar 2018 |
| 393 | menyambungnegeri.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Nov 2015 | 30 Nov 2016 | 27 Nov 2017 |
| 394 | menya-kitano.com | Japan Registry Services Co., Ltd. | 27 Nov 2015 | 25 Nov 2024 | 27 Nov 2025 |
| 395 | menyuanshi.com | GoDaddy.com, LLC | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2016 |
| 396 | menya-nishikawa.com | GMO Internet Inc. | 4 Dec 2015 | 4 Nov 2016 | 4 Dec 2017 |
| 397 | menybe.science | Alpnames Limited | 4 Dec 2015 | - | 3 Dec 2016 |
| 398 | menyarn.com | GoDaddy.com, LLC | 4 Dec 2015 | 5 Dec 2024 | 4 Dec 2026 |
| 399 | menya-gochi.com | PSI-USA, Inc. dba Domain Robot | 5 Dec 2015 | 24 Jan 2017 | 5 Dec 2017 |
| 400 | menyweather.com | Alpine Domains Inc. | 8 Dec 2015 | 16 Aug 2024 | 8 Dec 2026 |
| 401 | menyaiwacu.com | Melbourne IT, Ltd | 21 Feb 2017 | 7 Apr 2017 | 21 Feb 2018 |
| 402 | menybeauty.com | OnlineNIC, Inc. | 27 Mar 2018 | 9 May 2018 | 27 Mar 2019 |
| 403 | menywodarhyfel.cymru | Tucows Domains Inc. | 16 Dec 2015 | 16 Nov 2024 | 16 Dec 2025 |
| 404 | menyoy.com | 1&1 Internet AG | 17 Dec 2015 | 1 Mar 2025 | 17 Dec 2024 |
| 405 | menyazc.xyz | NameCheap, Inc. | 20 Dec 2015 | 20 Dec 2015 | 20 Dec 2016 |
| 406 | menyembuhkankeputihan.com | GoDaddy.com, LLC | 18 Mar 2019 | 18 Mar 2019 | 18 Mar 2020 |
| 407 | menyewakan.com | Crazy Domains FZ-LLC | 23 Dec 2015 | 23 Dec 2015 | 23 Dec 2025 |
| 408 | menyala.club | GoDaddy.com, LLC | 27 Jun 2024 | 2 Jul 2024 | 27 Jun 2025 |
| 409 | menyoushouldknow.info | 1&1 Internet AG | 23 Dec 2015 | 23 Dec 2019 | 23 Dec 2020 |
| 410 | menyaaozora.com | GMO Internet Inc. | 7 Jun 2023 | 18 Aug 2024 | 7 Jun 2024 |
| 411 | menya-hijiri.com | GMO Internet Inc. | 28 Dec 2015 | 13 Dec 2016 | 28 Dec 2017 |
| 412 | menyuanbobby.win | Alpnames Limited | 29 Dec 2015 | - | 28 Dec 2016 |
| 413 | menyapamu.com | eNom, Inc. | 28 Dec 2015 | 28 Dec 2015 | 28 Dec 2016 |
| 414 | menyuan.date | Alpnames Limited | 31 Dec 2015 | - | 30 Dec 2016 |
| 415 | menyen.xyz | NameCheap, Inc. | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 416 | menyok.top | Gandi SAS | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 417 | menygiganten.com | Tucows Domains Inc. | 5 Jan 2016 | 9 Jan 2017 | 5 Jan 2017 |
| 418 | menyame.com | GoDaddy.com, LLC | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2018 |
| 419 | menybeer.com | eNom, Inc. | 8 Jan 2016 | 14 Mar 2017 | 8 Jan 2018 |
| 420 | menye.lol | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Jan 2016 | - | 9 Jan 2017 |
| 421 | menyazc.com | GoDaddy.com, LLC | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2017 |
| 422 | menyew.com | GoDaddy.com, LLC | 29 Oct 2024 | 29 Oct 2024 | 29 Oct 2025 |
| 423 | menyuan.red | West263 International Limited | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 424 | menyear.com | Realtime Register B.V. | 29 Oct 2022 | 19 Nov 2023 | 29 Oct 2023 |
| 425 | menyacolorado.com | GoDaddy.com, LLC | 18 Jan 2016 | 3 Oct 2022 | 18 Jan 2027 |
| 426 | menyev.com | HiChina Zhicheng Technology Limited | 20 Jan 2016 | 20 Jan 2016 | 20 Jan 2017 |
| 427 | menyuan.info | West263 International Limited | 7 Apr 2017 | 6 Jun 2017 | 7 Apr 2018 |
| 428 | menya-kuroudo.com | GMO Internet Inc. | 25 Jan 2016 | 26 Dec 2024 | 25 Jan 2026 |
| 429 | menyerahmabro.com | Wild West Domains, LLC | 27 Jan 2016 | 27 Jan 2016 | 27 Jan 2017 |
| 430 | meny-meny.com | Netowl, Inc. | 28 Jan 2016 | 28 Dec 2024 | 28 Jan 2026 |
| 431 | menye.red | West263 International Limited | 29 Jan 2016 | - | 29 Jan 2017 |
| 432 | menykatzir.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Jan 2016 | 21 Jan 2017 | 31 Jan 2019 |
| 433 | menyuan.kim | West263 International Limited | 31 Jan 2016 | - | 31 Jan 2017 |
| 434 | menyentuh.top | Alpnames Limited | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 435 | menyanyi.xyz | GMO Internet Inc. | 6 Jun 2024 | 11 Jun 2024 | 6 Jun 2025 |
| 436 | menymusic.com | GoDaddy.com, LLC | 21 Jul 2023 | 21 Jun 2024 | 21 Jul 2025 |
| 437 | menyer.com | NameKing.com Inc. | 5 Feb 2016 | 3 Feb 2025 | 5 Feb 2026 |
| 438 | menya-bunkei.com | Dropcatching Names LLC | 25 Apr 2024 | 28 Apr 2025 | 25 Apr 2026 |
| 439 | menyuk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Feb 2016 | 7 Feb 2016 | 7 Feb 2017 |
| 440 | menyisheng.com | - | 24 Apr 2022 | 22 Apr 2024 | 24 Apr 2025 |
| 441 | menyatakumidou.com | PSI-USA, Inc. dba Domain Robot | 10 Feb 2016 | 11 Feb 2025 | 10 Feb 2026 |
| 442 | menya-shin.com | 1API GmbH | 17 Jun 2020 | 17 Jun 2020 | 17 Jun 2021 |
| 443 | menyhartter.info | NameCheap, Inc. | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 444 | menya-oto.com | Namesilo, LLC | 29 Sep 2022 | 2 Nov 2023 | 29 Sep 2023 |
| 445 | menyuan.online | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 7 May 2017 | 16 Jun 2017 | 7 May 2018 |
| 446 | menya-yasuji.com | GMO Internet Inc. | 21 Feb 2016 | 22 Feb 2016 | 21 Feb 2019 |
| 447 | menyembuhkantumorpayudara.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Feb 2016 | 16 Feb 2017 | 23 Feb 2018 |
| 448 | menymore.com | Cronon AG | 11 Oct 2019 | 12 Oct 2024 | 11 Oct 2025 |
| 449 | menyland.com | GoDaddy.com, LLC | 27 Feb 2022 | 2 Oct 2022 | 27 Feb 2027 |
| 450 | menyouxo.com | eNom, Inc. | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 451 | menyweb.com | - | 22 Mar 2023 | 24 May 2024 | 22 Mar 2024 |
| 452 | menyakoroku.com | Nordreg AB | 24 Feb 2025 | 25 Apr 2025 | 24 Feb 2026 |
| 453 | menyhart.online | united-domains AG | 18 Feb 2016 | 5 May 2017 | 18 Feb 2018 |
| 454 | menyuhu.com | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 455 | menyoohoo.com | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 456 | menyvids.com | NameCheap, Inc. | 8 Mar 2016 | 18 Dec 2024 | 8 Mar 2026 |
| 457 | menyajingqu.com | DropCatch.com 1200 LLC | 22 May 2018 | 22 May 2018 | 22 May 2019 |
| 458 | menyembuhkanradangsendi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Mar 2016 | 8 Mar 2017 | 9 Mar 2018 |
| 459 | menye.mobi | HiChina Zhicheng Technology Limited | 8 May 2019 | 9 May 2019 | 8 May 2020 |
| 460 | menyes.com | GoDaddy.com, LLC | 12 Aug 2020 | 21 Feb 2025 | 12 Aug 2025 |
| 461 | menyako.com | register.com, Inc. | 11 Mar 2016 | 21 Nov 2016 | 11 Mar 2018 |
| 462 | menya-v-gorode.net | OnlineNIC, Inc. | 14 Mar 2016 | 14 Mar 2016 | 14 Mar 2017 |
| 463 | menyingtianxia.net | Chengdu Fly-Digital Technology Co., Ltd | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 464 | menyun.xin | - | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 465 | menyacorp.com | GoDaddy.com, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 466 | menying.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Jun 2017 | 5 Jul 2017 | 30 Jun 2018 |
| 467 | meny24.com | Binero AB | - | - | - |
| 468 | menya.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Jun 2017 | 5 Jul 2017 | 30 Jun 2018 |
| 469 | menyetong.com | HiChina Zhicheng Technology Limited | 3 Jun 2017 | 11 Sep 2017 | 3 Jun 2019 |
