Our database now contains whois records of 618 Million (618,035,155) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1576 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [618 Million Domains] $10,000 Details

Keyword: MAJLIS

Reverse Whois » KEYWORD [majlis ]  { 890 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1majlis.irReserved for ICANN's Registry SLA Monitoring Syste…-12 Aug 201418 Dec 2016
2majlis.infoNameCheap, Inc.7 May 20247 May 20257 May 2026
3majlis.tatarLimited Liability Company "Registrar of domain nam…23 Mar 201523 May 201723 Mar 2018
4majlis.partyAlpnames Limited6 May 20156 May 20175 May 2017
5majlis.xyzDynadot, LLC5 Aug 202413 Sep 20245 Aug 2025
6majlis.newsGoDaddy.com, LLC18 Sep 20192 Nov 202418 Sep 2025
7majlis.restaurantPDR Ltd. d/b/a PublicDomainRegistry.com4 Feb 20164 Feb 20164 Feb 2017
8majlis.biz-2 Dec 20247 Dec 20242 Dec 2025
9majlis.comGoDaddy.com, LLC6 Aug 19985 Aug 20245 Aug 2025
10majlis.vip-24 Mar 202524 Mar 202524 Mar 2026
11majlis.usUniregistrar Corp5 Oct 201622 Feb 20174 Oct 2017
12majlis.netGoDaddy.com, LLC6 Aug 19985 Aug 20245 Aug 2025
13majlis.orgNamesilo, LLC25 Jan 199923 Jan 202525 Jan 2026
14majlis.ca-28 Dec 20113 Jun 201628 Dec 2016
15majlis.org.uk-20 Apr 201319 Apr 202520 Apr 2026
16majlis.cloudNameCheap, Inc.8 Dec 201613 Nov 20248 Dec 2025
17majlis.co.uk-21 Jul 200021 Jun 202421 Jul 2025
18majlis.networkGoDaddy.com, LLC26 Nov 20241 Dec 202426 Nov 2025
19majlis.services1API GmbH30 Jul 201730 Jul 201730 Jul 2018
20majlis.onlineCommuniGal Communication Ltd.21 Apr 202422 Apr 202521 Apr 2026
21majlis.siteHostinger, UAB16 Jan 202521 Jan 202516 Jan 2026
22majlis.liveCommuniGal Communication Ltd.5 Dec 202410 Dec 20245 Dec 2025
23majlis.uk-8 Oct 202416 Nov 20248 Oct 2025
24majlis.techGoDaddy.com, LLC18 Jul 202429 Aug 202418 Jul 2025
25majlis.homesGoDaddy.com, LLC27 Mar 202026 May 202027 Mar 2021
26majlis.globalNameCheap, Inc.11 Mar 202516 Mar 202511 Mar 2026
27majlis.worldGoDaddy.com, LLC1 Sep 20246 Sep 20241 Sep 2025
28majlis.digitalName.com, Inc.21 Apr 202122 Apr 202521 Apr 2026
29majlis.proNameCheap, Inc.23 Apr 202523 Apr 202523 Apr 2026
30majlis.tradeGoDaddy.com, LLC21 Apr 20222 Jun 202321 Apr 2023
31majlis.clubGoDaddy.com, LLC2 May 202213 Jun 20242 May 2024
32majlis.designeNom, Inc.11 Apr 202418 Apr 202511 Apr 2026
33majlis.ma-5 Mar 20212 Mar 20225 Mar 2023
34majlis.uzTLDOMAINS Inc.14 Aug 201720 Jun 202215 Aug 2032
35majlis.ai----
36majlis.ae----
37majlis.media-16 Mar 20258 May 202516 Mar 2026
38majlis.mu-21 Feb 201811 Feb 202221 Feb 2023
39majlis.app101domain, Inc.7 Dec 201921 Jan 20257 Dec 2025
40majlis.cafePorkbun, LLC6 Oct 202220 Nov 20246 Oct 2025
41majlis.org.inGoDaddy.com, LLC10 Mar 201814 Feb 202510 Mar 2027
42majlis.devGoDaddy.com, LLC2 Jan 20257 Jan 20252 Jan 2026
43majlis.topCSL Computer Service Langenbach GmbH d/b/a joker.c…16 Apr 202319 Apr 202416 Apr 2025
44majlis.shopNameCheap, Inc.11 May 202322 Jul 202411 May 2024
45majlis.bioNameCheap, Inc.16 May 202327 Jun 202416 May 2024
46majlis.coffeeGoogle, Inc.26 May 202310 Jul 202426 May 2025
47majlis.storeDomain.com, LLC23 Oct 202313 Oct 202423 Oct 2025
48majlis.ovhOVH sas26 Nov 202310 Jan 202526 Nov 2025
49majlis.co.inGoDaddy.com, LLC31 Aug 20235 Sep 202331 Aug 2026
50majlis.coGoDaddy.com, LLC27 May 20233 Aug 202427 May 2025
51majlis.nl-24 Nov 200431 Mar 2022-
52majlis.ru-3 Mar 2017-3 Mar 2026
53majlis.de--16 Jan 2022-
54majlis.dk-7 Feb 2005-28 Feb 2026
55majlis.agency1&1 Internet AG19 May 202424 May 202419 May 2025
56majlis.technologyGoDaddy.com, LLC18 Jul 202423 Jul 202418 Jul 2025
57majlis.incGoDaddy.com, LLC18 Jul 202429 Aug 202418 Jul 2025
58majlis.schoolNameCheap, Inc.28 Jul 20244 Aug 202428 Jul 2025
59majlis.supportNETIM SARL2 Aug 202418 Mar 20252 Aug 2025
60majlis.blogAutomattic Inc.24 Aug 202410 Sep 202424 Aug 2025
61majlis.om----
62majlis.fyiPorkbun, LLC5 Oct 202410 Oct 20245 Oct 2025
63majlis.onePorkbun, LLC5 Oct 202410 Oct 20245 Oct 2025
64majlis.businessHostinger, UAB25 Oct 202430 Oct 202425 Oct 2027
65majlis.se-24 Apr 201825 Apr 202524 Apr 2026
66majlis.fundGoDaddy.com, LLC26 Dec 202431 Dec 202426 Dec 2025
67majlisasmanabawi.netDropCatch.com 1079 LLC11 May 202322 Jul 202411 May 2024
68majlisfiqih.tk----
69majlisfest.comTurnCommerce, Inc. DBA NameBright.com17 Jan 201826 Feb 202517 Jan 2025
70majliselections.comGoDaddy.com, LLC31 Mar 200911 Apr 202431 Mar 2025
71majlissangbad.comCV. Jogjacamp29 Oct 201429 Oct 201429 Oct 2015
72majlisalarabi.netGoDaddy.com, LLC4 Nov 200717 Apr 20154 Nov 2015
73majlisalarabi.orgGoDaddy.com, LLC4 Nov 200727 Nov 20164 Nov 2017
74majlisgallery.comTurnCommerce, Inc. DBA NameBright.com4 Nov 201514 Dec 20244 Nov 2024
75majlisdaraakw.comGoDaddy.com, LLC10 Jun 201311 Jun 201510 Jun 2016
76majliscom.comGoDaddy.com, LLC3 Nov 20143 Nov 20143 Nov 2015
77majlisulmuhammadiyya.comGoDaddy.com, LLC12 Jun 201413 Jun 201512 Jun 2016
78majlisgrandmercure-auh.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Aug 201411 Aug 201618 Aug 2017
79majliskebudayaanbesut.comPT Ardh Global Indonesia19 Aug 201419 Aug 201419 Aug 2015
80majlis-fikr-e-wasif.comOnlineNIC, Inc.19 Aug 201419 Aug 201419 Aug 2015
81majlisfoods.com1API GmbH6 Mar 20256 Mar 20256 Mar 2026
82majlis313.orgPDR Ltd. d/b/a PublicDomainRegistry.com14 Apr 201514 Apr 201514 Apr 2016
83majlisomanhma.comGoDaddy.com, LLC11 Sep 201411 Sep 201411 Sep 2015
84majlisevents.comGoDaddy.com, LLC13 Nov 201413 Nov 201413 Nov 2016
85majlislocator.comTucows Domains Inc.12 Sep 201414 Aug 202412 Sep 2025
86majlislocator.orgTucows Domains Inc.12 Sep 201419 Aug 202412 Sep 2025
87majlismashhoor.comGoDaddy.com, LLC1 Sep 20141 Sep 20141 Sep 2015
88majlistv.comGoDaddy.com, LLC20 Sep 201420 Sep 201420 Sep 2015
89majlisna.comGoDaddy.com, LLC1 Oct 20142 Oct 20221 Oct 2027
90majlisrasulullah.comTucows Domains Inc.31 Dec 201531 Dec 201531 Dec 2016
91majlisna.netGoDaddy.com, LLC1 Oct 20142 Oct 20231 Oct 2025
92majlisproperties.comGoDaddy.com, LLC4 May 20165 May 20254 May 2026
93majlisasmanabawi.com-9 Dec 20245 Apr 20259 Dec 2025
94majlisinternational.comNameCheap, Inc.23 Dec 20216 Dec 202423 Dec 2025
95majlishrestaurant.comGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
96majlisilmudammam.comregister.com, Inc.29 Nov 201429 Nov 201429 Nov 2015
97majlislaw.orgeNom, Inc.2 Dec 20142 Dec 20142 Dec 2015
98majlisilmifes.comOVH sas2 Dec 20115 Dec 20142 Dec 2015
99majlisilimifes.comOVH sas1 Dec 20115 Dec 20141 Dec 2015
100majlisedu.comTucows Domains Inc.15 Jan 201119 Jan 201515 Jan 2016
101majlis-iq.orgGMO Internet Inc.26 Jan 201526 Jan 201526 Jan 2016
102majlissefrou.comTLD Registrar Solutions Ltd.19 Feb 201519 Feb 201519 Feb 2016
103majlisrafaheammah.orgOnlineNIC, Inc.21 Feb 2015-21 Feb 2016
104majlisplanner.comIP Mirror Pte Ltd dba IP MIRROR27 Feb 201527 Feb 201527 Feb 2016
105majlisnews.comHosting Concepts B.V. dba Openprovider2 May 20212 May 20212 May 2022
106majlis-iq.comHiChina Zhicheng Technology Limited19 Apr 201819 Apr 201819 Apr 2019
107majlissidibennour.netGoDaddy.com, LLC12 Mar 201524 May 202412 Mar 2024
108majlisaam.comTucows Domains Inc.22 Mar 201426 Mar 201522 Mar 2016
109majliskami.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Mar 201531 Mar 201531 Mar 2016
110majliskahwin.comWeb Commerce Communications Limited dba WebNic.cc7 Apr 20257 Apr 20257 Apr 2026
111majlis10.comGoDaddy.com, LLC1 Apr 20151 Apr 20151 Apr 2016
112majliss-edara1-ul.comGoDaddy.com, LLC2 Apr 20152 Apr 20152 Apr 2016
113majlisny.orgGoDaddy.com, LLC21 Oct 20235 Dec 202421 Oct 2025
114majliss-sidislimane.comGenious Communications SARL/AU1 Sep 20151 Sep 20151 Sep 2016
115majliscafe.comDynadot, LLC24 Sep 202420 Feb 202524 Sep 2025
116majlistalim.comHosting Concepts B.V. dba Openprovider29 Dec 202310 Mar 202529 Dec 2024
117majlisinteriors.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
118majlisinterior.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
119majlisezikrofikr.comNamesilo, LLC4 Sep 201525 Sep 20174 Sep 2018
120majlisrestaurant.comGoDaddy.com, LLC25 Mar 202225 Mar 202425 Mar 2026
121majlis94.comRealtime Register B.V.4 May 20154 May 20154 May 2016
122majlispress.comTLDs LLC dba SRSplus8 May 20158 May 20158 May 2016
123majlispress.infoTLDs LLC dba SRSplus8 May 20158 May 20158 May 2016
124majlislib.comDropCatch.com 875 LLC14 Nov 202211 Apr 202514 Nov 2025
125majlisveteran.orgTucows Domains Inc.10 May 201214 May 201510 May 2016
126majlisulquran.comGoDaddy.com, LLC18 May 201518 May 201518 May 2020
127majlishameediyyah.comGoDaddy.com, LLC22 May 201522 May 201522 May 2016
128majlis-e-taraqqi-e-adab.comGoDaddy.com, LLC28 May 201528 May 201528 May 2016
129majlismeknes.comName.com, Inc.19 Apr 20149 Apr 202519 Apr 2026
130majlisalfareej.com-13 Jun 202215 Aug 202313 Jun 2023
131majliswater.comGoDaddy.com, LLC17 Sep 201519 Sep 202217 Sep 2025
132majlishardware.comNom Infinitum, Incorporated3 Jun 202317 Aug 20243 Jun 2024
133majlistream.comGoDaddy.com, LLC26 Jun 201526 Jun 201526 Jun 2020
134majlistvindia.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Jul 20152 Jul 20152 Jul 2016
135majlisemughal.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Sep 201528 Sep 201626 Sep 2017
136majlis-baiturrohim.orgeNom, Inc.12 Jul 201512 Jul 201512 Jul 2016
137majlisanakshaleh.com-27 Sep 201227 Sep 201227 Sep 2017
138majlis-mc.comTLD Registrar Solutions Ltd.28 Sep 201528 Sep 201528 Sep 2016
139majliscafe.infoGoDaddy.com, LLC21 Jul 201521 Jul 201721 Jul 2018
140majliscafe.orgGoDaddy.com, LLC21 Jul 201522 Jul 201721 Jul 2018
141majliscafe.netAutomattic Inc.3 Aug 20193 Aug 20193 Aug 2020
142majlisandersen.comOne.com A/S1 Oct 20153 Sep 20241 Oct 2025
143majliselnwab.comGoDaddy.com, LLC30 Jul 201530 Jul 201530 Jul 2016
144majliselnwab.orgGoDaddy.com, LLC30 Jul 20157 Jun 201730 Jul 2021
145majliselnwab.netGoDaddy.com, LLC30 Jul 201530 Jul 201530 Jul 2016
146majlisalwegaisi.comGoDaddy.com, LLC3 Aug 20154 Aug 20243 Aug 2025
147majlistaklim.comGoDaddy.com, LLC2 Oct 20152 Oct 20152 Oct 2016
148majlisinvestments.comGoDaddy.com, LLC2 Dec 20242 Dec 20242 Dec 2025
149majlisinvestment.comGoDaddy.com, LLC26 Jul 202426 Jul 202426 Jul 2025
150majlisequity.comGoDaddy.com, LLC3 Oct 20153 Oct 20153 Oct 2016
151majliscapital.comGoDaddy.com, LLC10 Mar 202111 Mar 202510 Mar 2026
152majlisdawatulhaq.orgPDR Ltd. d/b/a PublicDomainRegistry.com4 Oct 201516 Oct 20164 Oct 2017
153majlis-me.comTucows Domains Inc.7 Oct 201511 Oct 20177 Oct 2017
154majlisgugurgunung.comCV. Jogjacamp9 Oct 20155 Oct 20249 Oct 2025
155majlisstudio.comGoDaddy.com, LLC13 Sep 202314 Sep 202413 Sep 2025
156majlislib.orgCSL Computer Service Langenbach GmbH d/b/a joker.c…6 Jan 20238 Jan 20246 Jan 2025
157majlisgroups.comGoDaddy.com, LLC30 Oct 201530 Oct 201530 Oct 2017
158majlisalbadr.orgCV. Jogjacamp3 Nov 20152 Nov 20163 Nov 2017
159majlisfann.comWild West Domains, LLC11 Nov 201511 Nov 201511 Nov 2016
160majlisrosho.orgCV. Rumahweb Indonesia19 Nov 20157 Nov 201619 Nov 2017
161majlisulamaakenya.orgeNom, Inc.24 Nov 201524 Nov 201524 Nov 2016
162majlisku.comNameCheap, Inc.18 Dec 202218 Nov 202418 Dec 2025
163majlisalammamrah.comAscio Technologies, Inc. Danmark - Filial af Ascio…11 Dec 201511 Dec 201511 Dec 2016
164majlis-international.com-4 Mar 20246 May 20254 Mar 2025
165majliskom.comDynadot, LLC31 Jan 202412 Apr 202531 Jan 2025
166majlisaza.comTucows Domains Inc.31 Dec 201531 Dec 201531 Dec 2016
167majlissenatormalaysia.comGoDaddy.com, LLC4 Jan 20164 Jan 20164 Jan 2018
168majlishikmah.comRealtime Register B.V.14 Jan 201614 Jan 201614 Jan 2017
169majlislahore.comGoDaddy.com, LLC19 Jan 201619 Jan 201619 Jan 2019
170majlispods.com1&1 Internet AG28 Jan 201630 Dec 201628 Jan 2018
171majlissenator.comGoDaddy.com, LLC29 Jan 201629 Jan 201629 Jan 2018
172majlisutdeenee.com1API GmbH9 Feb 201624 Mar 20179 Feb 2018
173majlisjatirasa.orgCV. Rumahweb Indonesia13 Feb 201613 Feb 201613 Feb 2017
174majlishalalmalaysia.comNetEarth One Inc. d/b/a NetEarth15 Feb 201615 Feb 201615 Feb 2017
175majlisgrandmercure.comBigRock Solutions Ltd.20 Feb 201615 Feb 201720 Feb 2018
176majlisjala.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Feb 20162 Apr 201723 Feb 2018
177majlisushifa.comRealtime Register B.V.22 Feb 202423 Feb 202522 Feb 2026
178majlisushifa.orgNetwork Solutions, LLC4 Mar 20164 Mar 20164 Mar 2017
179majlisishaatiluloom.orgAscio Technologies, Inc. Danmark - Filial af Ascio…7 Mar 20168 Mar 20177 Mar 2018
180majlisfes.comName.com, Inc.17 Oct 202417 Oct 202417 Oct 2025
181majlisnurulmusthofa.comCV. Jogjacamp11 Mar 201614 Mar 201711 Mar 2018
182majlis247.comGoDaddy.com, LLC13 Mar 201613 Mar 201613 Mar 2017
183majliswelfare.orgPDR Ltd. d/b/a PublicDomainRegistry.com18 Mar 201618 Mar 201618 Mar 2017
184majlisstore.com1&1 Internet AG15 May 202515 May 202515 May 2026
185majliselm.comGoDaddy.com, LLC22 Mar 201622 Mar 201622 Mar 2017
186majlisaam.netTucows Domains Inc.22 Mar 201422 Mar 201422 Mar 2017
187majlisaam.org-22 Mar 201422 Mar 201422 Mar 2017
188majlistaklimalhidayah.orgCV. Rumahweb Indonesia28 Mar 201628 Mar 201628 Mar 2017
189majliss-design.comGoDaddy.com, LLC10 Aug 202122 Oct 202310 Aug 2023
190majlisilmubrunei.comTucows Domains Inc.4 Apr 20168 Apr 20174 Apr 2017
191majlisperubatanelektronikmalaysia.comeNom, Inc.8 Apr 20168 Apr 20168 Apr 2017
192majlisalabrar.netHostinger, UAB24 Apr 20164 Jul 202424 Apr 2024
193majlisalabrar.comHostinger, UAB24 Apr 20164 Jul 202424 Apr 2024
194majlisalabrar.orgHostinger, UAB24 Apr 20163 Jul 202424 Apr 2024
195majlistalimattafsir.com-2 May 20162 May 20162 May 2017
196majlisrestaurantcafe.comGoDaddy.com, LLC9 May 20169 May 20169 May 2021
197majlisholding.comName.com, Inc.11 May 201611 May 201611 May 2017
198majlisrestaurantlounge.comWix.com Ltd.15 Jul 202215 Jul 202215 Jul 2025
199majlischat.comGoDaddy.com, LLC29 May 201629 May 201629 May 2017
200majlisban.comREALTIME REGISTER BV30 May 201630 May 201630 May 2017
201majlisilmupulaupinang.comTucows Domains Inc.31 May 201631 May 201631 May 2017
202majlis2017.comGoDaddy.com, LLC5 Jun 20165 Jun 20165 Jun 2017
203majlisecf.comREALTIME REGISTER BV12 Jun 201612 Jun 201612 Jun 2017
204majlis-shabab.comFastDomain Inc.24 Sep 200625 Sep 201524 Sep 2016
205majlisfood.xyzTLD Registrar Solutions Ltd.2 Jun 20167 Jun 20162 Jun 2017
206majlisschool.orgPDR Ltd. d/b/a PublicDomainRegistry.com11 Jul 201625 Aug 202411 Jul 2025
207majlisproperty.comGoDaddy.com, LLC12 Jul 201612 Jul 201612 Jul 2017
208majlish.comTurnCommerce, Inc. DBA NameBright.com15 Jul 20169 Jul 202015 Jul 2025
209majlist.com1API GmbH1 Mar 20203 Mar 20251 Mar 2027
210majlisfund.comeNom, Inc.8 Jun 202117 Jul 20248 Jun 2025
211majlisnameh.comNameCheap, Inc.21 Jul 201621 Jun 202421 Jul 2025
212majlisnameh.orgNameCheap, Inc.21 Jul 201626 Jun 202421 Jul 2025
213majlisilmieljadida.comeNom, Inc.25 Jul 20165 Sep 201725 Jul 2017
214majlishookah.comGoDaddy.com, LLC14 Aug 201629 Sep 202214 Aug 2026
215majlisalquran.comCV. Jogjacamp22 Aug 201621 Aug 201722 Aug 2018
216majlisimtiyaz.orgTucows Domains Inc.31 Aug 20164 Sep 201731 Aug 2018
217majlishall.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Sep 201618 Oct 20176 Sep 2017
218majlispartyhall.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Sep 201618 Oct 20176 Sep 2017
219majlisalbinfalah.comTucows Domains Inc.23 Nov 201027 Nov 201723 Nov 2017
220majlisayurveda.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Apr 201211 Apr 202510 Apr 2026
221majliseulamaehind.comXin Net Technology Corporation7 Apr 202127 May 20217 Apr 2022
222majlismeter.comGoDaddy.com, LLC12 Feb 201413 Feb 201612 Feb 2018
223majlisdatukpm.comTucows Domains Inc.29 Feb 201228 Feb 202428 Feb 2026
224majlisalmahrah.comWild West Domains, LLC19 Dec 201320 Dec 201519 Dec 2016
225majlisedalailulkhairat.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Dec 20132 Jan 201723 Dec 2017
226majlisalumma.comGoDaddy.com, LLC9 Aug 200720 Sep 20249 Aug 2024