| 470 | menyebao.com | Namesilo, LLC | 22 Oct 2021 | 23 Oct 2021 | 22 Oct 2022 |
| 471 | menya-hikoboshi-shop.com | GoDaddy.com, LLC | 21 Mar 2016 | 21 Mar 2016 | 21 Mar 2017 |
| 472 | menya-toku.com | GMO Internet Inc. | 23 Mar 2016 | 4 May 2025 | 23 Mar 2025 |
| 473 | menyres.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Mar 2016 | 24 Mar 2016 | 24 Mar 2017 |
| 474 | menyaer.net | HiChina Zhicheng Technology Limited | 27 Mar 2016 | 2 Mar 2024 | 27 Mar 2026 |
| 475 | menyaer.com | HiChina Zhicheng Technology Limited | 27 Mar 2016 | 2 Mar 2024 | 27 Mar 2026 |
| 476 | menyy.top | - | 28 Mar 2016 | 28 Mar 2016 | 28 Mar 2017 |
| 477 | menyooapp.com | GoDaddy.com, LLC | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 478 | menyauto.info | Domain.com, LLC | 31 Mar 2016 | - | 31 Mar 2017 |
| 479 | menya-ippo.com | GMO Internet Inc. | 1 Apr 2016 | 3 Mar 2025 | 1 Apr 2026 |
| 480 | menya-hide.com | GMO Internet Inc. | 31 Mar 2016 | 16 Mar 2025 | 31 Mar 2026 |
| 481 | menyexpress.net | Nordreg AB | 3 Apr 2016 | 3 Apr 2016 | 3 Apr 2017 |
| 482 | menyexpress.com | Nordreg AB | 3 Apr 2016 | 3 Apr 2016 | 3 Apr 2017 |
| 483 | menyasakata.com | Netowl, Inc. | 4 Apr 2016 | 19 Feb 2025 | 4 Apr 2026 |
| 484 | menyigou.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Aug 2022 | 28 Mar 2025 | 26 Aug 2025 |
| 485 | menyaginji.com | GMO Internet Inc. | 7 Apr 2016 | 7 Apr 2016 | 7 Apr 2017 |
| 486 | menye.kim | Alpnames Limited | 8 Apr 2016 | 8 Apr 2016 | 8 Apr 2017 |
| 487 | menyuan.xin | - | 10 Apr 2016 | 10 Apr 2016 | 10 Apr 2017 |
| 488 | menytilbud.com | Amazon Registrar, Inc. | 11 Apr 2016 | 7 Mar 2017 | 11 Apr 2018 |
| 489 | menye8.com | Dynadot, LLC | 12 Apr 2016 | 23 May 2024 | 12 Apr 2024 |
| 490 | menyananairo.com | GMO Internet Inc. | 12 Apr 2016 | 28 Jul 2017 | 12 Apr 2018 |
| 491 | menyama.com | EuropeanConnectiononline.com LLC | 25 Nov 2023 | 8 Feb 2025 | 25 Nov 2024 |
| 492 | menyentuh.com | - | 5 Jul 2021 | 6 Sep 2023 | 5 Jul 2023 |
| 493 | menycollection.com | GoDaddy.com, LLC | 14 Apr 2016 | 14 Apr 2016 | 14 Apr 2017 |
| 494 | menyaryuju.com | GoDaddy.com, LLC | 16 Apr 2016 | 9 Apr 2025 | 16 Apr 2026 |
| 495 | menya-aoi.net | GMO Internet Inc. | 16 Apr 2016 | 1 Apr 2017 | 16 Apr 2018 |
| 496 | menyat.top | Alpnames Limited | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 497 | menyegou.com | HiChina Zhicheng Technology Limited | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 498 | menya-kiyota.com | Netowl, Inc. | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 499 | menyawi.info | Network Solutions, LLC | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 500 | menyus.net | NETIM SARL | 5 Feb 2018 | 11 Feb 2025 | 5 Feb 2026 |
| 501 | menyehui.com | HiChina Zhicheng Technology Limited | 19 Apr 2016 | 26 May 2017 | 19 Apr 2018 |
| 502 | menylxqn.xyz | NameCheap, Inc. | 20 Apr 2016 | 23 May 2016 | 20 Apr 2017 |
| 503 | menyus.com | TurnCommerce, Inc. DBA NameBright.com | 8 Jul 2018 | 2 Jul 2020 | 8 Jul 2025 |
| 504 | menyebu.com | HiChina Zhicheng Technology Limited | 21 Apr 2016 | 11 Aug 2017 | 21 Apr 2018 |
| 505 | menyhartplumbing.com | GoDaddy.com, LLC | 31 Mar 2000 | 10 Apr 2025 | 9 Apr 2029 |
| 506 | menyaem-zhizn.com | Eranet International Limited | 1 Oct 2020 | 1 Oct 2020 | 1 Oct 2021 |
| 507 | menyala.net | GoDaddy.com, LLC | 26 Jan 2022 | 26 Jan 2025 | 26 Jan 2026 |
| 508 | menyiwacu.com | Launchpad, Inc. | 12 Aug 2023 | 19 Aug 2024 | 12 Aug 2025 |
| 509 | menyaite.ru | - | - | - | - |
| 510 | menya-blues.com | GMO Internet Inc. | 24 Apr 2016 | 25 Mar 2025 | 24 Apr 2026 |
| 511 | menyunaden.top | Alpnames Limited | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 512 | menyuanhuahai.com | HiChina Zhicheng Technology Limited | 15 Jul 2020 | 15 Jul 2020 | 15 Jul 2021 |
| 513 | menyusui.org | CommuniGal Communication Ltd. | 11 Jul 2017 | 11 Jul 2017 | 11 Jul 2018 |
| 514 | menyappu.com | NameCheap, Inc. | 1 May 2016 | 1 Apr 2025 | 1 May 2026 |
| 515 | menyusu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Dec 2022 | 26 Jan 2024 | 15 Dec 2023 |
| 516 | menyaxia.com | eName Technology Co., Ltd. | 8 May 2016 | 11 May 2017 | 8 May 2018 |
| 517 | menyachaoren.com | eName Technology Co., Ltd. | 8 May 2016 | 11 May 2017 | 8 May 2018 |
| 518 | menyayamahiko.com | Firstserver, Inc. | 8 May 2016 | 8 May 2016 | 8 May 2017 |
| 519 | menya-arie.com | Firstserver, Inc. | 8 May 2016 | 8 May 2016 | 8 May 2017 |
| 520 | menya-kishin.com | Firstserver, Inc. | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 521 | menyepingtai.com | - | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 522 | menyakuroda.com | GMO Internet Inc. | 11 May 2016 | 26 Apr 2017 | 11 May 2018 |
| 523 | menyaissi.com | - | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 524 | menya-darumaya.com | Tucows Domains Inc. | 30 Jun 2020 | 4 Jul 2021 | 30 Jun 2021 |
| 525 | menycnmjr.pink | NameCheap, Inc. | 17 May 2016 | 17 May 2016 | 17 May 2017 |
| 526 | menyuan.men | Alpnames Limited | 13 Jan 2018 | 13 Jan 2018 | 13 Jan 2019 |
| 527 | menyuan.vip | - | 17 May 2016 | 17 May 2016 | 17 May 2017 |
| 528 | menye.vip | GuangDong NaiSiNiKe Information Technology Co Ltd. | 17 May 2016 | 1 Jun 2025 | 17 May 2026 |
| 529 | menya-torinchu.com | GMO Internet Inc. | 24 May 2016 | 27 May 2016 | 24 May 2019 |
| 530 | menyungsruk.xyz | NameCheap, Inc. | 4 May 2016 | 23 May 2016 | 4 May 2017 |
| 531 | menyuan.mom | Chengdu West Dimension Digital Technology Co., Ltd… | 3 May 2016 | 12 May 2017 | 3 May 2017 |
| 532 | menye.mom | Chengdu West Dimension Digital Technology Co., Ltd… | 3 May 2016 | 12 May 2017 | 3 May 2017 |
| 533 | menyupridiabete.top | Alpnames Limited | 23 Apr 2016 | 23 Apr 2016 | 23 Apr 2017 |
| 534 | menyegs.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Jun 2023 | 7 Apr 2025 | 2 Jun 2025 |
| 535 | menyah.com | eNom, Inc. | 24 May 2016 | 24 May 2016 | 24 May 2017 |
| 536 | menya-yoshi.com | Interlakenames.com LLC | 10 Aug 2018 | 11 Aug 2018 | 10 Aug 2019 |
| 537 | menyelam.com | Wix.com Ltd. | 28 Sep 2021 | 29 Aug 2024 | 28 Sep 2027 |
| 538 | menye-wujia.com | Beijing Lanhai Jiye Technology Co., Ltd | 10 Jan 2024 | 28 Mar 2025 | 10 Jan 2026 |
| 539 | menya-uzumaki.com | register.com, Inc. | 26 May 2016 | 26 May 2016 | 26 May 2017 |
| 540 | menya.vip | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Feb 2021 | 27 Feb 2025 | 27 Feb 2026 |
| 541 | menyezhizao.com | Dynadot3 LLC | 22 Jul 2022 | 2 Oct 2023 | 22 Jul 2023 |
| 542 | menye365.com | Beijing Lanhai Jiye Technology Co., Ltd | 31 May 2016 | 6 Apr 2025 | 31 May 2025 |
| 543 | menybyem.com | GoDaddy.com, LLC | 30 May 2016 | 30 May 2016 | 30 May 2018 |
| 544 | menya100shiki.com | Key-Systems GmbH | 20 Aug 2020 | 22 Jan 2025 | 20 Aug 2025 |
| 545 | menya-murokawa.com | eNom, Inc. | 2 Jun 2016 | 28 May 2017 | 2 Jun 2018 |
| 546 | menya.ne | - | - | - | - |
| 547 | menya-akimichi.com | GMO Internet Inc. | 12 Dec 2018 | 13 Dec 2018 | 12 Dec 2019 |