227majlishotel.comCosmotown, Inc.8 Apr 20095 Feb 20258 Apr 2026
228majlisperbandarankulim.comWeb Commerce Communications Limited dba WebNic.cc6 Jun 20116 Jun 20116 Jun 2018
229majlismbz.comeNom, Inc.14 Feb 201313 Feb 201314 Feb 2023
230majliska.com1&1 Internet AG9 Oct 20124 Oct 20189 Oct 2025
231majliscollege.comWild West Domains, LLC30 Mar 201111 May 202430 Mar 2024
232majlisdubai.com1&1 Internet AG12 Jan 20252 Mar 202512 Jan 2026
233majlisomanstaff.comGoDaddy.com, LLC30 Oct 201123 Oct 201530 Oct 2016
234majlisilmu.comNetwork Solutions, LLC14 Jul 202414 Jul 202414 Jul 2025
235majlisconsulting.comNordreg AB7 Dec 20238 Dec 20247 Dec 2025
236majlisidarah.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Jun 202210 Aug 202429 Jun 2024
237majlisroyalty.comGoDaddy.com, LLC11 Jun 20149 May 201611 Jun 2017
238majlissala.comPDR Ltd. d/b/a PublicDomainRegistry.com10 May 201810 May 201810 May 2019
239majliss.comGoDaddy.com, LLC22 Feb 200514 Aug 202422 Feb 2026
240majlisqatar.comGoDaddy.com, LLC6 May 20087 May 20256 May 2026
241majliskerala.comNameSector LLC10 Mar 201311 Mar 201710 Mar 2018
242majlisalarabi.comDropCatch.com 378 LLC22 Jan 202523 Jan 202522 Jan 2026
243majlismuhibburrasool.comGoDaddy.com, LLC28 Mar 20134 Apr 201628 Mar 2017
244majlisaldawla.comGoDaddy.com, LLC13 Mar 201125 May 202413 Mar 2024
245majlisbimtech.comAtak Domain Hosting Internet d/b/a Atak Teknoloji27 Nov 202130 Nov 202127 Nov 2022
246majlisgroup.comHongkong Domain Name Information Management Co., L…20 Jan 202120 Jan 202120 Jan 2022
247majlistt.comeNom, Inc.13 Oct 201314 Oct 202413 Oct 2025
248majlispalakkad.comGoDaddy.com, LLC10 May 201411 May 201610 May 2017
249majlisyacoub.comLigne Web Services SARL11 Dec 201827 Jul 202311 Dec 2025
250majlisarts.comNameCheap, Inc.6 Jul 200823 Jun 20246 Jul 2027
251majlisetalimulquran.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Feb 201420 Feb 201717 Feb 2018
252majlisalmutawa.comTucows Domains Inc.18 Aug 201022 Aug 201718 Aug 2017
253majlisalittihad.comGoDaddy.com, LLC9 Aug 200720 Sep 20249 Aug 2024
254majlisululama.comZNet Technologies Pvt Ltd.15 Jan 201110 Dec 201615 Jan 2018
255majlisalshura.comGoDaddy.com, LLC31 Mar 200912 May 202431 Mar 2024
256majlisal-attasjepara.comNorthNames Inc14 Apr 201914 Apr 201914 Apr 2020
257majliseilmi.comTurnCommerce, Inc. DBA NameBright.com15 Apr 20199 Apr 202115 Apr 2025
258majlisalshora.comName.com, Inc.27 Apr 20095 Apr 201627 Apr 2017
259majlisronikonmaki.comCSL Computer Service Langenbach GmbH d/b/a joker.c…16 Nov 201213 Nov 202416 Nov 2025
260majlisschool.comHosting Concepts B.V. dba Openprovider28 Aug 202128 Aug 202128 Aug 2022
261majliselection.comGoDaddy.com, LLC31 Mar 200911 May 202431 Mar 2024
262majlisim.comeNom, Inc.25 Sep 200927 Aug 202425 Sep 2025
263majlishookahlounge.comGoDaddy.com, LLC7 May 20257 May 20257 May 2028
264majlistrio.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 20174 Nov 20174 Nov 2018
265majlispark.comGoDaddy.com, LLC11 Aug 201310 Mar 202511 Aug 2025
266majlisi.comCloudFlare, Inc.31 Jul 20233 Aug 202431 Jul 2025
267majlisalommah.comTucows Domains Inc.27 May 202031 May 202127 May 2021
268majlisworld.comNetwork Solutions, LLC11 Jul 20139 Jul 201611 Jul 2019
269majliselhassan.comNameCheap, Inc.23 Sep 200223 Dec 202423 Sep 2026
270majlisconnect.comGoDaddy.com, LLC23 Jan 201124 Jan 202323 Jan 2028
271majlissautulislam.comeNom, Inc.4 Jan 201126 Dec 20244 Jan 2026
272majliserola.comeNom, Inc.30 Nov 20101 Nov 201530 Nov 2016
273majlisnohay.comunited-domains AG15 Jan 201116 Jan 201715 Jan 2018
274majliskhawla.comGoDaddy.com, LLC20 Mar 201321 Mar 202320 Mar 2033
275majlispersson.comDomaininfo AB, aka domaininfo.com1 Aug 200325 Jul 20241 Aug 2025
276majlisglobal.comCSC Corporate Domains, Inc.11 Nov 20118 Nov 201511 Nov 2016
277majlisuzzikr.comGMO Internet Inc.13 Aug 202113 Aug 202113 Aug 2022
278majlisofthesultans.comIHS Telekom, Inc.21 Nov 201316 Apr 201521 Nov 2016
279majlisshura.com1&1 Internet AG1 Apr 20082 Apr 20161 Apr 2017
280majlisqtr.comGoDaddy.com, LLC6 May 20087 May 20256 May 2026
281majlisoman.comGoDaddy.com, LLC21 Nov 200722 Nov 201521 Nov 2016
282majliswinbergsalomonsson.comName.com, Inc.25 Aug 200927 Aug 201625 Aug 2016
283majlismonitor.comGoDaddy.com, LLC12 Feb 201413 Feb 202412 Feb 2026
284majlislaw.comGoDaddy.com, LLC8 Mar 201114 Oct 20228 Mar 2028
285majlisalittihadalwatani.comGoDaddy.com, LLC9 Aug 200720 Sep 20249 Aug 2024
286majlisalummah.comGoDaddy.com, LLC9 Aug 200720 Sep 20249 Aug 2024
287majlislounge.comGoDaddy.com, LLC3 Nov 200919 Oct 20153 Nov 2016
288majlisaljinn.comGoDaddy.com, LLC25 Feb 20128 Apr 202525 Feb 2025
289majlisberrechid.comBeijing Lanhai Jiye Technology Co., Ltd26 Apr 202228 Jun 202426 Apr 2024
290majlisalmahra.comWild West Domains, LLC19 Dec 201320 Dec 201519 Dec 2016
291majlispartners.comGoDaddy.com, LLC6 May 200918 Jul 20246 May 2024
292majliswatch.comBeijing Lanhai Jiye Technology Co., Ltd4 Mar 20226 May 20254 Mar 2025
293majlisefrogheurduadab.orgName.com, Inc.29 Sep 201613 Oct 201729 Sep 2018
294majlisalkarak.comName.com, Inc.4 Oct 201612 Sep 20174 Oct 2018
295majlisalmutawa.infoTucows Domains Inc.13 Feb 201017 Feb 201813 Feb 2019
296majlisdawatulhaq.netBigRock Solutions Ltd.11 Oct 201622 Nov 201711 Oct 2017
297majliska.net1&1 Internet AG9 Oct 20125 Dec 20179 Oct 2025
298majlisalmubarak.neteNom, Inc.25 Nov 200729 Nov 201725 Nov 2017
299majlisofthesultans.netIHS Telekom, Inc.21 Nov 201316 Apr 201521 Nov 2016
300majlisconsulting.netGoDaddy.com, LLC12 Sep 201024 Apr 201512 Sep 2018
301majlismbz.neteNom, Inc.14 Feb 201313 Feb 201314 Feb 2023
302majlisalshura.netTucows Domains Inc.26 Apr 202030 Apr 202126 Apr 2021
303majlis2016.com-17 Oct 201617 Oct 201617 Oct 2017
304majlisalomah.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Oct 20162 Dec 201721 Oct 2017
305majliseduboard.orgGoDaddy.com, LLC7 Sep 201330 Apr 20257 Sep 2026
306majlisofthesultans.orgIHS Telekom, Inc.21 Nov 201316 Apr 201521 Nov 2016
307majlisalumma.orgGo Canada Domains, LLC26 Oct 20127 Nov 202426 Oct 2025
308majlisbombay.orgNameCheap, Inc.19 Oct 20244 Mar 202519 Oct 2025
309majlisalhidayah.orgCV. Jogjacamp16 Mar 20142 Mar 201716 Mar 2018
310majlistaklimalamin.orgPDR Ltd. d/b/a PublicDomainRegistry.com28 Oct 20158 Oct 201728 Oct 2018
311majlisalittihadalwatani.orgGo Canada Domains, LLC26 Oct 20127 Nov 202426 Oct 2025
312majlisexam.orgPDR Ltd. d/b/a PublicDomainRegistry.com16 Sep 201114 Oct 201716 Sep 2018
313majlisrasulullah.orgOurdomains Limited1 Nov 200816 Dec 20241 Nov 2025
314majlish.orgNet 4 India Limited24 Sep 20125 Oct 201724 Sep 2018
315majlisdzikrullahpekojan.orgGoDaddy.com, LLC6 Jun 202321 Jul 20246 Jun 2025
316majlisalshura.orgGoDaddy.com, LLC31 Mar 200913 Apr 202431 Mar 2025
317majlismbz.orgeNom, Inc.14 Feb 201311 Mar 201714 Feb 2023
318majlispusat.orgMelbourne IT, Ltd20 Oct 201012 Jul 201720 Oct 2021
319majlisilmi.orgNameCheap, Inc.11 Jan 202319 Jan 202411 Jan 2026
320majliseulama.orgKey-Systems GmbH26 Jun 201426 Apr 201626 Jun 2017
321majliseilmi.orgPDR Ltd. d/b/a PublicDomainRegistry.com14 Jul 202016 Jul 202414 Jul 2025
322majliskerala.orgPDR Ltd. d/b/a PublicDomainRegistry.com10 Feb 20079 Feb 202510 Feb 2026
323majliseirshad.orgDreamHost, LLC22 Feb 20105 May 202522 Feb 2025
324majlisalittihad.orgGo Canada Domains, LLC26 Oct 20127 Nov 202426 Oct 2025
325majliscomplex.orgPDR Ltd. d/b/a PublicDomainRegistry.com30 May 20064 Jun 202430 May 2025
326majlis-zimbabwe.orgCloudFlare, Inc.4 Jul 200818 Jul 20244 Jul 2034
327majlisesharai.orgGoDaddy.com, LLC3 Aug 201415 Aug 20243 Aug 2026
328majlisonline.orgPDR Ltd. d/b/a PublicDomainRegistry.com2 Jan 20146 Jan 20172 Jan 2018
329majliska.org1&1 Internet AG9 Oct 201223 Nov 20249 Oct 2025
330majliselhassan.orgNameCheap, Inc.27 Jan 200329 Nov 202427 Jan 2026
331majlisul-ulama.xyzLimited Liability Company "Registrar of domain nam…2 Jun 201629 Jul 20162 Jun 2017
332majlis-remomm.fr-2 Jul 20141 Jun 20167 Feb 2017
333majlisskhemisset.ma-2 Sep 201314 Sep 20172 Sep 2018