| 548 | menyun.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 1 Aug 2016 | 1 Jun 2017 |
| 549 | menyong.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Jun 2016 | 6 Jun 2016 | 1 Jun 2017 |
| 550 | menying.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Jun 2016 | 6 Jun 2016 | 1 Jun 2017 |
| 551 | menyao.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 1 Aug 2016 | 1 Jun 2017 |
| 552 | menyang.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Jun 2016 | 6 Jun 2016 | 1 Jun 2017 |
| 553 | menyan.xyz | Namesilo, LLC | 19 Jun 2021 | 19 Jun 2021 | 19 Jun 2022 |
| 554 | menyugyudi.xyz | GMO Internet Inc. | 1 Jun 2016 | 6 Jun 2016 | 1 Jun 2017 |
| 555 | menyuflooring.xyz | GMO Internet Inc. | 1 Jun 2016 | 6 Jun 2016 | 1 Jun 2017 |
| 556 | menyubering.xyz | GMO Internet Inc. | 1 Jun 2016 | 6 Jun 2016 | 1 Jun 2017 |
| 557 | menyo.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 1 Aug 2016 | 1 Jun 2017 |
| 558 | menyin.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 1 Aug 2016 | 1 Jun 2017 |
| 559 | menyfieldshane.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 29 Jul 2016 | 1 Jun 2017 |
| 560 | menyfield.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 29 Jul 2016 | 1 Jun 2017 |
| 561 | menyaakinai.com | GMO Internet Inc. | 14 Aug 2023 | 25 Oct 2024 | 14 Aug 2024 |
| 562 | menyol.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Jun 2016 | 29 Jul 2016 | 5 Jun 2017 |
| 563 | menyimpan.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Jun 2016 | - | 5 Jun 2019 |
| 564 | menykitt.com | Key-Systems GmbH | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 565 | menyem.com | - | - | - | - |
| 566 | menyuarakan.com | CV. Jogjacamp | 12 Jun 2016 | 12 Jun 2016 | 12 Jun 2017 |
| 567 | menya-mitsuba.com | GMO Internet Inc. | 31 Aug 2022 | 1 Aug 2024 | 31 Aug 2025 |
| 568 | menyezhijia.com | Global Domain Name Trading Center Ltd | 22 Jul 2021 | 22 Jul 2021 | 22 Jul 2022 |
| 569 | menyiren.com | - | 15 Jun 2016 | 15 Jun 2016 | 15 Jun 2017 |
| 570 | menyagojapaneseramen.com | Above.com Pty Ltd. | 17 Sep 2021 | 28 Oct 2024 | 17 Sep 2024 |
| 571 | menyuanlvu.com | - | 11 Nov 2022 | 13 Dec 2023 | 11 Nov 2023 |
| 572 | menyasnet.net | - | 17 Jun 2016 | 17 Jun 2016 | 17 Jun 2017 |
| 573 | menya-sonoka.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 Sep 2023 | 9 Sep 2024 | 8 Sep 2025 |
| 574 | menya-takei.com | GMO Internet Inc. | 23 Jun 2016 | 24 May 2024 | 23 Jun 2025 |
| 575 | menya-butamaru.com | GMO Internet Inc. | 23 Jun 2016 | 9 Aug 2024 | 23 Jun 2025 |
| 576 | menyou.club | NameCheap, Inc. | 21 Jan 2020 | 21 Jan 2020 | 21 Jan 2021 |
| 577 | menyesha.top | Alpnames Limited | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2017 |
| 578 | menya-kyu.com | GMO Internet Inc. | 25 Jun 2016 | 10 Jun 2024 | 25 Jun 2025 |
| 579 | menye.site | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Jun 2016 | 6 Mar 2018 | 24 Jun 2019 |
| 580 | menye.bid | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Jun 2016 | 19 May 2017 | 23 Jun 2018 |
| 581 | menya-ichou.com | GMO Internet Inc. | 28 Jun 2016 | 13 Jun 2017 | 28 Jun 2018 |
| 582 | menyagou.net | GMO Internet Inc. | 11 Oct 2017 | 5 Apr 2025 | 11 Oct 2025 |
| 583 | menyasszonyiruham.com | OnlineNIC, Inc. | 29 Jun 2016 | 29 Jun 2016 | 29 Jun 2017 |
| 584 | menya-junna.com | GMO Internet Inc. | 6 Jul 2016 | 9 Aug 2024 | 6 Jul 2025 |
| 585 | menyagyochu.xyz | GMO Internet Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 586 | menya-chiaki.com | Firstserver, Inc. | 4 Jul 2016 | 4 Jul 2016 | 4 Jul 2017 |
| 587 | menyasent.xyz | GMO Internet Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 588 | menyimak.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jun 2016 | 8 Aug 2016 | 8 Jun 2017 |
| 589 | menyuangov.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 3 Aug 2016 | 2 Jun 2017 |
| 590 | menyuannews.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 3 Aug 2016 | 2 Jun 2017 |
| 591 | menyetti.science | Namesilo, LLC | 19 Jun 2016 | 19 Jun 2016 | 18 Jun 2017 |
| 592 | menyienrifusccd4080.xyz | NameCheap, Inc. | 21 Jun 2016 | 27 Jun 2016 | 21 Jun 2017 |
| 593 | menyweather.xyz | Uniregistrar Corp | 2 Jun 2016 | 5 Dec 2016 | 2 Jun 2017 |
| 594 | menyieadamic.xyz | NameCheap, Inc. | 16 Jun 2016 | 29 Jul 2016 | 16 Jun 2017 |
| 595 | menyanibi.com | NameCheap, Inc. | 11 Sep 2024 | 11 Sep 2024 | 11 Sep 2025 |
| 596 | menyou.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Oct 2015 | - | 20 Oct 2016 |
| 597 | menyuan.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 22 Aug 2014 | 12 Sep 2017 | 22 Aug 2018 |
| 598 | menyu.wang | eName Technology Co., Ltd. | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 599 | menyuan.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 2 Jun 2016 | 12 Jun 2016 | 2 Jun 2017 |
| 600 | menyuan.biz | eName Technology Co., Ltd. | 5 Jul 2013 | 4 Sep 2017 | 4 Jul 2018 |
| 601 | menya.biz | eNom, Inc. | 4 Nov 2010 | 12 Aug 2024 | 3 Nov 2025 |
| 602 | menyew.biz | Web Commerce Communications Limited dba WebNic.cc | 27 Dec 2013 | 27 Oct 2016 | 26 Dec 2018 |
| 603 | menyasszonyiruha.biz | GoDaddy.com, LLC | 17 Mar 2009 | 17 Mar 2017 | 16 Mar 2018 |
| 604 | menya-iroha.biz | Dynadot, LLC | 3 Oct 2024 | 9 Oct 2024 | 3 Oct 2025 |
| 605 | meny-wise.biz | OVH sas | 18 Dec 2010 | 23 Dec 2017 | 17 Dec 2018 |
| 606 | menysveventin.top | Eranet International Limited | 17 Jul 2016 | 22 Aug 2017 | 22 Aug 2017 |
| 607 | menyakiseki.com | Network Solutions, LLC | 23 Jul 2016 | 10 Jun 2024 | 23 Jul 2025 |
| 608 | menyamiyabi.com | GoDaddy.com, LLC | 24 Jul 2016 | 24 Jul 2024 | 24 Jul 2025 |
| 609 | menyditore.com | NameCheap, Inc. | 9 Jun 2023 | 21 Aug 2024 | 9 Jun 2024 |
| 610 | menya-ren-rin.com | GMO Internet Inc. | 27 Jul 2016 | 16 Jul 2024 | 27 Jul 2025 |
| 611 | menyakou.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Oct 2022 | 21 Apr 2025 | 19 Oct 2025 |
| 612 | menymoney.com | - | 28 Jul 2016 | 28 Jul 2016 | 28 Jul 2017 |
| 613 | menyokgroup.com | CV. Jogjacamp | 28 Jul 2016 | 3 Sep 2017 | 28 Jul 2017 |
| 614 | menya-en.com | Netowl, Inc. | 28 Jul 2016 | 2 Jul 2024 | 28 Jul 2025 |
| 615 | menycreas.com | Internet Domain Services BS Corp | 29 Jul 2016 | 30 Jul 2017 | 29 Jul 2017 |
| 616 | menye.online | Chengdu West Dimension Digital Technology Co., Ltd… | 3 Aug 2016 | 8 Aug 2016 | 3 Aug 2017 |
| 617 | menyahuku.com | - | 1 Aug 2016 | 1 Aug 2016 | 1 Aug 2017 |
| 618 | menyular.com | Hosting Concepts B.V. dba Openprovider | 24 Sep 2020 | 24 Sep 2020 | 24 Sep 2021 |
| 619 | menyges.net | - | 6 Aug 2016 | 6 Aug 2016 | 6 Aug 2017 |
| 620 | menyuklaw.com | DropCatch.com 924 LLC | 24 Aug 2023 | 4 Oct 2024 | 24 Aug 2024 |
| 621 | menyoy.info | Vautron Rechenzentrum AG | 17 Aug 2016 | 17 Aug 2016 | 17 Aug 2017 |
| 622 | menyoy.net | - | 17 Aug 2016 | 17 Aug 2016 | 17 Aug 2017 |
| 623 | menyie.com | Dynadot, LLC | 14 May 2025 | 14 May 2025 | 14 May 2026 |
| 624 | menydoggy.com | DropCatch.com 928 LLC | 12 Nov 2018 | 12 Nov 2018 | 12 Nov 2019 |
| 625 | menyaushio.com | Japan Registry Services Co., Ltd. | 30 Aug 2016 | 29 Sep 2024 | 30 Aug 2024 |
| 626 | menya-ultra.com | GoDaddy.com, LLC | 1 Sep 2016 | 30 Mar 2025 | 1 Sep 2026 |
| 627 | menyaultra.com | GoDaddy.com, LLC | 1 Sep 2016 | 30 Mar 2025 | 1 Sep 2025 |
| 628 | menyam.win | CV. Rumahweb Indonesia | 2 Sep 2016 | 1 Sep 2017 | 1 Sep 2017 |
| 629 | menybqxlqz.win | Alpnames Limited | 2 Sep 2016 | 2 Sep 2017 | 1 Sep 2017 |
| 630 | menyatsubaki.online | Chengdu West Dimension Digital Technology Co., Ltd… | 4 Sep 2016 | 7 Oct 2017 | 4 Sep 2017 |
| 631 | menysaenz.com | - | 7 Sep 2016 | 7 Sep 2016 | 7 Sep 2017 |
| 632 | menyuanweidao.com | - | 9 Sep 2016 | 9 Sep 2016 | 9 Sep 2017 |
| 633 | menyplane.com | - | 8 Sep 2016 | 8 Sep 2016 | 8 Sep 2017 |
| 634 | menyambutpagi.com | Web Commerce Communications Limited dba WebNic.cc | 5 Dec 2021 | 5 Dec 2021 | 5 Dec 2025 |
| 635 | menye1688.com | HiChina Zhicheng Technology Limited | 4 Jun 2018 | 4 Jun 2018 | 4 Jun 2019 |
| 636 | menyeweb.com | - | 10 Sep 2016 | 10 Sep 2016 | 10 Sep 2017 |
| 637 | menyanthesnews.com | eNom, Inc. | 28 Aug 2012 | 31 Aug 2016 | 28 Aug 2016 |
| 638 | menya-kuroko.com | GMO Internet Inc. | 3 Dec 2012 | 24 Nov 2024 | 3 Dec 2025 |
| 639 | menyembuhkanasma.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Feb 2014 | 1 Mar 2017 | 28 Feb 2018 |
| 640 | menyatakao.com | GMO Internet Inc. | 17 Nov 2006 | 22 Feb 2011 | 17 Nov 2016 |
| 641 | menyarau.com | Japan Registry Services Co., Ltd. | 8 Feb 2008 | 6 Feb 2025 | 8 Feb 2026 |
| 642 | menya-zen.com | Japan Registry Services Co., Ltd. | 10 Feb 2011 | 21 Dec 2016 | 10 Feb 2018 |
| 643 | menyechina.com | HiChina Zhicheng Technology Limited | 11 Nov 2011 | 4 Nov 2015 | 11 Nov 2016 |
| 644 | menyges.com | Chipshot Domains LLC | 29 Nov 2023 | 12 Jan 2025 | 29 Nov 2024 |
| 645 | menyangbo.com | GoDaddy.com, LLC | 9 Dec 2024 | 23 Mar 2025 | 9 Dec 2025 |
| 646 | menyns.com | Webfusion Ltd. | 27 Feb 2006 | 28 Feb 2025 | 27 Feb 2026 |
| 647 | menya305.com | GMO Internet Inc. | 15 Sep 2022 | 27 Nov 2023 | 15 Sep 2023 |
| 648 | menyasszonyicsokor.com | DomainDelights LLC | 19 May 2013 | 20 May 2017 | 19 May 2018 |
| 649 | menyasszonyiruhakolcsonzo.com | DotRoll Kft. | 16 Jan 2014 | 13 Jan 2025 | 16 Jan 2026 |
| 650 | menya-kiyomasa.com | GMO Internet Inc. | 13 Nov 2014 | 8 Oct 2015 | 12 Nov 2016 |
| 651 | menya-always.com | Netowl, Inc. | 9 Sep 2009 | 20 Jul 2024 | 9 Sep 2025 |
| 652 | menyouhui.com | HiChina Zhicheng Technology Limited | 23 May 2013 | 23 Aug 2017 | 23 May 2019 |
| 653 | menyc.com | Brandsight, Inc. | 28 Nov 2007 | 29 Oct 2024 | 28 Nov 2025 |
| 654 | menyatiasrealestate.com | GoDaddy.com, LLC | 9 Apr 2013 | 9 Apr 2025 | 9 Apr 2027 |
| 655 | menya-cocoro.com | GMO Internet Inc. | 10 Dec 2013 | 10 Nov 2024 | 10 Dec 2025 |
| 656 | menyone.com | GoDaddy.com, LLC | 10 Apr 2008 | 5 Sep 2022 | 10 Apr 2027 |
| 657 | menyekana.com | Dynadot, LLC | 8 Jul 2019 | 8 Jul 2019 | 8 Jul 2020 |
| 658 | menyebaike.com | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Jul 2013 | 19 Jul 2013 | 19 Jul 2018 |
| 659 | menya-mimi.com | Cosmotown, Inc. | 7 Oct 2022 | 17 Dec 2023 | 7 Oct 2023 |
| 660 | menya-menbous.com | Key-Systems GmbH | 12 Aug 2020 | 12 Aug 2020 | 12 Aug 2021 |
| 661 | menyswatts.com | 1&1 Internet AG | 4 Nov 2013 | 12 Jul 2017 | 4 Nov 2017 |
| 662 | menya-hashimoto.com | GMO Internet Inc. | 10 Dec 2012 | 1 May 2017 | 10 Dec 2018 |
| 663 | menyaoboro.com | Metaregistrar BV Applications | 15 Feb 2025 | 16 Apr 2025 | 15 Feb 2026 |
| 664 | menyembuhkandiabetes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Feb 2013 | 1 Mar 2017 | 22 Feb 2018 |
| 665 | menyevip.com | HiChina Zhicheng Technology Limited | 24 Jan 2013 | 12 May 2017 | 24 Jan 2018 |
| 666 | menyum.com | - | 1 Jun 2024 | 15 May 2025 | 1 Jun 2026 |
| 667 | menyooo.com | DropCatch.com 1254 LLC | 7 Sep 2023 | 8 Sep 2023 | 7 Sep 2025 |
| 668 | menymatch.com | enom433, Incorporated | 24 Jun 2018 | 24 Jun 2018 | 24 Jun 2019 |
| 669 | menysboys.com | EnomToo, Inc. | 25 Dec 2018 | 26 Dec 2018 | 25 Dec 2019 |
| 670 | menyhartrichard.com | PSI-USA, Inc. dba Domain Robot | 2 Jan 2012 | 1 Jan 2025 | 2 Jan 2026 |
| 671 | menya-hidamari.com | Netowl, Inc. | 15 Jun 2022 | 15 Jun 2022 | 15 Jun 2023 |
| 672 | menyuan.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 21 Sep 2004 | 10 Jan 2024 | 21 Sep 2025 |
| 673 | menya-kendama.com | GMO Internet Inc. | 26 Dec 2013 | 9 Dec 2016 | 26 Dec 2017 |
| 674 | menyhoffman.com | Wild West Domains, LLC | 18 Feb 2008 | 11 Feb 2024 | 18 Feb 2026 |
| 675 | menyashimizu.com | Sksa Technology Co., Ltd | 10 May 2025 | 10 May 2025 | 10 May 2026 |
| 676 | menyashou.com | GMO Internet Inc. | 10 Jul 2019 | 25 Jun 2024 | 10 Jul 2025 |
| 677 | menyahanabi.com | Google, Inc. | 22 Sep 2020 | 8 Sep 2024 | 22 Sep 2025 |
| 678 | menycontacts.com | GoDaddy.com, LLC | 25 Apr 2013 | 26 Apr 2016 | 25 Apr 2017 |
| 679 | menya-you.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 28 Jan 2023 | 6 Mar 2024 | 28 Jan 2024 |
| 680 | menyatakumi.com | GoDaddy.com, LLC | 18 Apr 2024 | 18 Apr 2024 | 18 Apr 2025 |
| 681 | menyfaces.com | GoDaddy.com, LLC | 2 Mar 2012 | 28 Apr 2015 | 2 Mar 2017 |
| 682 | menyoshi.com | Japan Registry Services Co., Ltd. | 24 Jul 2008 | 28 May 2024 | 24 Jul 2025 |
| 683 | menyezaixian.com | Beijing Lanhai Jiye Technology Co., Ltd | 30 Jun 2021 | 7 Apr 2025 | 30 Jun 2025 |
| 684 | menya-nosuke.com | eNom, Inc. | 28 Dec 2011 | 4 Oct 2016 | 28 Dec 2016 |
| 685 | menya-norio.com | Japan Registry Services Co., Ltd. | 6 Sep 2011 | 26 Jul 2024 | 6 Sep 2025 |
| 686 | menya-kamikaze.com | GMO Internet Inc. | 16 May 2014 | 17 Apr 2025 | 16 May 2026 |
| 687 | menyoral.com | Dynadot, LLC | 14 Nov 2018 | 14 Nov 2018 | 14 Nov 2019 |
| 688 | menyige.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 Apr 2022 | 14 Apr 2024 | 13 Apr 2025 |
| 689 | menya-hirai.com | GMO Internet Inc. | 24 May 2019 | 25 May 2019 | 24 May 2020 |
| 690 | menya-ichifuku.com | GMO Internet Inc. | 10 Apr 2014 | 12 Mar 2025 | 10 Apr 2026 |
| 691 | menya-sho.com | Netowl, Inc. | 17 Apr 2009 | 19 Feb 2025 | 17 Apr 2026 |
| 692 | menyn.com | Fabulous.com Pty Ltd. | 8 Nov 2000 | 23 Oct 2024 | 8 Nov 2025 |
| 693 | menyga.com | GMO Internet Inc. | 3 Sep 2007 | 19 Aug 2024 | 3 Sep 2025 |
| 694 | menya-tamazou.com | GMO Internet Inc. | 28 Aug 2017 | 28 Aug 2017 | 27 Aug 2018 |
| 695 | menyainoue.com | GMO Internet Inc. | 20 Aug 2011 | 24 Aug 2016 | 20 Aug 2019 |
| 696 | menya-crowd-m.com | Japan Registry Services Co., Ltd. | 4 Nov 2011 | 2 Oct 2017 | 4 Nov 2018 |
| 697 | menyuannews.com | HiChina Zhicheng Technology Limited | 5 Dec 2007 | 15 Nov 2023 | 5 Dec 2025 |
| 698 | menya-shiki.com | GMO Internet Inc. | 22 Dec 2016 | 1 Dec 2017 | 21 Dec 2018 |