334majlisshotel.ma-3 Aug 20112 Sep 20242 Aug 2025
335majlischool.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED21 Jan 202121 Jan 202121 Jan 2022
336majlisdaman.comGoDaddy.com, LLC12 Nov 201612 Nov 201612 Nov 2017
337majlisaman.comGoDaddy.com, LLC12 Nov 201612 Nov 201612 Nov 2017
338majliseqadria.comGoDaddy.com, LLC14 Nov 201614 Nov 201614 Nov 2021
339majlisaldallah.comEmirates Telecommunications Corporation - Etisalat24 Nov 201624 Nov 201623 Nov 2018
340majliscatering.comGoDaddy.com, LLC27 Nov 201627 Nov 201627 Nov 2018
341majlisalmaslamani.orgTucows Domains Inc.30 Nov 201614 Jan 202530 Nov 2025
342majlissnouweb.comDynadot3 LLC24 Feb 20226 Apr 202324 Feb 2023
343majlissangbad.netPDR Ltd. d/b/a PublicDomainRegistry.com8 Dec 20168 Dec 20178 Dec 2017
344majliscloud.comNameCheap, Inc.8 Dec 20168 Nov 20248 Dec 2025
345majlistobacco.comGoDaddy.com, LLC10 Dec 201610 Dec 201610 Dec 2018
346majlisloungecafe.comNameCheap, Inc.14 Dec 201614 Nov 202414 Dec 2025
347majlis-ilmu.comNameCheap, Inc.7 Feb 2020-7 Feb 2021
348majlisnelson.comLCN.COM Ltd.17 Dec 201618 Dec 201717 Dec 2018
349majlis-e-mughal.comGoDaddy.com, LLC21 Dec 201621 Dec 201621 Dec 2018
350majlistahaffuzekhatmenubbuwath.comGoDaddy.com, LLC2 Jan 20172 Jan 20172 Jan 2019
351majlisofsheikhs.comeNom, Inc.14 Jan 20175 Jan 201814 Jan 2019
352majlisehind.comGoDaddy.com, LLC17 Jan 201717 Jan 201717 Jan 2018
353majlisalfalah.comGoDaddy.com, LLC24 Jan 201724 Jan 201724 Jan 2018
354majlissocial.comGoDaddy.com, LLC29 Jan 201729 Jan 201729 Jan 2019
355majlisalnoman.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Feb 201729 Apr 201727 Feb 2018
356majlissukannegerisarawak.comTucows Domains Inc.31 May 201931 May 201931 May 2020
357majlisrekreasimalaysia.comTucows Domains Inc.14 Mar 201718 Mar 201814 Mar 2018
358majlis-e-ittehadul-mazaahib.comGoDaddy.com, LLC16 Mar 201716 Mar 201716 Mar 2018
359majlissilaturahmi.comHostinger, UAB30 Mar 201730 May 201730 Mar 2018
360majliskopi.comHostinger, UAB3 Apr 20173 Jun 20173 Apr 2018
361majlishalalmalaysia.orgPDR Ltd. d/b/a PublicDomainRegistry.com5 Apr 20175 Jun 20175 Apr 2018
362majlisesehat.worldDomeneshop AS dba domainnameshop.com8 Apr 201729 Sep 20178 Apr 2018
363majlisweb.comGoDaddy.com, LLC19 Apr 201720 Apr 202519 Apr 2026
364majliseulamaehind.orgPDR Ltd. d/b/a PublicDomainRegistry.com2 May 20176 May 20252 May 2026
365majlissholawat.infoNameCheap, Inc.19 May 201718 Jul 201719 May 2018
366majlisemohammadi.comBigRock Solutions Ltd.9 Jun 20179 Aug 20179 Jun 2018
367majlispro.comHostinger, UAB20 Apr 202520 Apr 202520 Apr 2026
368majlissenatormalaysia.orgNameCheap, Inc.18 Jul 201718 Jul 201718 Jul 2018
369majlisashura.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Jul 201725 Jul 201725 Jul 2018
370majlisomah.comLaunchpad, Inc.1 Aug 20171 Aug 20171 Aug 2018
371majlis-e-ahlesunnat.comBigRock Solutions Ltd.11 Aug 201711 Aug 201711 Aug 2018
372majliscentral.comLaunchpad, Inc.19 Aug 201719 Aug 201719 Aug 2018
373majlisians.onlineGoDaddy.com, LLC21 Aug 201721 Aug 201721 Aug 2018
374majlissusl.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Aug 201721 Aug 201721 Aug 2018
375majlisquran.onlineCV. Rumahweb Indonesia7 Sep 20177 Sep 20177 Sep 2018
376majlisparkaggarwalsabha.comBigRock Solutions Ltd.13 Sep 201711 Sep 202413 Sep 2025
377majlishcare.co.uk-8 May 20231 Oct 20238 May 2024
378majlisdurand.comGandi SAS10 Oct 201710 Oct 201710 Oct 2018
379majlistime.comDomain.com, LLC10 May 202123 Jun 202310 May 2023
380majlisfatih.comGandi SAS1 Nov 20171 Nov 20171 Nov 2018
381majlispaytren.onlineHostinger, UAB13 Nov 201713 Nov 201713 Nov 2018
382majlises.comNameCheap, Inc.4 Oct 2021-4 Oct 2022
383majlisgroup.netPDR Ltd. d/b/a PublicDomainRegistry.com6 Dec 20176 Dec 20176 Dec 2018
384majlisesehat.co.uk-4 Jun 20133 Jun 20234 Jun 2025
385majlislounge.co.ukLCN.COM Ltd.9 Jan 201412 Jan 20169 Jan 2018
386majlisedawatulhaq.org.uk-27 Mar 201028 Mar 202527 Mar 2026
387majliscalendar.co.uk-4 Nov 201421 Oct 20164 Nov 2018
388majlissabingdon.co.ukReserved22 Dec 201621 Dec 201722 Dec 2018
389majliss.co.ukLCN.COM Ltd.7 Jan 20097 Jan 20257 Jan 2027
390majlisseating.co.uk-17 Dec 201523 Nov 202417 Dec 2025
391majlismakkah.co.uk-21 Apr 201625 Jun 202421 Apr 2027
392majlispartners.co.uk-25 Jul 201218 Jul 201625 Jul 2018
393majlis65.comNameCheap, Inc.14 Jan 201814 Jan 201814 Jan 2019
394majlisshisha.comWebfusion Ltd.16 Jan 201817 Jan 202516 Jan 2026
395majlis-shisha.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Jan 201816 Jan 201816 Jan 2020
396majlisshisha.co.uk-16 Jan 201817 Jan 202516 Jan 2026
397majlis-alkwb.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jan 201823 Jan 201823 Jan 2020
398majliss-sheikh.comOVH sas2 Feb 20182 Feb 20182 Feb 2019
399majlisvape.comTucows Domains Inc.3 Mar 20187 Mar 20193 Mar 2019
400majlisapp.comName.com, Inc.19 Oct 20201 Dec 202419 Oct 2024
401majlischichaoua.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Mar 201831 Mar 201831 Mar 2019
402majlisdelivered.comWebfusion Ltd.17 Apr 201817 Apr 201817 Apr 2019
403majlisdelivered.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…17 Apr 201820 Apr 201817 Apr 2020
404majlislive.comCV. Rumahweb Indonesia4 May 2018-4 May 2019
405majlisdelivery.comWebfusion Ltd.16 May 201816 May 201816 May 2019
406majlisdelivery.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 May 201816 May 201816 May 2019
407majlismotivasiqu.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Apr 20227 Jun 202326 Apr 2023
408majliscard.comTucows Domains Inc.21 Jun 201825 Jun 201921 Jun 2019
409majlisoptics.comGoogle, Inc.20 Oct 202020 Oct 202020 Oct 2021
410majlisrasulullah-malaysia.comGoDaddy.com, LLC4 Aug 20184 Aug 20184 Aug 2019
411majlisresort.comGoDaddy.com, LLC13 Aug 201813 Aug 201813 Aug 2019
412majlisalhenna.comregister.com, Inc.15 Aug 201815 Aug 201815 Aug 2019
413majlisenergy.comeNom, Inc.8 Sep 20185 Sep 20248 Sep 2025
414majlisbachaotehreek.comGoDaddy.com, LLC21 Sep 201821 Sep 201821 Sep 2019
415majliswaheedaldoseri.comeNom, Inc.9 Oct 20189 Oct 20189 Oct 2019
416majlisboulemane.comLaunchpad, Inc.12 Nov 201812 Nov 201812 Nov 2019
417majlishosting.comGMO Internet Inc.8 Mar 202419 Apr 20258 Mar 2025
418majlisdzikirtv.comHostinger, UAB28 Nov 201828 Nov 201828 Nov 2019
419majlisdarbar.comGMO Internet Inc.7 Aug 20247 Aug 20247 Aug 2025
420majlis11.comGoDaddy.com, LLC11 Dec 201811 Dec 201811 Dec 2020
421majlis19.comGoDaddy.com, LLC8 Jan 20198 Jan 20198 Jan 2020
422majliss.neteNom, Inc.8 Jan 20197 Jan 20258 Jan 2026
423majlismakan.comTucows Domains Inc.11 Jan 201915 Jan 202011 Jan 2020
424majliseaza.comMat Bao Trading & Service Company Limited d/b/a Ma…27 Feb 202127 Feb 202127 Feb 2022
425majliskerabatkedah.comCloudFlare, Inc.6 Dec 202413 Dec 20246 Dec 2025
426majlisaluban.comGoDaddy.com, LLC20 Jan 201920 Jan 201920 Jan 2022
427majlisalluban.comGoDaddy.com, LLC23 Jan 201923 Jan 201923 Jan 2022
428majlisilmubatupahat.comGoDaddy.com, LLC26 Jan 201926 Jan 201926 Jan 2020
429majlis2019.comDomain.com, LLC28 Jan 201928 Jan 201928 Jan 2020
430majlisalmandi.com1API GmbH6 Jun 20236 Jun 20246 Jun 2025
431majlisalsultan.comGoDaddy.com, LLC18 Feb 201927 Jan 202518 Feb 2028
432majlisiqbal.comGoDaddy.com, LLC4 Mar 20194 Mar 20194 Mar 2020
433majlis71.comGoDaddy.com, LLC27 Mar 20198 Jun 202427 Mar 2024
434majlisalatthos.comCV. Jogjacamp13 Apr 201913 Apr 201913 Apr 2020
435majlisdakwahnegara.comCloudFlare, Inc.24 Apr 201925 Mar 202524 Apr 2026
436majlismihaaru.comAmazon Registrar, Inc.29 Apr 201925 Mar 202529 Apr 2026
437majlisusa.comGoDaddy.com, LLC5 Dec 20225 Dec 20225 Dec 2025
438majliskhalid.comGoDaddy.com, LLC5 May 20196 May 20255 May 2026
439majlisalsuwaidi.comGoDaddy.com, LLC22 May 201922 May 201922 May 2020
440majlissone.netGoDaddy.com, LLC23 May 201923 May 201923 May 2020
441majlishookahny.comGoDaddy.com, LLC24 May 201924 May 201924 May 2020
442majlischronicle.comNameCheap, Inc.22 Jun 2019-22 Jun 2020