| 699 | menyembuhkanbatuginjal.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Feb 2013 | 3 Feb 2017 | 4 Feb 2018 |
| 700 | menyma.com | Register.it SPA | 10 Jan 2010 | 14 Nov 2024 | 24 Nov 2025 |
| 701 | menytavla.com | Binero AB | - | - | - |
| 702 | menyakouji.com | Tucows Domains Inc. | 23 May 2014 | 24 Apr 2025 | 23 May 2026 |
| 703 | menyfenomeny.com | Hosting Ukraine LLC | 31 Jan 2013 | 21 Mar 2024 | 31 Jan 2026 |
| 704 | menyhomesforsale.com | GoDaddy.com, LLC | 9 Apr 2013 | 9 Apr 2025 | 9 Apr 2027 |
| 705 | menya-genbu.com | Hongkong Domain Name Information Management Co., L… | 6 Nov 2021 | 10 Nov 2022 | 6 Nov 2022 |
| 706 | menya-harukichi.com | GMO Internet Inc. | 5 Jul 2013 | 20 Jun 2024 | 5 Jul 2025 |
| 707 | menyled.com | Estrategias WebSite S.L. | 27 Jan 2012 | 24 Jan 2025 | 27 Jan 2026 |
| 708 | menyong.com | eName Technology Co., Ltd. | 11 May 2012 | 31 May 2025 | 11 May 2025 |
| 709 | menya-syoma.com | Japan Registry Services Co., Ltd. | 3 Dec 2013 | 30 Oct 2017 | 3 Dec 2018 |
| 710 | menya-yasuke.com | GMO Internet Inc. | 10 Jul 2017 | 10 Jul 2017 | 9 Jul 2018 |
| 711 | menyagen.com | Key-Systems GmbH | 31 Oct 2019 | 22 Jan 2025 | 31 Oct 2025 |
| 712 | menyclips.com | GoDaddy.com, LLC | 22 Mar 2004 | 2 Mar 2025 | 22 Mar 2026 |
| 713 | menyuliang.com | Hangzhou AiMing Network Co., LTD | 28 Oct 2010 | 18 Oct 2024 | 28 Oct 2025 |
| 714 | menya-benkei.com | GMO Internet Inc. | 23 Jan 2013 | 1 May 2017 | 23 Jan 2019 |
| 715 | menyaltd.com | GoDaddy.com, LLC | 30 Aug 2006 | 31 Aug 2024 | 30 Aug 2025 |
| 716 | menyu-cardloaniroiro.com | Key-Systems GmbH | 26 Jan 2015 | 29 Dec 2015 | 26 Jan 2017 |
| 717 | menynetworks.com | eNom, Inc. | 10 May 2012 | 3 May 2025 | 10 May 2026 |
| 718 | menya-ippachi.com | Japan Registry Services Co., Ltd. | 15 Mar 2011 | 28 Jan 2025 | 15 Mar 2026 |
| 719 | menyi.com | Hefei Juming Network Technology Co., Ltd | 29 Sep 2002 | 18 May 2025 | 29 Sep 2027 |
| 720 | menya-amanojaku.com | Firstserver, Inc. | 15 Feb 2014 | 31 Jan 2025 | 15 Feb 2026 |
| 721 | menyue.com | Hangzhou AiMing Network Co., LTD | 2 Mar 2011 | 13 Feb 2025 | 2 Mar 2026 |
| 722 | menyouth.com | register.com, Inc. | 12 May 2011 | 14 May 2024 | 12 May 2026 |
| 723 | menyourmanagement.com | Tucows Domains Inc. | 5 Feb 2009 | 18 Apr 2023 | 5 Feb 2023 |
| 724 | menyesch.com | 1&1 Internet AG | 3 Aug 2009 | 24 Jan 2024 | 3 Aug 2025 |
| 725 | menyalami.com | PSI-USA, Inc. dba Domain Robot | 6 Nov 2006 | 26 Dec 2024 | 22 Oct 2025 |
| 726 | menyiramspa.com | Network Solutions, LLC | 14 May 2014 | 12 May 2016 | 14 May 2017 |
| 727 | meny-wise.com | OVH sas | 18 Dec 2010 | 17 Dec 2016 | 18 Dec 2017 |
| 728 | menyajiro.com | GMO Internet Inc. | 16 Aug 2012 | 17 Jul 2024 | 16 Aug 2025 |
| 729 | menyamy.com | GoDaddy.com, LLC | 16 Jun 2014 | 17 Jun 2016 | 16 Jun 2017 |
| 730 | meny-bau.com | RegistryGate GmbH | 27 Apr 2001 | 22 Jan 2025 | 27 Apr 2025 |
| 731 | menycep.com | Porkbun, LLC | 14 Jul 2004 | 13 Jul 2024 | 14 Jul 2025 |
| 732 | menya-susuru.com | GoDaddy.com, LLC | 10 Dec 2010 | 20 Jan 2025 | 10 Dec 2024 |
| 733 | menya-kantaro.com | Interlink Co., Ltd. | 26 Sep 2012 | 28 Aug 2013 | 26 Sep 2018 |
| 734 | menyewang.com | - | 9 Feb 2025 | 20 Feb 2025 | 9 Feb 2026 |
| 735 | menyhaymedical.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 29 May 2002 | 29 May 2017 | 29 May 2018 |
| 736 | menyouxi.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Jul 2012 | 20 Jul 2012 | 20 Jul 2018 |
| 737 | menyhart.com | GoDaddy.com, LLC | 28 May 1999 | 5 Sep 2022 | 28 May 2027 |
| 738 | menyembuhkansyarafterjepit.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Feb 2013 | 26 Jan 2017 | 18 Feb 2018 |
| 739 | menyuapp.com | GoDaddy.com, LLC | 28 May 2014 | 5 Apr 2016 | 28 May 2017 |
| 740 | menyaumanosuke.com | GMO Internet Inc. | 14 Apr 2011 | 16 Mar 2017 | 14 Apr 2018 |
| 741 | menyber.com | Mesh Digital Limited | 9 Jan 2003 | 17 Dec 2024 | 9 Jan 2026 |
| 742 | menye360.com | Chengdu Fly-Digital Technology Co., Ltd | 22 May 2014 | 17 Dec 2015 | 22 May 2017 |
| 743 | menyagou.com | GMO Internet Inc. | 27 Feb 2012 | 29 Jan 2025 | 27 Feb 2026 |
| 744 | menysayag.com | GoDaddy.com, LLC | 16 Jul 2013 | 17 Jul 2024 | 16 Jul 2026 |
| 745 | menya-fabric.com | Tucows Domains Inc. | 2 Apr 2007 | 22 Nov 2024 | 2 Apr 2026 |
| 746 | menyquist.com | GoDaddy.com, LLC | 10 Aug 2014 | 3 Aug 2024 | 10 Aug 2025 |
| 747 | menyouart.com | Network Solutions, LLC | 18 Mar 2013 | 15 Mar 2016 | 18 Mar 2017 |
| 748 | meny-pulnoy.com | OVH sas | 27 Sep 2013 | 28 Sep 2024 | 27 Sep 2024 |
| 749 | menya-jikon.com | Dynadot, LLC | 10 Mar 2013 | 19 Apr 2025 | 10 Mar 2025 |
| 750 | menyasan.com | GMO Internet Inc. | 31 Oct 2000 | 16 Oct 2024 | 31 Oct 2025 |
| 751 | menydschn.com | Beijing Lanhai Jiye Technology Co., Ltd | 22 Dec 2021 | 23 Mar 2025 | 22 Dec 2025 |
| 752 | menya-hanaichi.com | GoDaddy.com, LLC | 1 Jul 2013 | 12 Aug 2024 | 1 Jul 2024 |
| 753 | menya-furaibo.com | NameCheap, Inc. | 18 Jun 2022 | 3 Oct 2024 | 18 Jun 2025 |
| 754 | menya-tousuke.com | GMO Internet Inc. | 10 Mar 2012 | 23 Jun 2020 | 10 Mar 2026 |
| 755 | menyhay.com | GoDaddy.com, LLC | 25 Sep 2012 | 26 Sep 2022 | 25 Sep 2027 |
| 756 | menying.com | GoDaddy.com, LLC | 28 Jul 2007 | 18 Jul 2024 | 28 Jul 2025 |
| 757 | menya-mugen.com | GMO Internet Inc. | 21 Jan 2013 | 16 Jan 2025 | 21 Jan 2026 |
| 758 | menydogtraining.com | - | 9 Sep 2024 | 11 Sep 2024 | 9 Sep 2025 |
| 759 | menya-itiri.com | Japan Registry Services Co., Ltd. | 16 Jul 2010 | 31 Jul 2020 | 16 Jul 2020 |
| 760 | menyandchic.com | Arsys Internet, S.L. dba NICLINE.COM | 6 Apr 2020 | 5 Jun 2020 | 6 Apr 2026 |
| 761 | meny-jeremie.com | Gandi SAS | 4 Jan 2012 | 14 Jan 2021 | 4 Jan 2023 |
| 762 | menyu.com | HiChina Zhicheng Technology Limited | 5 Jul 2006 | 5 Jul 2024 | 5 Jul 2025 |
| 763 | menyouping.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 8 Jul 2024 | 8 Jul 2024 | 8 Jul 2027 |
| 764 | menyul.com | Neubox Internet S.A. de C.V. | 22 Jul 2009 | 2 Jun 2016 | 22 Jul 2017 |
| 765 | menya-sora.com | GMO Internet Inc. | 3 Oct 2013 | 19 Sep 2023 | 3 Oct 2025 |
| 766 | menyaitto.com | Network Solutions, LLC | 8 Apr 2014 | 6 Feb 2025 | 8 Apr 2026 |
| 767 | menya-n.com | GMO Internet Inc. | 21 May 2004 | 21 Apr 2025 | 21 May 2026 |
| 768 | menya-inoichi.com | GMO Internet Inc. | 2 Jul 2013 | 17 Jun 2024 | 2 Jul 2025 |
| 769 | menyoucantrust.com | NameCheap, Inc. | 14 Apr 2021 | 15 Mar 2025 | 14 Apr 2026 |
| 770 | menyasolutions.com | GoDaddy.com, LLC | 11 Jul 2006 | 12 Jul 2023 | 11 Jul 2025 |
| 771 | menychtas.com | Papaki Ltd. | 10 Jan 2006 | 28 Apr 2024 | 10 Jan 2028 |
| 772 | menykwickliscamidgefamilypractice.com | GoDaddy.com, LLC | 15 Aug 2012 | 15 Aug 2012 | 15 Aug 2017 |
| 773 | menya-tanakashoten.com | GoDaddy.com, LLC | 16 May 2020 | 20 May 2025 | 16 May 2026 |
| 774 | menya-mokuren.com | Japan Registry Services Co., Ltd. | 25 Feb 2010 | 12 Dec 2024 | 25 Feb 2026 |
| 775 | menyanagomi.com | Beijing Lanhai Jiye Technology Co., Ltd | 18 May 2023 | 20 Jul 2024 | 18 May 2024 |
| 776 | menyaclub.com | Tucows Domains Inc. | 30 Dec 2020 | 30 Dec 2020 | 30 Dec 2021 |
| 777 | menyajp.com | Key-Systems GmbH | 7 Jul 2010 | 9 May 2017 | 7 Jul 2018 |
| 778 | menya-maruchu.com | GoDaddy.com, LLC | 19 Oct 2006 | 2 Dec 2024 | 19 Oct 2025 |
| 779 | menyhartsportsgroup.com | Tucows Domains Inc. | 7 Dec 2011 | 25 Mar 2025 | 7 Dec 2025 |
| 780 | menya-singetu.com | Japan Registry Services Co., Ltd. | 30 Apr 2014 | 26 Feb 2025 | 30 Apr 2026 |
| 781 | menya-garyu.com | Chengdu West Dimension Digital Technology Co., Ltd… | 8 Apr 2019 | 8 Apr 2019 | 8 Apr 2020 |
| 782 | menyserv.com | GoDaddy.com, LLC | 8 Apr 2014 | 18 Mar 2025 | 8 Apr 2026 |
| 783 | menyembuhkanambeien.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Mar 2014 | 2 Mar 2017 | 3 Mar 2018 |
| 784 | menyon-frise.com | GMO Internet Inc. | 30 Sep 2012 | 15 Sep 2024 | 30 Sep 2025 |
| 785 | menyahimawari.com | GMO Internet Inc. | 13 Dec 2013 | 14 Nov 2016 | 13 Dec 2017 |
| 786 | menyingtianxia.com | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Dec 2013 | 18 Dec 2013 | 18 Dec 2018 |
| 787 | meny-laxou.com | OVH sas | 24 Sep 2013 | 25 Sep 2024 | 24 Sep 2024 |
| 788 | menyananexpress.com | GKG.NET, INC. | 15 Oct 2013 | 21 Jan 2023 | 15 Oct 2025 |
| 789 | menyawang.com | HiChina Zhicheng Technology Limited | 6 Aug 2013 | 6 Aug 2013 | 6 Aug 2017 |
| 790 | menyonline.com | GoDaddy.com, LLC | 10 Jul 2022 | 2 Jul 2024 | 10 Jul 2025 |
| 791 | menyoga.com | GoDaddy.com, LLC | 11 Oct 2024 | 11 Oct 2024 | 11 Oct 2025 |
| 792 | menyp.com | TurnCommerce, Inc. DBA NameBright.com | 24 Apr 2022 | 26 May 2024 | 24 Apr 2024 |
| 793 | menya-mujinzou.com | GMO Internet Inc. | 24 Dec 2024 | 10 Jan 2025 | 24 Dec 2025 |
| 794 | menystar.com | eNom, Inc. | 8 Oct 2007 | 8 Oct 2024 | 8 Oct 2025 |
| 795 | menya-saru.com | GMO Internet Inc. | 29 Mar 2011 | 28 Feb 2017 | 29 Mar 2018 |
| 796 | menyamotonari.com | Tucows Domains Inc. | 23 Nov 2006 | 31 Oct 2024 | 23 Nov 2025 |
| 797 | menyotech.com | NameCheap, Inc. | 9 Mar 2013 | 7 Mar 2025 | 9 Mar 2026 |
| 798 | menyun.com | Hangzhou AiMing Network Co., LTD | 13 Apr 2007 | 29 Mar 2025 | 13 Apr 2026 |
| 799 | menynet.com | OVH sas | 21 Nov 2004 | 22 Nov 2024 | 21 Nov 2025 |
| 800 | menyka.com | GoDaddy.com, LLC | 19 Sep 2009 | 1 Sep 2016 | 19 Sep 2017 |
| 801 | menye315.com | Beijing Lanhai Jiye Technology Co., Ltd | 14 Mar 2022 | 16 May 2024 | 14 Mar 2024 |
| 802 | menya-ichinobou.com | GMO Internet Inc. | 13 Nov 2009 | 29 Oct 2024 | 13 Nov 2025 |
| 803 | menyiguan.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Dec 2018 | 20 Dec 2018 | 20 Dec 2019 |
| 804 | menyoo.com | Webfusion Ltd. | 17 Aug 2004 | 17 Aug 2024 | 17 Aug 2026 |
| 805 | menyoungagain.com | eNom, Inc. | 9 Oct 2013 | 10 Sep 2017 | 9 Oct 2018 |
| 806 | menya-arisaka.com | GMO Internet Inc. | 17 Mar 2012 | 2 Mar 2025 | 17 Mar 2026 |
| 807 | menyembuhkanautis.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Apr 2013 | 18 Apr 2017 | 18 Apr 2018 |
| 808 | menyembuhkanhidrokel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Mar 2014 | 13 Mar 2017 | 11 Mar 2018 |
| 809 | menyembuhkanlukadiabetes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Aug 2013 | 9 Aug 2017 | 10 Aug 2018 |
| 810 | menya-imura.com | - | 1 Sep 2024 | 28 Feb 2025 | 1 Sep 2025 |
| 811 | menyatamaki.com | GMO Internet Inc. | 6 Nov 2012 | 1 May 2017 | 6 Nov 2018 |
| 812 | menyanakamaru.com | Netowl, Inc. | 28 Feb 2012 | 15 Dec 2024 | 28 Feb 2026 |
| 813 | menyminymo.com | Crazy Domains FZ-LLC | 21 Apr 2014 | 22 Apr 2025 | 21 Apr 2025 |
| 814 | menyin.com | Hefei Juming Network Technology Co., Ltd | 1 Mar 2012 | 7 May 2025 | 1 Mar 2026 |
| 815 | menyouclinic.com | Whois Networks Co., Ltd. | 15 Feb 2006 | 8 Jan 2024 | 15 Feb 2029 |
| 816 | menysconsum.com | Cronon AG | 29 Oct 2013 | 18 Dec 2024 | 29 Oct 2025 |
| 817 | menyhei.com | Google, Inc. | 16 Jan 2008 | 1 Jan 2025 | 16 Jan 2026 |
| 818 | menyembuhkanaids.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Jun 2013 | 28 Jun 2017 | 26 Jun 2018 |
| 819 | menya-gaga.com | GMO Internet Inc. | 21 May 2013 | 21 Apr 2025 | 21 May 2026 |
| 820 | menyadiningsenbayashi.com | PSI-USA, Inc. dba Domain Robot | 4 Feb 2014 | 20 Apr 2016 | 4 Feb 2017 |
| 821 | menya-usagi.com | GMO Internet Inc. | 3 Sep 2018 | 2 Sep 2024 | 3 Sep 2025 |
| 822 | menygwacon.com | Amazon Registrar, Inc. | 15 Jul 2008 | 10 Jun 2024 | 15 Jul 2025 |
| 823 | menyembuhkanprostat.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jun 2013 | 23 Jun 2017 | 19 Jun 2018 |
| 824 | menyembuhkanbatuempedu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Apr 2013 | 4 Apr 2017 | 15 Apr 2018 |
| 825 | menyashin.com | Beijing Lanhai Jiye Technology Co., Ltd | 1 Jul 2022 | 2 Jul 2023 | 1 Jul 2024 |
| 826 | menya-hachidai.com | GMO Internet Inc. | 28 Feb 2010 | 13 Feb 2025 | 28 Feb 2026 |
| 827 | menya-taketora.com | GMO Internet Inc. | 9 Oct 2022 | 21 Dec 2023 | 9 Oct 2023 |
| 828 | menya-haruhi.com | GMO Internet Inc. | 7 May 2021 | 7 May 2021 | 7 May 2022 |
| 829 | menyang.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Dec 2005 | 2 May 2025 | 9 Dec 2025 |
| 830 | menya-kiwami.com | Tucows Domains Inc. | 29 Mar 2010 | 5 Mar 2025 | 29 Mar 2026 |
| 831 | menyguiden.com | Wild West Domains, LLC | 8 Apr 2014 | 9 Apr 2016 | 8 Apr 2017 |
| 832 | menya315.com | GMO Internet Inc. | 3 Jun 2014 | 4 May 2025 | 3 Jun 2026 |
| 833 | menya-kuu.com | Japan Registry Services Co., Ltd. | 29 Mar 2007 | 28 Jan 2025 | 29 Mar 2026 |
| 834 | menyanzhao.com | ! #1 Host Germany, Inc. | 9 Oct 2020 | 10 Oct 2020 | 9 Oct 2021 |
| 835 | menyouwant.com | DreamHost, LLC | 29 Jul 2001 | 28 Jun 2024 | 29 Jul 2025 |
| 836 | menyasandaime.com | GoDaddy.com, LLC | 26 May 2021 | 7 Aug 2024 | 26 May 2024 |
| 837 | menyard.com | GoDaddy.com, LLC | 30 Jun 2005 | 13 Mar 2025 | 30 Jun 2026 |
| 838 | menydigital.com | Web Commerce Communications Limited dba WebNic.cc | 18 Feb 2012 | 18 Feb 2012 | 18 Feb 2018 |
| 839 | menylees.com | GoDaddy.com, LLC | 21 Sep 2018 | 23 Sep 2024 | 21 Sep 2025 |
| 840 | menya-hoshino.com | GMO Internet Inc. | 9 May 2006 | 10 Apr 2025 | 9 May 2026 |
| 841 | menyon-kyoto.com | GMO Internet Inc. | 26 Feb 2014 | 27 Jan 2017 | 26 Feb 2018 |
| 842 | menya-horino.com | GMO Internet Inc. | 3 Aug 2010 | 5 Aug 2024 | 3 Aug 2029 |
| 843 | menya-goo.com | Japan Registry Services Co., Ltd. | 20 Dec 2013 | 27 Dec 2016 | 20 Dec 2018 |
| 844 | menyembuhkansinusitis.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Feb 2014 | 1 Mar 2017 | 26 Feb 2018 |
| 845 | menyule.com | eName Technology Co., Ltd. | 13 Mar 2008 | 24 May 2024 | 13 Mar 2024 |
| 846 | menya-nagomi.com | GMO Internet Inc. | 13 Jun 2014 | 29 May 2024 | 13 Jun 2025 |
| 847 | menylevy.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Oct 2010 | 15 Jul 2023 | 3 Oct 2025 |
| 848 | menyberwifi.com | Mesh Digital Limited | 31 Dec 2013 | 9 Dec 2015 | 31 Dec 2017 |