443majlissandwichshop.comGoDaddy.com, LLC26 Jun 201926 Jun 201926 Jun 2021
444majlisaleawali.comGoDaddy.com, LLC27 Jun 201927 Jun 201927 Jun 2020
445majlisapps.com1API GmbH27 Jun 201910 Aug 202027 Jun 2020
446majlispengetuaselangor.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Jul 20193 Jul 20193 Jul 2020
447majlisksa.comAmazon Registrar, Inc.9 Jul 20199 Jul 20199 Jul 2020
448majlisalternatif.comCV. Jogjacamp18 Jul 201919 Jul 201918 Jul 2020
449majlisna-app.comName.com, Inc.22 Jul 201922 Jul 201922 Jul 2021
450majlis-aloma.comFastDomain Inc.23 Jul 201923 Jul 201923 Jul 2020
451majlissouq.comNameCheap, Inc.27 Dec 202427 Dec 202427 Dec 2025
452majlisalamirusedfurniture.com1&1 Internet AG20 Aug 201920 Aug 201920 Aug 2020
453majlissimtudduror.comCV. Jogjacamp23 Aug 201923 Aug 201923 Aug 2020
454majlisahrarislamhindms.comGoDaddy.com, LLC3 Sep 20193 Sep 20193 Sep 2020
455majlishamdalah.comCV. Jogjacamp9 Sep 20199 Sep 20199 Sep 2020
456majlisbcn.comDomain.com, LLC27 Sep 201910 Nov 202427 Sep 2024
457majlishalal.comWeb Commerce Communications Limited dba WebNic.cc8 Oct 20198 Oct 20198 Oct 2020
458majlistalaqqibangi.comNameCheap, Inc.24 Oct 2019-24 Oct 2020
459majlis-cars.club1&1 Internet AG31 Oct 201931 Oct 201931 Oct 2020
460majlisexclusive.comOnline SAS17 Nov 201920 Jan 202517 Nov 2028
461majlisehassan.netBigRock Solutions Ltd.21 Nov 201926 Nov 202421 Nov 2025
462majlisdarulfutuh.comGoogle, Inc.26 Nov 201926 Nov 201926 Nov 2020
463majlisbuilder.comGoDaddy.com, LLC15 Dec 201915 Dec 201915 Dec 2022
464majlisnanews.comGoDaddy.com, LLC6 Feb 202020 Apr 20256 Feb 2025
465majlis98.comNameCheap, Inc.13 Feb 2020-13 Feb 2021
466majlisislamicparenting.comCV. Rumahweb Indonesia28 Feb 2020-27 Feb 2021
467majlisjeddah.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Mar 20202 Mar 20202 Mar 2021
468majlisofthefuture.comGoogle, Inc.17 Mar 20202 Mar 202517 Mar 2026
469majlisna-bh.comGoDaddy.com, LLC8 Apr 20208 Apr 20208 Apr 2021
470majlisdrhima.comGoDaddy.com, LLC14 Apr 202027 Apr 202314 Apr 2024
471majlis19.infoNamesilo, LLC5 Jun 20194 Aug 20195 Jun 2020
472majlissidikacem.comArcanes Technologies24 Apr 202024 Apr 202024 Apr 2021
473majlis-news.comCloudFlare, Inc.9 May 202013 Jan 20259 May 2026
474majlis-news.netCloudFlare, Inc.9 May 202013 Jan 20259 May 2026
475majlisnewsagency.comPDR Ltd. d/b/a PublicDomainRegistry.com16 May 202016 May 202016 May 2021
476majlis2020.comGoDaddy.com, LLC25 May 202025 May 202025 May 2021
477majlismutaalimin.comTucows Domains Inc.26 May 202026 May 202026 May 2021
478majlisalomma.comTucows Domains Inc.27 May 202011 Mar 202527 May 2026
479majlisalfujairah.comGoDaddy.com, LLC3 Jun 20204 Jun 20203 Jun 2021
480majlisorder.comTurnCommerce, Inc. DBA NameBright.com6 Jun 202010 May 20246 Jun 2025
481majliswalker.comGoDaddy.com, LLC9 Jun 202013 Nov 20229 Jun 2030
482majlistrading.comGoDaddy.com, LLC26 Jun 202027 Jun 202426 Jun 2025
483majlistrading.netGoDaddy.com, LLC26 Jun 202027 Jun 202426 Jun 2025
484majlisny.comGoDaddy.com, LLC9 Jul 20207 Jul 20249 Jul 2026
485majlisofny.comGoDaddy.com, LLC9 Jul 202014 Jan 20259 Jul 2026
486majlisofnewyork.comGoDaddy.com, LLC9 Jul 20207 Jul 20249 Jul 2026
487majlisresidences.comCrazy Domains FZ-LLC20 Jul 202020 Jul 202020 Jul 2025
488majlistower.comCrazy Domains FZ-LLC20 Jul 202020 Jul 202020 Jul 2025
489majlisdarbararabiancuisinevisakhapatnam.comGoogle, Inc.21 Jul 202021 Jul 202021 Jul 2021
490majlis14.comTucows Domains Inc.29 Jul 202029 Jun 202429 Jul 2026
491majlisaloud.comGoDaddy.com, LLC18 Dec 202119 Dec 202418 Dec 2025
492majlistalimkwitang.sitePDR Ltd. d/b/a PublicDomainRegistry.com13 Aug 202021 Sep 202013 Aug 2021
493majlisjournal.comFastDomain Inc.26 Aug 202026 Aug 202026 Aug 2021
494majlistaklimbaiturrahman.comCV. Rumahweb Indonesia11 Jun 2020-11 Jun 2021
495majlis-united.comGoDaddy.com, LLC2 Sep 202017 Nov 20222 Sep 2025
496majlisunited.comGoDaddy.com, LLC2 Sep 202017 Nov 20222 Sep 2025
497majlise.comWix.com Ltd.13 Dec 202413 Dec 202413 Dec 2025
498majlisululalbab.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Sep 202016 Sep 202016 Sep 2021
499majlis-saudi.comTucows Domains Inc.26 Sep 202030 Sep 202126 Sep 2021
500majlisyala.comGoDaddy.com, LLC28 Sep 202018 Nov 202228 Sep 2025
501majlisbbs.comTucows Domains Inc.29 Sep 20203 Oct 202229 Sep 2023
502majlisicecream.comGoDaddy.com, LLC22 Oct 20201 Nov 202222 Oct 2025
503majlisaloudh.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Nov 20204 Nov 20241 Nov 2025
504majlislondon.comGoDaddy.com, LLC10 Nov 202022 Jan 202410 Nov 2023
505majliskita.comNameCheap, Inc.16 Apr 202417 Apr 202516 Apr 2026
506majlisdzikir.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Nov 202030 Jan 202418 Nov 2023
507majlisquran.comHostinger, UAB20 Nov 202024 May 202420 Nov 2025
508majliseduboard.comNamesilo, LLC20 Nov 202021 Nov 202020 Nov 2021
509majlisdatuk-datuknegerimelaka.comGoDaddy.com, LLC23 Nov 202024 Nov 202423 Nov 2025
510majlisaldaewa.comDreamHost, LLC14 Dec 202013 Nov 202414 Dec 2025
511majlisaldaewa.netDomain.com, LLC14 Dec 202029 Nov 202414 Dec 2025
512majlisula.xyzİsimtescil Bilişim A.Ş.16 Dec 202016 Dec 202016 Dec 2021
513majlistravel.comGoDaddy.com, LLC24 Dec 202025 Dec 202424 Dec 2026
514majlisnikahsiri.websiteHostinger, UAB28 Dec 202028 Dec 202028 Dec 2021
515majlisb23469.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
516majlism1-3031.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
517majlisme1589b.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
518majlis40853ml.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
519majlis21295mb.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
520majlis28793b.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
521majlismb81749.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
522majlisme1b911.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
523majlisml53112.siteURL Solutions, Inc.2 Jan 20212 Jan 20212 Jan 2022
524majlistahkeem.comGoDaddy.com, LLC8 Jan 20218 Jan 20218 Jan 2022
525majlistahkim.comGoDaddy.com, LLC8 Jan 20218 Jan 20218 Jan 2022
526majlispadhangjiwo.comCV. Jogjacamp14 Jan 202114 Jan 202114 Jan 2022
527majlisdelivered.ltd1&1 Internet AG28 Jan 202128 Jan 202428 Jan 2025
528majlisdeliveredltd.com1&1 Internet AG28 Jan 202111 Mar 202428 Jan 2024
529majlispengetuayik.comLucky Elephant Domains, LLC21 Apr 20234 Jun 202421 Apr 2024
530majlisdaerahyan.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Feb 202124 Feb 202521 Feb 2026
531majliscintarasul.comGoDaddy.com, LLC26 Feb 202127 Feb 202526 Feb 2026
532majlisha.comTucows Domains Inc.25 Mar 202124 Feb 202525 Mar 2026
533majlissberrechid.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Mar 202126 Mar 202126 Mar 2022
534majliseglobal.comRegister.it SPA4 Apr 20216 Jun 20234 Apr 2023
535majlisilmi.xyzPDR Ltd. d/b/a PublicDomainRegistry.com15 Apr 202115 Apr 202115 Apr 2022
536majlis2u.comGoDaddy.com, LLC24 Apr 202124 Apr 202124 Apr 2022
537majlislife.comDomain.com, LLC10 May 202123 Jun 202310 May 2023
538majlisvibes.comDomain.com, LLC10 May 202123 Jun 202310 May 2023
539majliskyoshikai.comGoDaddy.com, LLC20 May 20216 Jun 202320 May 2025
540majlisdigital.comName.com, Inc.11 May 20219 May 202411 May 2025
541majlistokyo.comNetowl, Inc.3 Jun 20213 Jun 20213 Jun 2022
542majlisadvisory.comeNom, Inc.8 Jun 202118 Jul 20248 Jun 2025
543majlishealth.comeNom, Inc.8 Jun 202117 Jul 20248 Jun 2025
544majlisvision.comeNom, Inc.8 Jun 202117 Jul 20248 Jun 2025
545majlistech.comeNom, Inc.8 Jun 202117 Jul 20248 Jun 2025
546majlisventures.comeNom, Inc.8 Jun 202117 Jul 20248 Jun 2025
547majlisekonomihalal.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Jun 202114 Jun 202413 Jun 2025
548majliseldera.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Jun 202115 Jun 202115 Jun 2022
549majlisdzikirfikir.comHostinger, UAB21 Jun 202121 Jun 202121 Jun 2022
550majlisperkahwinan.comBeijing Lanhai Jiye Technology Co., Ltd22 Jun 202122 Jun 202122 Jun 2022
551majlisalarab.comRealtime Register B.V.24 Jun 2021-24 Jun 2022
552majlisalfakher.comNameCheap, Inc.25 Oct 202327 Oct 202425 Oct 2027
553majlis-telecom.comGandi SAS11 Jul 202112 Apr 202511 Jul 2025
554majlis-telco.comGandi SAS11 Jul 202112 Apr 202511 Jul 2025
555majlistelco.comGandi SAS11 Jul 202112 Apr 202511 Jul 2025
556majlistelco.netGandi SAS11 Jul 202127 Jun 202411 Jul 2025
557majlis-telco.netGandi SAS11 Jul 202127 Jun 202411 Jul 2025
558majlis-telecom.netGandi SAS11 Jul 202112 Apr 202511 Jul 2025
559majlisenglishschool.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Jul 202112 Jul 202112 Jul 2022
560majlisalvazarat.comDynadot, LLC26 Jul 202126 Jul 202126 Jul 2022
561majlistalimarraudhoh.comGoogle, Inc.26 Jul 202127 Jul 202326 Jul 2024
562majlisalalbait.comGoogle, Inc.8 Aug 20218 Aug 20218 Aug 2022
563majlisschoolganemar.comHosting Concepts B.V. dba Openprovider11 Aug 202111 Aug 202111 Aug 2022
564majlis-aloud.comGoDaddy.com, LLC17 Aug 202129 Oct 202317 Aug 2023
565majlisarchive.comAutomattic Inc.21 Aug 202121 Aug 202121 Aug 2022
566majlissofa.comregister.com, Inc.27 Aug 202130 May 202427 Aug 2025
567majlisaltaif.comTLD Registrar Solutions Ltd.4 Sep 20214 Sep 20214 Sep 2022
568majlisdalailalkhayratintl.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Sep 20217 Sep 20247 Sep 2025
569majlisalfardan.comNameCheap, Inc.8 Sep 20218 Sep 20218 Sep 2031
570majlis-ihsanul-iman.comGoDaddy.com, LLC20 Sep 202119 Sep 202120 Sep 2022
571majlisservices.comNameCheap, Inc.22 Sep 202131 Oct 202422 Sep 2025
572majliskhaleeji.comGoDaddy.com, LLC3 Oct 20218 Oct 20233 Oct 2025
573majlissenisarawak.comNamesilo, LLC25 Oct 202115 Oct 202425 Oct 2025
574majlisfutures.comeNom, Inc.5 Nov 20212 Nov 20245 Nov 2025
575majlisprojects.comeNom, Inc.5 Nov 20212 Nov 20245 Nov 2025
576majlissi.comNordNet SA12 Nov 20212 May 202512 Nov 2025
577majlisob.xyzNameCheap, Inc.15 Nov 202115 Nov 202115 Nov 2022
578majliscoin.comGoDaddy.com, LLC17 Nov 202117 Nov 202117 Nov 2022
579majlistour.comHosting Concepts B.V. dba Openprovider19 Nov 202119 Nov 202119 Nov 2022
580majlisplasticuae.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Nov 202124 Nov 202124 Nov 2022
581majlisgm.comGoDaddy.com, LLC25 Nov 202125 Nov 202125 Nov 2022
582majlispelancaranperkhidmatan5g.comGoogle, Inc.26 Nov 202126 Nov 202126 Nov 2022
583majlisalsalam.comName.com, Inc.29 Nov 202129 Nov 202129 Nov 2022
584majlistalks.comGoDaddy.com, LLC30 Nov 202111 Feb 202430 Nov 2023
585majliscrypto.comeNom, Inc.5 Dec 202128 Nov 20245 Dec 2025
586majlisketersediaanperkhidmatan5g.comGoogle, Inc.8 Dec 20218 Dec 20218 Dec 2022
587majliskorea.comLaunchpad, Inc.20 Dec 20214 Mar 202520 Dec 2024
588majlis-mrt.comHostinger, UAB16 Jan 202216 Jan 202216 Jan 2023
589majlisaljazeera.comGoDaddy.com, LLC23 Jan 20226 Mar 202523 Jan 2025
590majlismeta.comName.com, Inc.28 Jan 202211 Apr 202428 Jan 2024
591majlishabab.comGoogle, Inc.28 Jan 202228 Jan 202228 Jan 2023
592majlisulijaba.comGoDaddy.com, LLC1 Feb 20221 Feb 20221 Feb 2023
593majlisqatarllshabab.comGoDaddy.com, LLC7 Feb 20223 Oct 20227 Feb 2027
594majlis-darululum.comCV. Jogjacamp28 Feb 20226 May 202428 Feb 2024
595majlismusic.comGoDaddy.com, LLC9 Mar 20229 Mar 20229 Mar 2023
596majlisaljubailtrading.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…17 Mar 202227 Apr 202317 Mar 2023
597majlismetaverse.comTucows Domains Inc.20 Mar 202213 Mar 202520 Mar 2026
598majlisoud.comName.com, Inc.17 Aug 202417 Aug 202417 Aug 2025
599majlissilmiberkane.ma-22 Apr 201511 Feb 202222 Apr 2022
600majlis-taqlim.my.id-29 Mar 202229 Mar 202229 Mar 2023
601majlis-aflam.comAutomattic Inc.15 Apr 202220 Apr 202315 Apr 2024
602majlissofas.comTucows Domains Inc.13 Jul 202413 Jul 202413 Jul 2026
603majlisbunkers.comTurnCommerce, Inc. DBA NameBright.com21 Apr 202222 Apr 202521 Apr 2025
604majlisoftheworld.comGoDaddy.com, LLC2 May 20222 May 20222 May 2023
605majlisyousef.comGoDaddy.com, LLC4 May 202219 Apr 20254 May 2026
606majlisarrasyad.comCV. Jogjacamp5 May 20226 May 20255 May 2025
607majlispertunangan2022.asiaGoDaddy.com, LLC30 May 202212 Jul 202330 May 2024
608majlistemara.ma-4 Sep 202010 Sep 20244 Sep 2025
609majlissala.ma-7 Nov 201911 Dec 20247 Nov 2025
610majlisundangan.comHostinger, UAB6 Jun 202217 Jul 20236 Jun 2023
611majlisrhamna.ma-12 Jul 202111 Jul 202412 Jul 2025
612majlis-tetouan.ma-25 Apr 201927 May 202425 Apr 2025
613majlisilmi-tanger.ma-12 Feb 201414 Mar 202512 Feb 2026
614majlishtheatre.comGoDaddy.com, LLC4 Dec 20234 Dec 20234 Dec 2024
615majlisfahsanjara.ma-19 Oct 201519 Nov 202419 Oct 2025
616majlisschool.inGoDaddy.com, LLC19 Feb 202115 Feb 202319 Feb 2026
617majlisdigital.digitalNameCheap, Inc.19 Jun 202230 Aug 202319 Jun 2023
618majlisalmasih.comGoogle, Inc.28 Jun 20222 Jul 202428 Jun 2025
619majlisilmi-yacoub.ma-11 Oct 201010 Nov 202410 Oct 2025
620majlismaqbuldoa.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jul 202222 Aug 202311 Jul 2023
621majlis-ar.ma-21 Jul 202225 Jul 202421 Jul 2025
622majlis-ul-marifat-wal-yaqiin.comWix.com Ltd.22 Jul 202222 Jun 202422 Jul 2025
623majlisdatolsu.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Jul 202216 Mar 202526 Jul 2026
624majlispusatkebajikansemalaysiacawanganlangkapperak.comGoogle, Inc.2 Aug 202218 Jul 20242 Aug 2025
625majlisamalat.comMedia Elite Holdings Limited2 Aug 20223 Aug 20232 Aug 2023
626majlisdakwahnegara.netNamesilo, LLC24 Feb 202519 Apr 202524 Feb 2026
627majliswarisshahuk.comGoDaddy.com, LLC10 Aug 202210 Aug 202210 Aug 2027
628majlisamanah.comNameCheap, Inc.12 Aug 202224 Oct 202312 Aug 2023
629majlisalrayyan.comGoDaddy.com, LLC30 Aug 202211 Nov 202330 Aug 2023
630majlisim.orgGoogle, Inc.3 Sep 202225 Aug 20243 Sep 2025
631majlistti.orgGoDaddy.com, LLC6 Sep 20228 Sep 20246 Sep 2025
632majlisku.appGoogle, Inc.6 Sep 202227 Aug 20246 Sep 2025
633majlisaslamdanaina.infoGoogle, Inc.9 Sep 202230 Aug 20249 Sep 2025
634majlis-dubai.comTucows Domains Inc.2 Oct 202225 Sep 20242 Oct 2025
635majlisresto.comGoogle, Inc.7 Oct 20228 Oct 20237 Oct 2024
636majlisbombay.comDynadot, LLC12 Oct 202222 Dec 202312 Oct 2023
637majlisology.comAmazon Registrar, Inc.11 Oct 20227 Sep 202411 Oct 2025
638majlistrip.comGoDaddy.com, LLC31 Oct 20221 Nov 202431 Oct 2025
639majlisonline.comRealtime Register B.V.3 Nov 202217 Dec 20233 Nov 2023
640majlisquranazzainiah.netGoogle, Inc.4 Nov 20224 Dec 20244 Nov 2024
641majlisx.comGoDaddy.com, LLC8 Nov 202221 Nov 20248 Nov 2025
642majlisbuilders.comGoDaddy.com, LLC9 Nov 202221 Jan 20249 Nov 2023
643majliskami.xyzNameCheap, Inc.23 Nov 202224 Nov 202323 Nov 2024
644majlisaljubailtradingest.comWeb Commerce Communications Limited dba WebNic.cc1 Dec 20221 Dec 20221 Dec 2024
645majlis-eskan.orgeNom, Inc.5 Dec 202215 Feb 20245 Dec 2023
646majlismap.comGoogle, Inc.4 Dec 202219 Nov 20244 Dec 2025
647majlishookahloungecafe.comGoDaddy.com, LLC5 Dec 20225 Dec 20225 Dec 2027
648majlisdesign.comHostinger, UAB6 Dec 20229 Nov 20246 Dec 2025
649majlissi.ma-1 Nov 20241 Nov 20241 Nov 2025
650majlisnet.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED13 Dec 202220 Jan 202413 Dec 2023
651majlistore.comGoDaddy.com, LLC4 May 20228 May 20254 May 2026
652majlisna.orgGoDaddy.com, LLC29 Oct 20243 Nov 202429 Oct 2025
653majlisalazhar.comCV. Jogjacamp19 Dec 202213 Dec 202419 Dec 2025
654majliseishaatulislamtrust.orgPDR Ltd. d/b/a PublicDomainRegistry.com26 Dec 20226 Feb 202426 Dec 2023
655majlis2002.comGoDaddy.com, LLC3 Jan 202314 Feb 20253 Jan 2025
656majlisrestaurent.comGoDaddy.com, LLC5 Jan 20236 Jan 20255 Jan 2026
657majlisdar.orgNETIM SARL9 Jan 20239 Jan 20249 Jan 2025
658majlisngos.comGoDaddy.com, LLC17 Jan 202317 Jan 202317 Jan 2026
659majlismohamedbinzayed.comMarcaria.com International, Inc.18 Jan 202320 Dec 202418 Jan 2026
660majlisoman.om----
661majlisexpo.comGoogle, Inc.25 Jan 20234 Jun 202425 Jan 2026
662majlissidikacem.ma-30 Jul 20212 Aug 202430 Jul 2025
663majlisnurussadah.onlineHostinger, UAB16 Feb 202324 Mar 202416 Feb 2024
664majlisweldingworks.comTucows Domains Inc.22 Feb 20233 Apr 202422 Feb 2024
665majlismarket.comDropCatch.com 1225 LLC12 May 202413 May 202412 May 2025
666majlisbarcelona.comArsys Internet, S.L. dba NICLINE.COM21 Oct 201822 Oct 202421 Oct 2025
667majlisrabat.comNameCheap, Inc.14 Jan 201915 Jan 202514 Jan 2026
668majlisayah.comTucows Domains Inc.2 Oct 202012 Nov 20232 Oct 2023
669majlismall.comNameCheap, Inc.21 Mar 202325 Feb 202421 Mar 2025
670majlis-e-sahebzadagan.comNameCheap, Inc.3 Jul 20218 Jul 20243 Jul 2025
671majlisart.comeNom, Inc.5 Nov 20212 Nov 20245 Nov 2025
672majlisfuture.comeNom, Inc.5 Nov 20212 Nov 20245 Nov 2025
673majlisekuinmalaysia.comGoDaddy.com, LLC24 Dec 20214 Feb 202424 Dec 2023
674majlisolpad.comWix.com Ltd.29 Dec 20219 Mar 202429 Dec 2023
675majlisilmi.comCosmotown, Inc.5 Jun 20224 Jun 20245 Jun 2025
676majlisabulalamayn.comCloudFlare, Inc.16 Jun 202219 Jun 202416 Jun 2025
677majlisrakyat.comNamesilo, LLC11 Jul 202212 Sep 202311 Jul 2023
678majlismerahputih.comCV. Rumahweb Indonesia25 Apr 20235 Jun 202425 Apr 2024
679majlisbahrain.orgGoDaddy.com, LLC22 Jan 201822 Jul 202422 Jan 2026
680majlisartforum.orgGoDaddy.com, LLC30 Sep 20186 Sep 202430 Sep 2025
681majlisatlanta.comWix.com Ltd.26 Apr 202327 Mar 202526 Apr 2026
682majliss.orgeNom, Inc.8 Jan 201912 Jan 20258 Jan 2026
683majliswatch.orgGoDaddy.com, LLC30 Jan 201916 Mar 202530 Jan 2026
684majliskhalid.orgGoDaddy.com, LLC5 May 20196 May 20255 May 2026
685majlisulama.orgTucows Domains Inc.6 Dec 201926 Nov 20246 Dec 2025
686majlispusatsg.orgNameCheap, Inc.9 Apr 20209 Apr 20259 Apr 2026
687majlisaldaewa.orgDomain.com, LLC14 Dec 20204 Dec 202414 Dec 2025
688majlis-telco.orgGandi SAS11 Jul 20212 Jul 202411 Jul 2025
689majlis-telecom.orgGandi SAS11 Jul 20212 Jul 202411 Jul 2025
690majlistelco.orgGandi SAS11 Jul 20212 Jul 202411 Jul 2025
691majlis-shabab.qa--22 Mar 2025-
692majlislondon.co.uk-10 Nov 202026 Jul 202310 Nov 2023
693majlisstar.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED13 May 202320 Jun 202413 May 2024
694majlisfl.orgSquarespace Domains LLC14 Aug 202419 Aug 202414 Aug 2025
695majliscoffee.comGoogle, Inc.26 May 20231 Jun 202426 May 2025
696majlisthmanyah.xyzNameCheap, Inc.27 May 20238 Jul 202427 May 2024
697majlismohamedbinzayed.ae----
698majlis7.netNameCheap, Inc.22 Jun 202322 Jun 202322 Jun 2027
699majliscom.orgHostinger, UAB23 Jun 20237 Aug 202423 Jun 2025
700majlisshoppingcenter.qa--21 Nov 2024-
701majlisbelialabuan.orgGoogle, Inc.31 Jul 202314 Sep 202431 Jul 2025
702majliso.comCloudFlare, Inc.31 Jul 20233 Aug 202431 Jul 2025
703majlisa.comCloudFlare, Inc.31 Jul 20233 Aug 202431 Jul 2025
704majlisfinder.comGoogle, Inc.3 Aug 202320 Jul 20243 Aug 2025
705majliskuzhimandhi.comGoDaddy.com, LLC3 Aug 20234 Aug 20233 Aug 2026
706majlistar.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED8 Aug 202315 Oct 20248 Aug 2024
707majlisai.comCloudFlare, Inc.13 Aug 20233 Aug 202413 Aug 2025
708majlis4u.comTucows Domains Inc.16 Aug 202312 Aug 202416 Aug 2025
709majlisluxe.comRealtime Register B.V.4 Sep 20239 Aug 20244 Sep 2025
710majlisselawat.comCosmotown, Inc.7 Sep 202318 Oct 20247 Sep 2024
711majlistrustkosamba.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Sep 202310 Oct 202414 Sep 2025
712majlisonlinee.comCSL Computer Service Langenbach GmbH d/b/a joker.c…16 Sep 202316 Oct 202416 Sep 2024
713majlisaldaewa.onlineDomain.com, LLC19 Sep 20232 Dec 202419 Sep 2024
714majlisshalawat.comGoDaddy.com, LLC24 Jan 202524 Jan 202524 Jan 2026
715majlismiaow.comGoDaddy.com, LLC4 Oct 202316 Dec 20244 Oct 2024
716majlistales.comNameCheap, Inc.17 Oct 20231 Oct 202417 Oct 2025
717majlishtheatre.nl-3 Jun 202322 Jun 2024-
718majlisofficial.comNameCheap, Inc.18 Oct 202318 Sep 202418 Oct 2025
719majlisalmollak.comNameCheap, Inc.26 Oct 202329 Oct 202426 Oct 2025
720majlistea.comGoogle, Inc.31 Oct 202316 Oct 202431 Oct 2025
721majlis-stuga-jokkmokk-rental.comWix.com Ltd.2 Nov 20235 Nov 20232 Nov 2025
722majlisy.comHostinger, UAB2 Nov 202316 Dec 20242 Nov 2024
723majlisupdates.in-4 Sep 20238 Sep 20244 Sep 2025
724majlis-stuga-jokkmokk.comWix.com Ltd.4 Nov 20234 Nov 20234 Nov 2025
725majlisilmireviews.comHosting Concepts B.V. dba Openprovider18 Nov 202315 Dec 202418 Nov 2025
726majlisandmarkets.comGoDaddy.com, LLC22 Nov 202319 Nov 202422 Nov 2025
727majlismart.comGoDaddy.com, LLC17 Mar 202528 Apr 202517 Mar 2026
728majlis2024.comNameCheap, Inc.5 Dec 202316 Jan 20255 Dec 2024
729majlis24.comNameCheap, Inc.5 Dec 202316 Jan 20255 Dec 2024
730majlissouq.storeNameCheap, Inc.7 Dec 202318 Jan 20257 Dec 2024
731majlissouk.comNameCheap, Inc.11 Dec 202311 Nov 202411 Dec 2025
732majlis-al-hikma.comHostinger, UAB1 Jan 20245 Dec 20241 Jan 2026
733majlisalmazad.liveGoDaddy.com, LLC5 Jan 202418 Mar 20255 Jan 2025
734majlisalmazad.onlineGoDaddy.com, LLC5 Jan 202418 Mar 20255 Jan 2025
735majlisalmazad.comGoDaddy.com, LLC5 Jan 202416 Feb 20255 Jan 2025
736majlisclub.comGoDaddy.com, LLC7 Jan 20248 Jan 20257 Jan 2026
737majlishome.comNameCheap, Inc.9 Jan 202423 Mar 20259 Jan 2025
738majlisplay.comNameCheap, Inc.13 Jan 202413 Jan 202513 Jan 2026
739majliscare.comNameCheap, Inc.15 Jan 20248 Jan 202515 Jan 2026
740majlisfurniture.comHostinger, UAB16 Jan 202417 Mar 202416 Jan 2026
741majliskw.comTucows Domains Inc.24 Apr 202524 Apr 202524 Apr 2026
742majlisalakhbar.comGoDaddy.com, LLC26 Jan 202427 Jan 202526 Jan 2026
743majlisasaudia.comGoDaddy.com, LLC26 Jan 202424 Jan 202526 Jan 2026
744majlisrestaurants.comGoDaddy.com, LLC28 Jan 202411 Apr 202528 Jan 2025
745majlissalon.comGoDaddy.com, LLC1 Feb 20242 Feb 20251 Feb 2026
746majlissadoulesettat.comHosting Concepts B.V. dba Openprovider6 Feb 202411 Feb 20256 Feb 2026
747majlis-alkhalij.comGoDaddy.com, LLC9 Feb 202423 Apr 20259 Feb 2025
748majlisdar.comNameCheap, Inc.12 Feb 202412 Feb 202412 Feb 2026
749majlisdaawatulhaqq.orgGoDaddy.com, LLC13 Feb 20242 Sep 202413 Feb 2027
750majlisdaawatulhaqq.comGoDaddy.com, LLC13 Feb 202430 May 202413 Feb 2029
751majlis24pnc.comGoDaddy.com, LLC15 Feb 202416 Feb 202515 Feb 2026
752majlisshop.comDynadot, LLC16 Feb 202429 Mar 202516 Feb 2025
753majliskhaliji.shopDynadot, LLC24 Feb 202429 Feb 202424 Feb 2025
754majlis-al-hikma.siteHostinger, UAB25 Feb 202410 Apr 202525 Feb 2025
755majlishardwareuae.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Feb 202428 Apr 202526 Feb 2026
756majlismarket.onlineNameCheap, Inc.1 Mar 202412 Apr 20251 Mar 2025
757majlishotels.comSquarespace Domains LLC8 Mar 202421 Feb 20258 Mar 2026
758majlis8.comGoDaddy.com, LLC7 Mar 20248 Mar 20247 Mar 2027
759majlis24.netGoDaddy.com, LLC10 Mar 202411 Mar 202510 Mar 2026
760majlismode.comSquarespace Domains LLC15 Mar 20244 Mar 202515 Mar 2026
761majliskoovalloor.orgGoDaddy.com, LLC16 Mar 202418 Jan 202516 Mar 2027
762majlismarket.storeNameCheap, Inc.20 Mar 202421 Mar 202520 Mar 2026
763majlismarkets.comNameCheap, Inc.22 Mar 202423 Mar 202522 Mar 2026
764majlistore.storeNameCheap, Inc.25 Mar 202426 Mar 202525 Mar 2026
765majlismate.comGoDaddy.com, LLC26 Mar 202410 Nov 202426 Mar 2025
766majlissmarket.comOne.com A/S30 Mar 202431 Mar 202530 Mar 2026
767majlishpurhighschool.comWeb Commerce Communications Limited dba WebNic.cc5 Apr 20246 Apr 20255 Apr 2026
768majlisdev.comGoDaddy.com, LLC10 Apr 20249 Apr 202510 Apr 2026
769majlisculture.inNameCheap, Inc.2 Mar 20227 Mar 20222 Mar 2027
770majlismarkets.shopNameCheap, Inc.23 Feb 20247 Mar 202423 Feb 2025
771majlismarket.shopNameCheap, Inc.15 Mar 20237 Mar 202415 Mar 2025
772majlismocha.comGoDaddy.com, LLC29 Apr 202429 Apr 202429 Apr 2027
773majlissbusinesstv.comWix.com Ltd.2 May 20241 Jun 20242 May 2026
774majlismedia.comGoDaddy.com, LLC5 May 20246 May 20255 May 2026
775majlisbahrain.comGoDaddy.com, LLC9 May 20249 May 20249 May 2025
776majlis20.comGoDaddy.com, LLC28 May 202428 May 202428 May 2025
777majlisflowers.onlineGoDaddy.com, LLC6 Jun 202430 Jul 20246 Jun 2025
778majliskami.infoPDR Ltd. d/b/a PublicDomainRegistry.com7 Jun 202423 Jun 20247 Jun 2025
779majlisretreats.comGoDaddy.com, LLC19 Jun 202419 Jun 202419 Jun 2027
780majlisms.comGoDaddy.com, LLC27 Jun 202427 Jun 202427 Jun 2025
781majlis4ppl.comGoDaddy.com, LLC1 Jul 202421 Oct 20241 Jul 2025
782majliscode.comLigne Web Services SARL2 Jul 20242 Jul 20242 Jul 2025
783majlis-mart.comGoDaddy.com, LLC2 Jul 20242 Jul 20242 Jul 2025
784majlisss.comGoDaddy.com, LLC7 Jul 20247 Jul 20247 Jul 2025
785majlisnearby.comGoDaddy.com, LLC13 Jul 20243 Aug 202413 Jul 2027
786majlisdeal.comNameCheap, Inc.23 Jul 20248 Aug 202423 Jul 2025
787majlis-archive.netPDR Ltd. d/b/a PublicDomainRegistry.com31 Jul 202430 Sep 202431 Jul 2025
788majlismats.comTucows Domains Inc.20 Aug 202420 Aug 202420 Aug 2025
789majliseirshad.comRealtime Register B.V.24 Aug 202424 Aug 202424 Aug 2025
790majlisi.eventsGoDaddy.com, LLC26 Aug 202431 Aug 202426 Aug 2025
791majlisbukharimalaysia.comGoDaddy.com, LLC26 Aug 202426 Aug 202426 Aug 2025
792majlisalsirat.infoGoDaddy.com, LLC27 Aug 20241 Sep 202427 Aug 2025
793majlissirat.infoGoDaddy.com, LLC27 Aug 20241 Sep 202427 Aug 2025
794majlisalsirat.orgGoDaddy.com, LLC27 Aug 20241 Sep 202427 Aug 2025
795majlissirat.orgGoDaddy.com, LLC27 Aug 20241 Sep 202427 Aug 2025
796majlisalsirat.xyzGoDaddy.com, LLC27 Aug 202430 Oct 202427 Aug 2025
797majlissirat.xyzGoDaddy.com, LLC27 Aug 202430 Oct 202427 Aug 2025
798majlissirat.comGoDaddy.com, LLC27 Aug 202427 Aug 202427 Aug 2027
799majlisalsirat.comGoDaddy.com, LLC27 Aug 202427 Aug 202427 Aug 2027
800majlistindakanrakyatkelantan.comNameCheap, Inc.27 Aug 202427 Aug 202427 Aug 2025
801majlisalsirat.netGoDaddy.com, LLC27 Aug 202427 Aug 202427 Aug 2025
802majlissirat.netGoDaddy.com, LLC27 Aug 202427 Aug 202427 Aug 2025
803majlishub.comCronon AG28 Aug 202417 Oct 202428 Aug 2025
804majlisabishooftuu.comCosmotown, Inc.3 Sep 20243 Sep 20243 Sep 2025
805majlis-ngos.orgeNom, Inc.8 Sep 202413 Sep 20248 Sep 2025
806majlisalbarzakh.id-28 Nov 2024-28 Nov 2025
807majlispolytechnic.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Sep 202418 Nov 202418 Sep 2025
808majlis01.comGoDaddy.com, LLC20 Sep 202420 Sep 202420 Sep 2027
809majlisok.comNameCheap, Inc.27 Sep 202427 Sep 202427 Sep 2025
810majlismeals.comNetwork Solutions, LLC29 Sep 202429 Sep 202429 Sep 2026
811majlisefiqhi.comHostinger, UAB2 Oct 20242 Dec 20242 Oct 2025
812majlisrugs.comGoDaddy.com, LLC7 Oct 20247 Oct 20247 Oct 2025
813majlisuae.comGoDaddy.com, LLC7 Oct 20247 Oct 20247 Oct 2025
814majlisco.comGoDaddy.com, LLC8 Oct 20248 Oct 20248 Oct 2025
815majlisflooring.comGoDaddy.com, LLC8 Oct 20248 Oct 20248 Oct 2025
816majlis-juskan-arts.comWix.com Ltd.15 Oct 202415 Oct 202415 Oct 2026
817majlisalnaqbeen.comFastDomain Inc.16 Oct 202416 Oct 202416 Oct 2025
818majlisp.comNameCheap, Inc.19 Oct 202419 Oct 202419 Oct 2025
819majlis-ai.comeNom, Inc.23 Oct 202423 Oct 202423 Oct 2026
820majliscircle.com1&1 Internet AG25 Oct 202425 Oct 202425 Oct 2025
821majlismakeupsmannos.funNameCheap, Inc.26 Oct 202411 Nov 202426 Oct 2025
822majliss.clubTucows Domains Inc.1 Nov 20246 Nov 20241 Nov 2025
823majlisagbeck.se-22 Mar 201320 Mar 202522 Mar 2026
824majlisululamaguntur.comNordreg AB14 Nov 202414 Nov 202414 Nov 2025
825majliskesyukuran.siteNameCheap, Inc.18 Nov 202423 Nov 202418 Nov 2025
826majliskesyukuran.onlineHostinger, UAB18 Nov 202423 Nov 202418 Nov 2025
827majlismakarimalloy.blogNameCheap, Inc.21 Nov 202427 Nov 202421 Nov 2025
828majlisarabia.comWix.com Ltd.21 Nov 202421 Nov 202421 Nov 2026
829majlisalitqan.comNameCheap, Inc.23 Nov 202423 Nov 202423 Nov 2025
830majlisona.comNameCheap, Inc.30 Nov 202430 Nov 202430 Nov 2025
831majlisia.comBigRock Solutions Ltd.3 Dec 20242 Feb 20253 Dec 2025
832majlisiauae.comNameCheap, Inc.5 Dec 20245 Dec 20245 Dec 2025
833majlissubulussalaam.com-11 Dec 202411 Dec 202411 Dec 2026
834majlis-arabi.comName.com, Inc.10 Dec 202410 Dec 202410 Dec 2025
835majlisrestaurant.uk-10 Dec 202410 Dec 202410 Dec 2025
836majlistaklimabuya.comMetaregistrar BV Applications15 Dec 202420 Dec 202415 Dec 2025
837majlisllc.comNordreg AB23 Dec 202423 Dec 202423 Dec 2025
838majliscanada.orgeNom, Inc.26 Dec 202431 Dec 202426 Dec 2025
839majliscanada.comeNom, Inc.26 Dec 202426 Dec 202426 Dec 2025
840majlisbythesea.comGoDaddy.com, LLC7 Jan 20257 Jan 20257 Jan 2026
841majlisnow.onlineNameCheap, Inc.8 Jan 202513 Feb 20258 Jan 2026
842majlisroom.comGoDaddy.com, LLC8 Jan 20258 Jan 20258 Jan 2026
843majlisqa.comHostinger, UAB9 Jan 202511 Mar 20259 Jan 2026
844majlis-madani.org1&1 Internet AG11 Jan 20258 Mar 202511 Jan 2026
845majlismohammed.comName.com, Inc.13 Jan 202513 Jan 202513 Jan 2026
846majlismart.xyzNameCheap, Inc.14 Jan 202513 Feb 202514 Jan 2026
847majlispoly.in-25 Feb 202425 Feb 202525 Feb 2025
848majlisaluqool.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Jan 202520 Mar 202518 Jan 2026
849majlispurbaya.comHostinger, UAB26 Jan 202528 Mar 202526 Jan 2026
850majlisgo.comHostinger, UAB29 Jan 202529 Jan 202529 Jan 2028
851majlis-gulf.comNameCheap, Inc.1 Feb 20251 Feb 20251 Feb 2026
852majlisukforfurniture.comName.com, Inc.9 Feb 20259 Feb 20259 Feb 2026
853majlisgrowth.comSquarespace Domains LLC10 Feb 202510 Feb 202510 Feb 2028
854majliscinta.comGoDaddy.com, LLC10 Feb 202510 Feb 202510 Feb 2026
855majlistan.comGoDaddy.com, LLC11 Feb 202511 Feb 202511 Feb 2026
856majlisallayali.comWix.com Ltd.13 Feb 202513 Feb 202513 Feb 2026
857majlispropfirm.comGoDaddy.com, LLC15 Feb 202515 Feb 202515 Feb 2026
858majlisproprietaryfirm.comGoDaddy.com, LLC15 Feb 202515 Feb 202515 Feb 2026
859majlisulj14.onlineTucows Domains Inc.17 Feb 202510 Mar 202517 Feb 2026
860majlisdates.comHostinger, UAB17 Feb 202517 Feb 202517 Feb 2026
861majlisgames.comNameCheap, Inc.18 Feb 202518 Feb 202518 Feb 2026
862majlisae.comGoDaddy.com, LLC20 Feb 202520 Feb 202520 Feb 2027
863majlisgulf.comDynadot, LLC24 Feb 202524 Feb 202524 Feb 2026
864majlisserver.comGoDaddy.com, LLC25 Feb 202525 Feb 202525 Feb 2026
865majlis77.comName.com, Inc.25 Feb 202525 Feb 202525 Feb 2026
866majlismohammadbinthani.comGoDaddy.com, LLC3 Mar 20253 Mar 20253 Mar 2026
867majlismart.storeNameCheap, Inc.4 Mar 20251 Apr 20254 Mar 2026
868majlismanara.comSquarespace Domains LLC4 Mar 20254 Mar 20254 Mar 2027
869majlispod.comGoDaddy.com, LLC15 Mar 202515 Mar 202515 Mar 2026
870majlismoment.comGoDaddy.com, LLC17 Mar 202517 Mar 202517 Mar 2026
871majlismoments.comGoDaddy.com, LLC17 Mar 202517 Mar 202517 Mar 2026
872majlisgeforce.com-19 Mar 202519 Mar 202519 Mar 2026
873majlisullerart.se-20 Mar 202520 Mar 202520 Mar 2026
874majlison.com-25 Mar 202525 Mar 202525 Mar 2026
875majlismaimoen.orgCV. Rumahweb Indonesia2 Apr 20253 Apr 20252 Apr 2026
876majlismaimoen.comCV. Rumahweb Indonesia2 Apr 20253 Apr 20252 Apr 2026
877majliss.storeGoDaddy.com, LLC3 Apr 20253 Apr 20253 Apr 2026
878majlissindian.comKey-Systems GmbH3 Apr 20253 Apr 20253 Apr 2026
879majlisrestaurant.linkPDR Ltd. d/b/a PublicDomainRegistry.com5 Apr 20255 Apr 20255 Apr 2026
880majliscrunch.onlineTucows Domains Inc.7 Apr 20257 Apr 20257 Apr 2026
881majliscrunch.comTucows Domains Inc.7 Apr 20257 Apr 20257 Apr 2028
882majlistrackermv.comHostinger, UAB19 Apr 202519 Apr 202519 Apr 2026
883majlispro.techHostinger, UAB20 Apr 202520 Apr 202520 Apr 2026
884majlisapprovals.comHostinger, UAB20 Apr 202520 Apr 202520 Apr 2026
885majlisuahlilquran.orgWeb4Africa Inc24 Apr 202524 Apr 202524 Apr 2026
886majliswanfahmibaizura.comWeb Commerce Communications Limited dba WebNic.cc1 May 20251 May 20251 May 2026
887majlis-kita.comWeb Commerce Communications Limited dba WebNic.cc2 May 20252 May 20252 May 2026
888majlissiri.comName.com, Inc.5 May 20255 May 20255 May 2026
889majlishypermarket.comNameCheap, Inc.6 May 20256 May 20256 May 2026
890majlisgabunganbeliamelaka.comGoogle, Inc.14 May 202514 May 202514 May 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=majlis

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now