| 849 | menyoncp.com | GoDaddy.com, LLC | 12 Oct 2010 | 28 Mar 2024 | 12 Oct 2025 |
| 850 | menya-komond.com | GMO Internet Inc. | 27 May 2012 | 21 Apr 2015 | 27 May 2020 |
| 851 | menyelampulauweh.com | 10dencehispahard, S.L. | 25 Feb 2014 | 2 Mar 2019 | 25 Feb 2020 |
| 852 | menynx.com | OVH sas | 15 Sep 2000 | 16 Sep 2024 | 15 Sep 2025 |
| 853 | menyasakai.com | GoDaddy.com, LLC | 5 Apr 2024 | 17 Apr 2025 | 5 Apr 2026 |
| 854 | menya-marugen.com | eNom, Inc. | 3 Jun 2013 | 4 Jun 2019 | 3 Jun 2019 |
| 855 | menya-amanojyaku.com | GoDaddy.com, LLC | 14 Apr 2021 | 29 Apr 2024 | 14 Apr 2025 |
| 856 | menya33.com | Netowl, Inc. | 3 Dec 2024 | 3 Dec 2024 | 3 Dec 2025 |
| 857 | menyakiryu.com | GMO Internet Inc. | 28 Apr 2014 | 29 Mar 2025 | 28 Apr 2026 |
| 858 | menyasszony.com | TurnCommerce, Inc. DBA NameBright.com | 27 Nov 2012 | 21 Nov 2020 | 27 Nov 2025 |
| 859 | menycas.com | 1&1 Internet AG | 28 Oct 2021 | 28 Oct 2021 | 28 Oct 2025 |
| 860 | menyajikan.com | Dynadot, LLC | 1 Jan 2020 | 1 Jan 2020 | 1 Jan 2021 |
| 861 | menydial.com | GoDaddy.com, LLC | 30 Aug 2010 | 1 Sep 2024 | 30 Aug 2026 |
| 862 | menyards.com | Key-Systems GmbH | 5 Jan 2005 | 8 Aug 2024 | 4 Jul 2025 |
| 863 | menyhertco.com | Dynamic Network Services, Inc. | 4 Feb 2005 | 19 Jul 2017 | 4 Feb 2019 |
| 864 | menyasszonyi-csokor.com | Internet Domain Services BS Corp | 3 Feb 2009 | 22 Jan 2016 | 3 Feb 2017 |
| 865 | menyasszonyiruhaoutlet.com | Cloud Yuqu LLC | 28 Jul 2020 | 28 Jul 2020 | 28 Jul 2021 |
| 866 | menyanthes.com | Dynadot, LLC | 20 Nov 2024 | 20 Nov 2024 | 20 Nov 2025 |
| 867 | menya-miyabi.com | GMO Internet Inc. | 27 Apr 2007 | 21 Mar 2025 | 27 Apr 2026 |
| 868 | menyao.com | Hangzhou AiMing Network Co., LTD | 16 Mar 2012 | 20 Jan 2025 | 16 Mar 2026 |
| 869 | menyza.com | SafeNames Ltd. | 30 Mar 2012 | 31 Mar 2025 | 30 Mar 2026 |
| 870 | menyo.com | TurnCommerce, Inc. DBA NameBright.com | 5 Dec 2010 | 29 Nov 2020 | 5 Dec 2025 |
| 871 | menyums.com | GoDaddy.com, LLC | 29 Oct 2010 | 29 Oct 2024 | 29 Oct 2026 |
| 872 | menyot-webb.com | 1&1 Internet AG | 30 Jan 2010 | 31 Jan 2016 | 30 Jan 2017 |
| 873 | menyse.com | DropCatch.com 546 LLC | 13 Jul 2023 | 25 Oct 2023 | 13 Jul 2025 |
| 874 | menya-ryu.com | Beijing Lanhai Jiye Technology Co., Ltd | 30 Dec 2022 | 1 Apr 2025 | 30 Dec 2025 |
| 875 | menya-hikoboshi.com | Goldmine Domains LLC | 20 Nov 2017 | 20 Nov 2017 | 20 Nov 2018 |
| 876 | menyaoshi.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 24 Jul 2022 | 8 Sep 2023 | 24 Jul 2023 |
| 877 | menye021.com | Bizcn.com, Inc. | 2 Nov 2012 | 15 Jan 2025 | 2 Nov 2025 |
| 878 | menyembuhkanvertigo.com | Xin Net Technology Corporation | 22 Feb 2021 | 27 May 2021 | 22 Feb 2022 |
| 879 | menyaramen.com | GMO Internet Inc. | 1 Jan 2019 | 11 Feb 2025 | 1 Jan 2025 |
| 880 | menyembuhkanhipertensi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Jun 2013 | 28 Jun 2017 | 21 Jun 2018 |
| 881 | menya-hinata.com | GMO Internet Inc. | 30 Apr 2017 | 30 Apr 2017 | 29 Apr 2018 |
| 882 | menyembuhkangondok.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Jul 2014 | 10 Jul 2017 | 10 Jul 2018 |
| 883 | menya-jussen.com | Japan Registry Services Co., Ltd. | 2 Jun 2011 | 31 May 2024 | 2 Jun 2025 |
| 884 | menya-shinmei.com | GMO Internet Inc. | 20 Apr 2011 | 22 Mar 2025 | 20 Apr 2026 |
| 885 | menya-ikkoku.com | GMO Internet Inc. | 8 Jul 2013 | 28 Jun 2017 | 8 Jul 2018 |
| 886 | menya-tenpu.com | GMO Internet Inc. | 28 Jun 2013 | 1 May 2017 | 28 Jun 2020 |
| 887 | menyweatherassociates.com | Wild West Domains, LLC | 31 Jan 2011 | 31 Jan 2016 | 31 Jan 2017 |
| 888 | menyooz.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Jan 2023 | 12 Feb 2025 | 11 Jan 2025 |
| 889 | menyembuhkanstroke.com | Key-Systems GmbH | 7 May 2021 | 7 May 2021 | 7 May 2022 |
| 890 | menya-sou.com | GMO Internet Inc. | 30 Mar 2007 | 15 Mar 2025 | 30 Mar 2026 |
| 891 | menyawolfe.com | Tucows Domains Inc. | 8 Feb 2001 | 7 Feb 2025 | 8 Feb 2026 |
| 892 | menyariku.com | Tucows Domains Inc. | 22 Jun 2008 | 28 May 2017 | 22 Jun 2018 |
| 893 | menyanyi.com | NameKing.com Inc. | 1 Jan 2011 | 11 Feb 2025 | 1 Jan 2026 |
| 894 | menya-ushio.com | GMO Internet Inc. | 31 Jul 2014 | 10 Jul 2024 | 31 Jul 2025 |
| 895 | menyouinterview.com | GoDaddy.com, LLC | 2 Jan 2008 | 2 Jan 2025 | 2 Jan 2026 |
| 896 | menya-shou.com | GMO Internet Inc. | 28 Apr 2022 | 10 Jul 2023 | 28 Apr 2023 |
| 897 | menya589.com | Network Solutions, LLC | 9 Oct 2013 | 7 Oct 2024 | 9 Oct 2025 |
| 898 | menyon.com | GoDaddy.com, LLC | 19 Jul 2009 | 6 Sep 2022 | 23 Dec 2025 |
| 899 | meny-occasions-laxou.com | Gandi SAS | 25 Nov 2013 | 27 Aug 2016 | 25 Nov 2016 |
| 900 | menyikou.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Jun 2017 | 27 Mar 2025 | 5 Jun 2025 |
| 901 | menye66.com | Bizcn.com, Inc. | 8 Apr 2017 | 8 Apr 2017 | 8 Apr 2018 |
| 902 | menya-hishio.com | GMO Internet Inc. | 13 Oct 2017 | 12 Sep 2024 | 12 Oct 2025 |
| 903 | menyawi.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 Dec 2021 | 9 Dec 2023 | 8 Dec 2024 |
| 904 | menya-bar-uzu.com | Hawthornedomains.com LLC | 6 Sep 2022 | 8 Mar 2025 | 6 Sep 2025 |
| 905 | menya634.com | GMO Internet Inc. | 14 Sep 2011 | 26 Oct 2017 | 14 Sep 2017 |
| 906 | menya-uchoten.com | Nakazawa Trading Co., Ltd. | 17 Apr 2017 | 30 Jun 2024 | 17 Apr 2024 |
| 907 | menyaissei.com | GMO Internet Inc. | 16 Jan 2014 | 19 Dec 2016 | 16 Jan 2018 |
| 908 | menyembuhkanasamurat.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jul 2013 | 3 Jul 2017 | 2 Jul 2018 |
| 909 | menyo.us | - | 11 Sep 2016 | 11 Sep 2016 | 10 Sep 2017 |
| 910 | menyaryukichi.com | eNom, Inc. | 23 Dec 2020 | 5 Mar 2024 | 23 Dec 2023 |
| 911 | menyaa.xyz | GMO Internet Inc. | 19 Sep 2016 | 24 Sep 2016 | 19 Sep 2017 |
| 912 | menyoung.com | TurnCommerce, Inc. DBA NameBright.com | 4 Dec 2017 | 28 Nov 2020 | 4 Dec 2025 |
| 913 | menyuan.xyz | - | 30 Jul 2024 | 20 Aug 2024 | 30 Jul 2025 |
| 914 | menya-sho.net | NameCheap, Inc. | 11 Sep 2024 | 11 Sep 2024 | 11 Sep 2025 |
| 915 | menyon.review | CV. Rumahweb Indonesia | 24 Sep 2016 | 23 Sep 2017 | 23 Sep 2017 |
| 916 | menyei.com | - | 26 Sep 2016 | 26 Sep 2016 | 26 Sep 2017 |
| 917 | menya.love | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Sep 2016 | 19 Oct 2018 | 27 Sep 2019 |
| 918 | menya.live | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Sep 2016 | 10 Sep 2024 | 27 Sep 2025 |
| 919 | menyasszonyiruhak.info | Dynadot, LLC | 21 Jan 2025 | 18 Feb 2025 | 21 Jan 2026 |
| 920 | menyirap.com | Hefei Juming Network Technology Co., Ltd | 22 Dec 2023 | 27 Nov 2024 | 22 Dec 2025 |
| 921 | menyou.xn--tckwe | GMO Internet Inc. | 5 Oct 2016 | 15 Nov 2017 | 5 Oct 2017 |
| 922 | menye.tel | Eranet International Limited | 24 Oct 2019 | 29 Oct 2019 | 24 Oct 2020 |
| 923 | menyetubuhi.com | West263 International Limited | 7 Oct 2016 | 7 Oct 2016 | 7 Oct 2017 |
| 924 | menyanoodle.com | FastDomain Inc. | 9 Oct 2016 | 24 Sep 2024 | 9 Oct 2025 |
| 925 | menyasszonyicsokor.info | EuroDNS S.A. | 24 Jan 2012 | 19 Feb 2020 | 24 Jan 2021 |
| 926 | menyhart.info | Secura GmbH | 3 Dec 2008 | 6 May 2025 | 3 Dec 2025 |
| 927 | menyasszony.info | Dynadot, LLC | 5 Apr 2023 | 5 Apr 2024 | 5 Apr 2025 |
| 928 | menya-souun.info | GMO Internet Inc. | 3 Aug 2014 | 17 Sep 2024 | 3 Aug 2025 |
| 929 | menyusui.info | PT Ardh Global Indonesia | 14 Feb 2012 | 26 Mar 2025 | 14 Feb 2025 |
| 930 | menyagenpuku.info | GMO Internet Inc. | 6 Jan 2011 | 21 Dec 2016 | 6 Jan 2018 |
| 931 | menya.info | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 23 May 2024 | 23 May 2025 | 23 May 2026 |
| 932 | meny-wise.info | OVH sas | 18 Dec 2010 | 17 Dec 2016 | 18 Dec 2017 |
| 933 | menyoos.info | DreamHost, LLC | 15 Apr 2015 | 23 Oct 2017 | 15 Apr 2019 |
| 934 | menyanakagawakai.info | GMO Internet Inc. | 15 Jun 2011 | 20 Mar 2023 | 15 Jun 2026 |
| 935 | menyber.info | GoDaddy.com, LLC | 21 May 2012 | 22 May 2025 | 21 May 2026 |
| 936 | menyanakamaru.mobi | GMO Internet Inc. | 24 May 2012 | 5 Jul 2020 | 24 May 2021 |
| 937 | menya-zen.mobi | GMO Internet Inc. | 28 Sep 2010 | 29 Aug 2019 | 28 Sep 2020 |
| 938 | menyafujiyoshi.mobi | GMO Internet Inc. | 27 Sep 2010 | 28 Aug 2017 | 27 Sep 2018 |
| 939 | menyin.net | HiChina Zhicheng Technology Limited | 9 Jul 2019 | 10 Jul 2024 | 9 Jul 2025 |
| 940 | menyao.net | - | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 941 | menya-tyt.net | - | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 942 | menying.net | - | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 943 | menyan.net | - | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 944 | menyecn.net | HiChina Zhicheng Technology Limited | 11 Nov 2011 | 4 Nov 2015 | 11 Nov 2016 |
| 945 | menyasszonyi-ruha.net | eNom, Inc. | 2 Aug 2011 | 28 Jul 2016 | 2 Aug 2017 |
| 946 | menyuan.net | Hangzhou AiMing Network Co., LTD | 6 Aug 2006 | 12 May 2025 | 6 Aug 2026 |
| 947 | menyew.net | Beijing Innovative Linkage Technology Ltd. dba dns… | 27 Dec 2013 | 9 Jun 2017 | 27 Dec 2018 |
| 948 | menykaffe.net | Key-Systems GmbH | 23 Oct 2008 | 22 Jan 2025 | 23 Oct 2026 |
| 949 | menya-marugen.net | Japan Registry Services Co., Ltd. | 23 May 2013 | 30 Mar 2016 | 23 May 2017 |
| 950 | meny-wise.net | OVH sas | 18 Dec 2010 | 17 Dec 2016 | 18 Dec 2017 |
| 951 | menyoos.net | DreamHost, LLC | 15 Apr 2015 | 23 Aug 2017 | 15 Apr 2019 |
| 952 | menyhart.net | NameCheap, Inc. | 10 May 2000 | 7 May 2025 | 10 May 2026 |
| 953 | menyoo.net | Webfusion Ltd. | 17 Aug 2004 | 17 Aug 2024 | 17 Aug 2026 |
| 954 | menyber.net | Mesh Digital Limited | 21 May 2012 | 2 May 2017 | 21 May 2018 |
| 955 | menyatakumi.net | Key-Systems GmbH | 8 Sep 2008 | 19 Aug 2013 | 8 Sep 2022 |
| 956 | menyasszony.net | GoDaddy.com, LLC | 12 Aug 2009 | 13 Aug 2016 | 12 Aug 2017 |
| 957 | menyewang.net | eName Technology Co., Ltd. | 6 Oct 2012 | 13 Oct 2024 | 6 Oct 2025 |
| 958 | menyanyi.net | GMO Internet Inc. | 31 Aug 2012 | 20 Oct 2017 | 31 Aug 2018 |
| 959 | menye.net | eName Technology Co., Ltd. | 18 Feb 2006 | 21 Jan 2025 | 18 Feb 2026 |
| 960 | menyembuhkankeputihan.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Jun 2014 | 27 May 2017 | 3 Jun 2018 |
| 961 | menyikou.net | PSI-USA, Inc. dba Domain Robot | 28 Apr 2021 | 28 Apr 2021 | 28 Apr 2022 |
| 962 | menyakokoro.net | GMO Internet Inc. | 28 May 2013 | 29 Apr 2025 | 28 May 2026 |
| 963 | menyusui.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Apr 2009 | 11 Mar 2017 | 14 Apr 2018 |
| 964 | menya-genbu.net | Japan Registry Services Co., Ltd. | 24 Apr 2013 | 28 Feb 2017 | 24 Apr 2018 |
| 965 | menyechina.net | HiChina Zhicheng Technology Limited | 11 Nov 2011 | 4 Nov 2015 | 11 Nov 2016 |
| 966 | menydialecuador.com | Acens Technologies, S.L.U. | 19 Oct 2016 | 9 Oct 2017 | 19 Oct 2018 |
| 967 | menyaenishi.com | GMO Internet Inc. | 20 Oct 2016 | 24 Apr 2017 | 20 Oct 2020 |
| 968 | menya-enishi.com | Japan Registry Services Co., Ltd. | 14 May 2021 | 14 Jul 2023 | 14 May 2023 |
| 969 | menyehatkan.info | NameCheap, Inc. | 7 Jan 2018 | 7 Jan 2018 | 7 Jan 2019 |
| 970 | menykaffe.org | Key-Systems GmbH | 23 Oct 2008 | 16 Jan 2025 | 23 Oct 2026 |
| 971 | menyewang.org | Jiangsu Bangning Science and technology Co. Ltd. | 16 Jul 2013 | 3 Aug 2017 | 16 Jul 2018 |
| 972 | meny-wise.org | OVH sas | 18 Dec 2010 | 18 Dec 2016 | 18 Dec 2017 |
| 973 | menysgraus.org | Estrategias WebSite S.L. | 22 Apr 2011 | 9 Dec 2021 | 22 Apr 2027 |
| 974 | menyber.org | Mesh Digital Limited | 21 May 2012 | 2 May 2017 | 21 May 2018 |
| 975 | menyasszonyiruhak.org | NETIM SARL | 9 Sep 2011 | 8 Sep 2024 | 9 Sep 2025 |
| 976 | menythings.org | Gransy s.r.o. d/b/a subreg.cz | 16 Nov 2005 | 8 Nov 2017 | 16 Nov 2018 |
| 977 | menyoos.org | DreamHost, LLC | 15 Apr 2015 | 24 Oct 2017 | 15 Apr 2019 |
| 978 | menya.org | Tucows Domains Inc. | 11 Nov 2003 | 26 Dec 2024 | 11 Nov 2025 |
| 979 | menya-media.org | OVH sas | 26 Jan 2007 | 22 Dec 2016 | 26 Jan 2019 |
| 980 | menyuwvyg.org | - | 14 Dec 2010 | 30 Nov 2017 | 14 Dec 2017 |
| 981 | menye.org | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 4 Dec 2006 | 13 Nov 2024 | 4 Dec 2025 |
| 982 | menyuanbj.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 983 | menyuanhb.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 984 | menyajikan.xyz | OnlineNIC, Inc. | 2 Jun 2016 | 29 Jul 2016 | 2 Jun 2017 |
| 985 | menyuansc.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 986 | menyembuhkanpenyakitkeputihanpadawanita.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 987 | menyembuhkankeputihan.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 988 | menyuannx.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 989 | menyengs.xyz | NameCheap, Inc. | 1 Jun 2016 | 27 Jun 2016 | 1 Jun 2017 |
| 990 | menyembuhkankeputihansecaraalami.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 991 | menyuannmg.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 992 | menyuangx.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 993 | menyuansh.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 994 | menyfield38.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 29 Jul 2016 | 1 Jun 2017 |
| 995 | menyegarkan.xyz | GMO Internet Inc. | 25 Nov 2024 | 30 Nov 2024 | 25 Nov 2025 |
| 996 | menyacavalryman.xyz | GMO Internet Inc. | 2 Jun 2016 | 7 Jun 2016 | 2 Jun 2017 |
| 997 | menyuantw.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 998 | menyuantj.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 999 | menyue.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 1 Aug 2016 | 2 Jun 2017 |
| 1000 | menyuanqh.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
Displaying 1,000 out of 4,772 domains starting with the keyword "MENY". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=meny
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |