Our database now contains whois records of 556 Million (556,070,815) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1563 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [556 Million Domains] $10,000 Details

Keyword: MAIDSERVICE

Reverse Whois » KEYWORD [maidservice ]  { 1,319 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1maidservice.laReserved for non-billable transactions where Regis…24 Sep 20165 Oct 201624 Sep 2017
2maidservice.xyzDynadot, LLC5 Feb 20245 Feb 20245 Feb 2025
3maidservice.directory-29 Jun 201429 Jun 201429 Jun 2015
4maidservice.expertGoDaddy.com, LLC13 Jul 201412 Jun 202313 Jul 2024
5maidservice.cleaningGoDaddy.com, LLC13 Jul 201412 Jun 202313 Jul 2024
6maidservice.vegaseNom, Inc.15 Sep 201428 Jan 202015 Sep 2024
7maidservice.workGoDaddy.com, LLC11 Aug 201511 Aug 201511 Aug 2016
8maidservice.worldGoDaddy.com, LLC6 Mar 202411 Mar 20246 Mar 2025
9maidservice.businessGoDaddy.com, LLC28 May 201528 May 201528 May 2016
10maidservice.helpGoDaddy.com, LLC9 Jul 20159 Jul 20159 Jul 2016
11maidservice.onlineNameCheap, Inc.9 May 20189 Apr 20249 May 2025
12maidservice.infoGoDaddy.com, LLC23 Aug 202328 Aug 202323 Aug 2024
13maidservice.topChengdu West Dimension Digital Technology Co., Ltd…30 Sep 2015-30 Sep 2016
14maidservice.momUniregistrar Corp6 May 201616 Jun 20176 May 2017
15maidservice.comCloudFlare, Inc.4 Mar 199914 Apr 20244 Mar 2033
16maidservice.companyGoDaddy.com, LLC22 May 201410 May 201722 May 2018
17maidservice.reviewsGoDaddy.com, LLC9 Jul 201419 Sep 20179 Jul 2017
18maidservice.bizEpik Inc.18 May 201719 Dec 202317 May 2025
19maidservice.mobiGoDaddy.com, LLC16 May 201327 Jun 202016 May 2021
20maidservice.netGoDaddy.com, LLC28 Mar 199928 Mar 202427 Mar 2025
21maidservice.orgCloudFlare, Inc.8 Nov 200112 Apr 20248 Nov 2025
22maidservice.usEpik Inc.13 Jul 202028 Jul 202113 Jul 2021
23maidservice.telName.com, Inc.2 Jun 20112 Jun 20231 Jun 2024
24maidservice.linkUniregistrar Corp26 Jan 201731 Jan 201726 Jan 2018
25maidservice.fyiGoDaddy.com, LLC10 Jun 201729 Sep 201710 Jun 2018
26maidservice.rockseNom, Inc.10 Oct 201710 Oct 201710 Oct 2018
27maidservice.marketeNom, Inc.10 Oct 201710 Oct 201710 Oct 2018
28maidservice.liveeNom, Inc.10 Oct 201710 Oct 201710 Oct 2018
29maidservice.saleeNom, Inc.10 Oct 201710 Oct 201710 Oct 2018
30maidservice.todayGoDaddy.com, LLC1 Jun 202319 Aug 20231 Jun 2024
31maidservice.universityNameCheap, Inc.21 Nov 201822 Nov 201821 Nov 2019
32maidservice.partnersGoDaddy.com, LLC4 Oct 20199 Oct 20194 Oct 2020
33maidservice.homesGlobal Domains International, Inc. DBA DomainCostC…3 Sep 20192 Nov 20193 Sep 2020
34maidservice.siteHostinger, UAB20 May 202331 Aug 202320 May 2024
35maidservice.proNameCheap, Inc.10 Dec 202315 Dec 202310 Dec 2024
36maidservice.uk-3 Jul 20194 Sep 20233 Jul 2024
37maidservice.cloudGMO Internet Inc.29 Sep 202129 Sep 202129 Sep 2022
38maidservice.ae----
39maidservice.appKey-Systems, LLC8 May 20188 May 20248 May 2025
40maidservice.ccNameCheap, Inc.26 Jan 20239 Mar 202426 Jan 2024
41maidservice.lifeGoDaddy.com, LLC3 Feb 202316 Mar 20243 Feb 2024
42maidservice.storeGoDaddy.com, LLC27 Mar 202328 Mar 202427 Mar 2025
43maidservice.co.inGoDaddy.com, LLC30 Aug 202211 Oct 202330 Aug 2023
44maidservice.it-28 Aug 201230 Sep 202330 Sep 2024
45maidservice.co.jp--1 Sep 2023-
46maidservice.websiteKey-Systems, LLC23 Oct 20195 Jan 202423 Oct 2023
47maidservice.softwareGoDaddy.com, LLC4 Nov 202019 Dec 20234 Nov 2024
48maidservice.co.uk-6 Dec 19998 Dec 20236 Dec 2024
49maidservice.tokyoGMO Internet Inc.31 Aug 202322 Mar 202431 Aug 2024
50maidservice.bondKey-Systems, LLC24 Dec 202311 Feb 202424 Dec 2024
51maidservice.funDNSPod, Inc.27 Feb 20243 Mar 202427 Feb 2025
52maidservice.asiaDNSPod, Inc.6 Mar 202411 Mar 20246 Mar 2025
53maidservice.spaceGoDaddy.com, LLC11 Mar 202425 Apr 202411 Mar 2025
54maidservice.clubGoDaddy.com, LLC26 May 20148 Jun 202325 May 2024
55maidservice.nl-11 Mar 20141 Apr 2022-
56maidservice.cfdNameCheap, Inc.22 Apr 202422 Apr 202422 Apr 2025
57maidservice.ru-24 May 2011-24 May 2024
58maidservice.de--10 Aug 2011-
59maidservice.euRealtime Register B.V.---
60maidservices.comGoDaddy.com, LLC25 Jun 199725 Jun 202324 Jun 2024
61maidservice-newjersey.comGoDaddy.com, LLC25 May 201426 May 201525 May 2016
62maidserviceatx.comGoDaddy.com, LLC26 May 201427 May 201526 May 2016
63maidservicesmiami.comTradewinds Names, LLC25 May 20231 Feb 202425 May 2024
64maidservicecleaning.comGoDaddy.com, LLC9 Aug 20179 Aug 20239 Aug 2024
65maidservicevancouverbc.comDynadot, LLC11 Nov 202011 Nov 202011 Nov 2021
66maidservicecanada.comGoDaddy.com, LLC28 Oct 201430 Oct 202328 Oct 2024
67maidservicejacksonville.comGoDaddy.com, LLC19 Jul 201930 Sep 202319 Jul 2023
68maidservicenewyorkcity.comNameKing.com Inc.26 Jun 202019 Dec 202326 Jun 2024
69maidservicesanfrancisco.comNameKing.com Inc.14 Sep 202014 Sep 202014 Sep 2021
70maidservicesanjose.comNameKing.com Inc.13 May 202013 May 202013 May 2021
71maidservicewashington.comGoDaddy.com, LLC6 Jan 20107 Jan 20156 Jan 2016
72maidservicesoklahomacity.comGoDaddy.com, LLC19 Sep 201229 Aug 201419 Sep 2015
73maidservices.bizGoDaddy.com, LLC6 Jul 201818 Jul 20236 Jul 2024
74maidservicefortworth.neteNom, Inc.31 Oct 201431 Oct 201431 Oct 2015
75maidservicebocaraton.orgGoDaddy.com, LLC11 Jun 201423 Jun 201511 Jun 2016
76maidservicefullerton.comGoDaddy.com, LLC4 Nov 20145 Nov 20234 Nov 2024
77maidservicewichita.com----
78maidservicekatytx.comWild West Domains, LLC18 Jun 201319 Jun 201518 Jun 2016
79maidserviceatlantaga.orgGoDaddy.com, LLC16 Jul 202030 Aug 202316 Jul 2024
80maidservices.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…13 Mar 202321 Apr 202413 Mar 2024
81maidservicesfortworth.comGoDaddy.com, LLC20 May 201920 May 201920 May 2020
82maidservicesupply.comeNom, Inc.19 Aug 201419 Aug 201419 Aug 2015
83maidserviceelpaso.neteNom, Inc.4 Nov 20144 Nov 20144 Nov 2015
84maidservicealbuquerque.comGoDaddy.com, LLC11 Nov 201612 Nov 202311 Nov 2024
85maidservicecharlotte.comGoDaddy.com, LLC18 Apr 202418 Apr 202418 Apr 2025
86maidservicecincinnati.comTucows Domains Inc.17 Aug 201919 Jul 202317 Aug 2024
87maidservicenashville.comNameCheap, Inc.2 Feb 202418 Feb 20242 Feb 2025
88maidservicemiami.orgTucows Domains Inc.8 Aug 201312 Aug 20148 Aug 2015
89maidserviceselite.comTucows Domains Inc.12 Aug 201416 Aug 201512 Aug 2016
90maidserviceweston.comTucows Domains Inc.11 Aug 201314 Aug 201411 Aug 2015
91maidservicealbuq.comGoDaddy.com, LLC28 Aug 201416 Sep 202228 Aug 2024
92maidservicehoustontx.comGoDaddy.com, LLC20 Jan 201720 Jan 201720 Jan 2018
93maidservicesfortlauderdale.comGoDaddy.com, LLC5 Nov 20185 Nov 20185 Nov 2019
94maidservicechicagoil.comTucows Domains Inc.29 Aug 20111 Sep 201429 Aug 2015
95maidservicelansing.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
96maidservice-marietta.comregister.com, Inc.18 Sep 201418 Sep 201418 Sep 2015
97maidservice-chicago.comInterweb Advertising D.B.A. Profile Builder5 Sep 20145 Sep 20145 Sep 2015
98maidservicepontevedra.comCorehub, S.R.L.23 Dec 20111 Oct 201423 Dec 2014
99maidservice-jacksonville.comCorehub, S.R.L.23 Dec 20111 Oct 201423 Dec 2014
100maidservicemorencimi.comWild West Domains, LLC4 Oct 20144 Oct 20144 Oct 2015
101maidservicetacoma.com1&1 Internet AG21 Nov 201421 Nov 201421 Nov 2015
102maidserviceoakland.comGoDaddy.com, LLC29 Sep 201429 Sep 201429 Sep 2015
103maidservicesacramento.comGoDaddy.com, LLC28 Sep 201428 Sep 201428 Sep 2015
104maidservicecleveland.comGoDaddy.com, LLC14 Sep 202226 Oct 202314 Sep 2023
105maidservicestlouis.comGoDaddy.com, LLC18 Apr 201718 Apr 201718 Apr 2018
106maidserviceslasvegas.comNameKing.com Inc.17 Jul 202128 Dec 202317 Jul 2024
107maidservicefortlauderdale.com1&1 Internet AG5 Aug 20185 Aug 20185 Aug 2019
108maidservicesnorthridge.comGoDaddy.com, LLC13 Oct 201413 Oct 201413 Oct 2015
109maidservicesseattle.comNamesilo, LLC27 Aug 20224 May 202427 Aug 2024
110maidservicesballantyne.comTucows Domains Inc.3 Dec 20147 Dec 20153 Dec 2016
111maidservices.infoGoogle, Inc.5 Dec 20225 Dec 20235 Dec 2024
112maidservicenewark.comName.com, Inc.3 Dec 20143 Dec 20143 Dec 2015
113maidservicevannuys.comName.com, Inc.12 Dec 201412 Dec 201412 Dec 2015
114maidserviceprofessionals.comTucows Domains Inc.10 Dec 201314 Dec 201410 Dec 2015
115maidserviceconcord.comName.com, Inc.17 Dec 201417 Dec 201417 Dec 2015
116maidservicesanantonio.neteNom, Inc.17 Dec 201417 Dec 201417 Dec 2015
117maidserviceflowermound.comNameCheap, Inc.20 Dec 201420 Nov 202320 Dec 2024
118maidservice-4u.comTucows Domains Inc.26 Dec 201030 Dec 201426 Dec 2015
119maidservicephoenixaz.comregister.com, Inc.1 Jan 201529 Feb 20161 Jan 2018
120maidserviceknoxville.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2016
121maidservicesinc.xyzNetwork Solutions, LLC28 Jul 201429 Jul 201428 Jul 2015
122maidservices.nycGoDaddy.com, LLC15 Nov 202226 Mar 202415 Nov 2027
123maidservicealbuquerque.cleaning1API GmbH15 Oct 201415 Oct 201415 Oct 2015
124maidservicealbuquerque.club1API GmbH14 Oct 2014-13 Oct 2015
125maidservicesnaples.comGoDaddy.com, LLC11 Aug 201512 Aug 202311 Aug 2024
126maidservicelocalpros.comGoDaddy.com, LLC11 Aug 20151 Jul 201911 Aug 2020
127maidservices.cleaningeNom, Inc.27 Oct 201427 Oct 201427 Oct 2015
128maidservices.worldInstra Corporation Pty Ltd.22 Jan 201522 Jan 201522 Jan 2016
129maidservicesgainesville.comGoDaddy.com, LLC13 Aug 201513 Aug 201513 Aug 2016
130maidservicesclearwater.comGoDaddy.com, LLC13 Aug 201513 Aug 201513 Aug 2016
131maidservicessandiego.comGoDaddy.com, LLC26 Mar 201627 Mar 202426 Mar 2025
132maidservicesnola.comGoDaddy.com, LLC29 Jul 201610 Aug 201729 Jul 2018
133maidservicecoralsprings.com1&1 Internet AG5 Aug 20185 Aug 20185 Aug 2019
134maidservicesdenver.netName.com, Inc.8 Jan 20158 Jan 20158 Jan 2016
135maidservicesofthedmv.comregister.com, Inc.13 Jan 201513 Jan 201513 Jan 2016
136maidserviceshouston.comMypreciousdomain.com LLC7 Jan 202410 Jan 20247 Jan 2025
137maidservicereston.comTLD Registrar Solutions Ltd.15 Jan 201515 Jan 201615 Jan 2018
138maidserviceburbank.comDropCatch.com 680 LLC4 Apr 20184 Apr 20184 Apr 2019
139maidserviceashburn.comGoDaddy.com, LLC16 Jan 201516 Jan 201516 Jan 2016
140maidservices.linkNameCheap, Inc.27 Jun 20152 Jul 201527 Jun 2018
141maidservicepros.comGoDaddy.com, LLC25 May 202220 Sep 202225 May 2024
142maidservices.directoryeNom, Inc.22 Jul 201523 Jul 201722 Jul 2018
143maidserviceleads.comWild West Domains, LLC6 Aug 20187 Aug 20236 Aug 2024
144maidservicescharlotte.com-5 Nov 20165 Nov 20165 Nov 2017
145maidservicelocal.comGoDaddy.com, LLC28 Jan 201528 Jan 201528 Jan 2017
146maidserviceltd.comDropCatch.com 1181 LLC30 Apr 201830 Apr 201830 Apr 2019
147maidservice-richmondva.comGoDaddy.com, LLC31 Jan 201531 Jan 201531 Jan 2016
148maidservice-housecleaning.comGoDaddy.com, LLC31 Jan 201531 Jan 201531 Jan 2017
149maidservicestulsa.comWild West Domains, LLC3 Feb 20153 Feb 20243 Feb 2025
150maidservicelakenorman.comGoDaddy.com, LLC8 Mar 20248 Mar 20248 Mar 2025
151maidserviceapex.comGoDaddy.com, LLC25 Mar 202025 Mar 202025 Mar 2021
152maidserviceschicago.comNameCheap, Inc.11 Mar 202322 Apr 202411 Mar 2024
153maidservicelocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
154maidserviceimpactmarketing.comTucows Domains Inc.12 Feb 201516 Feb 201712 Feb 2017
155maidserviceincrva.comTucows Domains Inc.10 Feb 201414 Feb 201510 Feb 2016
156maidservicesindallastx.comeNom, Inc.21 Aug 201521 Aug 201521 Aug 2016
157maidservicebedfordview.comWild West Domains, LLC21 Aug 201521 Aug 201521 Aug 2016
158maidservicebuddy.comNameCheap, Inc.1 May 20241 May 20241 May 2025
159maidserviceottawa.comDomain.com, LLC18 Feb 20133 Feb 202418 Feb 2025
160maidservicenorthhills.comName.com, Inc.26 Feb 201526 Feb 201526 Feb 2016
161maidservicelathrop.comGoDaddy.com, LLC27 Feb 201527 Feb 201527 Feb 2016
162maidservicesandiego.comGoDaddy.com, LLC1 Mar 20152 Mar 20241 Mar 2025
163maidserviceautomation.comGoDaddy.com, LLC3 Mar 20153 Mar 20153 Mar 2016
164maidservicemarketing.comNameCheap, Inc.27 Dec 202327 Dec 202327 Dec 2024
165maidservicecharlotte.netName.com, Inc.5 Mar 20155 Mar 20155 Mar 2016
166maidserviceorangecounty.com-28 Feb 202313 May 202428 Feb 2024
167maidservicesbaltimore.comName.com, Inc.12 Mar 201512 Mar 201512 Mar 2016
168maidservicedc.orgGoDaddy.com, LLC11 Mar 201511 Mar 201511 Mar 2016
169maidservicesmarthasvineyard.comGoDaddy.com, LLC13 Mar 201513 Mar 201513 Mar 2016
170maidserviceinorangecountyca.comDNSPod, Inc.22 Oct 202022 Oct 202022 Oct 2021
171maidserviceairbnb.com1&1 Internet AG25 Aug 201526 Aug 201625 Aug 2017
172maidserviceaustin.infoGoDaddy.com, LLC14 Mar 2015-14 Mar 2016
173maidservicetyler.comGoDaddy.com, LLC17 Mar 201517 Mar 201517 Mar 2016
174maidservicestyler.comGoDaddy.com, LLC17 Mar 201517 Mar 201517 Mar 2016
175maidservicecolumbusoh.comTucows Domains Inc.18 Mar 201518 Mar 201518 Mar 2017
176maidservicechattanooga.comDomain.com, LLC20 Mar 201520 Apr 201520 Mar 2016
177maidserviceinqueensny.comeNom, Inc.26 Aug 201526 Aug 201526 Aug 2016
178maidservicespringtx.comGoDaddy.com, LLC23 Mar 201523 Mar 201523 Mar 2016
179maidserviceneworleans.comeNom, Inc.27 Aug 201527 Aug 201527 Aug 2016
180maidserviceslosangeles.com1&1 Internet AG27 Mar 201515 Mar 201827 Mar 2025
181maidservicestoday.comGoDaddy.com, LLC27 Feb 202027 Feb 202027 Feb 2021
182maidserviceplantation.comGoDaddy.com, LLC30 Mar 201530 Mar 201530 Mar 2017
183maidservicesaustin.comGoDaddy.com, LLC2 Apr 20152 Apr 20242 Apr 2025
184maidservicesprovo.comGoDaddy.com, LLC1 Sep 20151 Sep 20161 Sep 2017
185maidservicesapp.comeNom, Inc.1 Sep 201518 Aug 20161 Sep 2019
186maidservicehouston.orgTucows Domains Inc.1 Sep 20153 Aug 20171 Sep 2018
187maidserviceinvirginia.comGoDaddy.com, LLC31 Aug 201531 Aug 201531 Aug 2016
188maidserviceinarlington.comGoDaddy.com, LLC31 Aug 201531 Aug 201531 Aug 2016
189maidserviceinalexandria.comGoDaddy.com, LLC31 Aug 201531 Aug 201531 Aug 2016
190maidserviceincornelius.com1&1 Internet AG29 Aug 201529 Aug 201529 Aug 2016
191maidservicealbanyny.comGoDaddy.com, LLC8 Apr 20158 Apr 20158 Apr 2016
192maidservicementor.comGoDaddy.com, LLC11 Apr 201511 Apr 201511 Apr 2016
193maidservicecoach.comGoDaddy.com, LLC11 Apr 201511 Apr 201511 Apr 2016
194maidservicecleveland.netName.com, Inc.13 Apr 201513 Apr 201513 Apr 2016
195maidservicesmasonohio.comTucows Domains Inc.3 Sep 20137 Sep 20153 Sep 2016
196maidservicekings.comeNom, Inc.6 Sep 20158 Aug 20176 Sep 2018
197maidservicewestpalmbeach.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
198maidserviceindependence.comName.com, Inc.3 May 20153 May 20153 May 2016
199maidservicerates.comFastDomain Inc.5 May 201515 May 20175 May 2020
200maidserviceteam.comWest263 International Limited6 Oct 20206 Oct 20206 Oct 2021
201maidservicesrls.comRegister.it SPA11 Sep 201511 Sep 201511 Sep 2016
202maidservicehonolulu.comGoDaddy.com, LLC11 Sep 201511 Sep 201511 Sep 2016
203maidserviceseattle.netBR domain Inc. dba namegear.co2 Aug 20219 Oct 20212 Aug 2022
204maidservicemaplewood.comName.com, Inc.26 May 201526 May 201526 May 2016
205maidservicesfinder.comGoDaddy.com, LLC15 Sep 201515 Sep 202315 Sep 2024
206maidservicememphistn.comGoDaddy.com, LLC31 May 201531 May 201531 May 2016
207maidservicemn.comTucows Domains Inc.13 Sep 201017 Sep 201513 Sep 2016
208maidservicesantacruz.comName.com, Inc.6 Jun 20148 Jun 20156 Jun 2016
209maidservicesacramento.netName.com, Inc.17 Sep 201517 Sep 201517 Sep 2016
210maidserviceinpointlomaca.comeNom, Inc.11 Jun 201511 Jun 201511 Jun 2016
211maidservicess.com-1 Oct 20161 Oct 20161 Oct 2017
212maidservicebangkok.comregister.com, Inc.13 Jun 201515 Jun 201713 Jun 2018
213maidservicesinbayshoreny.comeNom, Inc.18 Sep 201518 Sep 201518 Sep 2016
214maidserviceflorida.comNameCheap, Inc.20 Nov 202021 Oct 202320 Nov 2024
215maidserviceslv.comTucows Domains Inc.12 Jun 201416 Jun 201512 Jun 2016
216maidservice-nyc.comGoDaddy.com, LLC20 Jun 201521 Jun 202320 Jun 2024
217maidservicesusa.comTierraNet Inc. d/b/a DomainDiscover21 Sep 201519 Sep 201621 Sep 2017
218maidservicesnewyork.com-23 Mar 202211 Apr 202423 Mar 2025
219maidserviceweb.comeNom, Inc.24 Sep 201531 Aug 201624 Sep 2017
220maidserviceswow.comeNom, Inc.24 Sep 201524 Sep 201524 Sep 2016
221maidservicesbay.comeNom, Inc.24 Sep 201524 Sep 201524 Sep 2016
222maidservicesace.comeNom, Inc.24 Sep 201524 Sep 201524 Sep 2016
223maidservicenorthmiami.comGoDaddy.com, LLC6 Jul 20156 Jul 20156 Jul 2016
224maidserviceberwyn.comGoDaddy.com, LLC7 Jul 20157 Jul 20157 Jul 2016
225maidservicesus.comKey-Systems GmbH17 Mar 202217 Aug 202317 Mar 2024
226maidservicesup.comeNom, Inc.9 Jul 20159 Jul 20159 Jul 2016
227maidservicesgo.comeNom, Inc.9 Jul 20159 Jul 20159 Jul 2016
228maidservicedelraybeach.comGoDaddy.com, LLC8 Jul 20158 Jul 20158 Jul 2016
229maidservicebocaraton.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
230maidservicesleaguecity.comGoDaddy.com, LLC9 Jul 20159 Jul 20159 Jul 2016
231maidservicewellingtonfl.comGoDaddy.com, LLC13 Jul 201513 Jul 201513 Jul 2016
232maidservicesweb.comeNom, Inc.15 Jul 201516 Jun 201715 Jul 2018
233maidservicesok.comeNom, Inc.15 Jul 201516 Jun 201715 Jul 2018
234maidserviceso.comeNom, Inc.15 Jul 201516 Jun 201715 Jul 2018
235maidservicecondocleaning.comGoDaddy.com, LLC16 Jul 201517 Jul 202316 Jul 2024
236maidserviceapartmentcleaning.comGoDaddy.com, LLC16 Jul 201517 Jul 202316 Jul 2024
237maidservicealexandria.comNameCheap, Inc.18 Aug 201719 Jul 202318 Aug 2024
238maidservicelongisland.usGoDaddy.com, LLC28 Sep 201526 Sep 201627 Sep 2017
239maidservice-longisland.usGoDaddy.com, LLC28 Sep 201526 Sep 201627 Sep 2017
240maidservice-longisland.comGoDaddy.com, LLC28 Sep 201528 Sep 201528 Sep 2016
241maidservicesdeals.comGoDaddy.com, LLC21 Jul 201513 Jul 201721 Jul 2018
242maidservicesdeal.comGoDaddy.com, LLC21 Jul 201513 Jul 201721 Jul 2018
243maidservicedeal.comGoDaddy.com, LLC17 Feb 202417 Feb 202417 Feb 2025
244maidservicechicago.netName.com, Inc.20 Jul 201520 Jul 201520 Jul 2016
245maidservicesuse.comeNom, Inc.22 Jul 201523 Jun 201722 Jul 2018
246maidservicesnew.comeNom, Inc.22 Jul 201523 Jun 201722 Jul 2018
247maidservicesjet.comeNom, Inc.22 Jul 201523 Jun 201722 Jul 2018
248maidserviceshub.comeNom, Inc.22 Jul 201523 Jun 201722 Jul 2018
249maidservicesget.comeNom, Inc.22 Jul 201523 Jun 201722 Jul 2018
250maidservicesbuy.comeNom, Inc.22 Jul 201523 Jun 201722 Jul 2018
251maidservicehillsborough.comGoDaddy.com, LLC23 Jul 201523 Jul 201523 Jul 2016
252maidservicesway.comeNom, Inc.29 Jul 201530 Jun 201729 Jul 2018
253maidservicestop.comeNom, Inc.29 Jul 201530 Jun 201729 Jul 2018
254maidservicestab.comeNom, Inc.29 Jul 201530 Jun 201729 Jul 2018
255maidservicesrun.comeNom, Inc.29 Jul 201529 Jul 201529 Jul 2016
256maidservicesone.comeNom, Inc.29 Jul 201530 Jun 201729 Jul 2018
257maidservicesnet.comeNom, Inc.29 Jul 201529 Jul 201529 Jul 2016
258maidservicesmax.comeNom, Inc.29 Jul 201529 Jul 201529 Jul 2016
259maidservicesfed.comeNom, Inc.29 Jul 201529 Jul 201529 Jul 2016
260maidservicesfan.comeNom, Inc.29 Jul 201529 Jul 201529 Jul 2016
261maidservicesfab.comeNom, Inc.29 Jul 201529 Jul 201529 Jul 2016
262maidservicesbig.comeNom, Inc.29 Jul 201530 Jun 201729 Jul 2018
263maidservicesall.comeNom, Inc.29 Jul 201530 Jun 201729 Jul 2018
264maidservicesrad.comeNom, Inc.6 Aug 20156 Aug 20156 Aug 2016
265maidservicepage.comeNom, Inc.6 Aug 20158 Jul 20176 Aug 2018
266maidservicesyes.comeNom, Inc.8 Aug 20158 Aug 20158 Aug 2016
267maidservicecoloradosprings.comGoDaddy.com, LLC12 Apr 20232 Apr 202412 Apr 2026
268maidservicekennesaw.comGoDaddy.com, LLC10 Aug 201510 Aug 201510 Aug 2016
269maidserviceeastlansing.usGoDaddy.com, LLC8 Oct 20158 Oct 20157 Oct 2016
270maidservicepaisley.comName.com, Inc.14 Oct 201514 Oct 201514 Oct 2016
271maidserviceusa.xyzNameCheap, Inc.15 Oct 201515 Oct 201515 Oct 2016
272maidservicesanantonio.comGoDaddy.com, LLC14 Mar 202319 Mar 202414 Mar 2025
273maidservicesnearyou.xyzNameCheap, Inc.20 Oct 201520 Oct 201520 Oct 2016
274maidservicemarietta.comName.com, Inc.20 Oct 201520 Oct 201520 Oct 2016
275maidservicepricing.comNameCheap, Inc.26 Oct 201513 May 202226 Oct 2031
276maidservicemesa.comenom431, Incorporated11 Apr 201812 Apr 201811 Apr 2019
277maidservicegilbert.comTucows Domains Inc.23 Oct 201027 Oct 201523 Oct 2016
278maidservicechandler.comWest263 International Limited8 Oct 20208 Oct 20208 Oct 2021
279maidservice-dallas.comGoDaddy.com, LLC26 Oct 201526 Oct 201526 Oct 2016
280maidservicespro.comeNom, Inc.29 Oct 201530 Sep 201629 Oct 2017
281maidservicestip.comeNom, Inc.30 Oct 201530 Oct 201530 Oct 2016
282maidservicesray.comeNom, Inc.30 Oct 201530 Oct 201530 Oct 2016
283maidservicesnashville.comGoDaddy.com, LLC21 Feb 201721 Feb 201721 Feb 2018
284maidservicespringfield.comName.com, Inc.17 Nov 201517 Nov 201517 Nov 2016
285maidservicetemplehills.comGoDaddy.com, LLC20 Nov 201520 Nov 201520 Nov 2016
286maidservicessoutheuclid.comGoDaddy.com, LLC20 Nov 201520 Nov 201520 Nov 2016
287maidservicesknoxville.comGoDaddy.com, LLC20 Nov 201520 Nov 201520 Nov 2016
288maidservicemyrtlebeach.comWild West Domains, LLC21 Nov 201522 Nov 201521 Nov 2016
289maidservicetoronto.xyzNameCheap, Inc.27 Nov 20156 Dec 201627 Nov 2017
290maidservicebothell.netName.com, Inc.30 Nov 201530 Nov 201530 Nov 2016
291maidservicenearme.xyzGMO Internet Inc.8 Dec 202313 Dec 20238 Dec 2024
292maidserviceinantiochca.comeNom, Inc.4 Dec 20154 Dec 20154 Dec 2016
293maidservicestampa.comGoDaddy.com, LLC23 Feb 20226 Apr 202323 Feb 2023
294maidservicefairfax.orgGoDaddy.com, LLC8 Dec 201523 Oct 20168 Dec 2018
295maidservicefairfax.netGoDaddy.com, LLC8 Dec 201523 Oct 20168 Dec 2018
296maidservicefairfax.infoGoDaddy.com, LLC9 Dec 201510 Dec 20199 Dec 2020
297maidservicebethesda.orgGoDaddy.com, LLC8 Dec 201523 Oct 20168 Dec 2018
298maidservicebethesda.netGoDaddy.com, LLC8 Dec 20158 Dec 20158 Dec 2016
299maidservicebethesda.infoGoDaddy.com, LLC9 Dec 201523 Oct 20169 Dec 2018
300maidservicesearch.comeNom, Inc.13 Dec 201513 Dec 201513 Dec 2016
301maidservicesatlanta.comGoDaddy.com, LLC22 Aug 201923 Aug 202322 Aug 2024
302maidserviceorangecountyca.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
303maidservicenearmeorangecounty.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
304maidservicelagunaniguelca.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
305maidservicelagunabeachca.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
306maidserviceirvineca.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
307maidservicehuntingtonbeachca.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
308maidservicedanapointca.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
309maidservices.topGandi SAS24 Dec 201524 Dec 201524 Dec 2016
310maidserviceevanston.comTucows Domains Inc.5 Jan 20129 Jan 20165 Jan 2017
311maidservicewoodlands.comOmnis Network, LLC15 Jan 201617 Jan 201715 Jan 2018
312maidservicebaby.comTucows Domains Inc.17 Jan 201616 Jan 202417 Jan 2025
313maidservice-bellevue.comregister.com, Inc.18 Jan 201619 Jan 202418 Jan 2025
314maidservicesaid.comeNom, Inc.21 Jan 201623 Dec 201621 Jan 2018
315maidservicecolumbus.comGoDaddy.com, LLC10 Apr 201710 Apr 201710 Apr 2018
316maidservicedeals.comGoDaddy.com, LLC17 Feb 202417 Feb 202417 Feb 2025
317maidservicelewisville.comNamesilo, LLC21 May 201922 May 202321 May 2024
318maidservicephiladelphia.netDomain.com, LLC5 Feb 201621 Jan 20175 Feb 2018
319maidservicescompany.comWix.com Ltd.2 Jan 202313 Mar 20242 Jan 2024
320maidservicesanfranciscoca.comName.com, Inc.5 Feb 20165 Feb 20165 Feb 2017
321maidservicenearme.comInternet Domain Services BS Corp5 Feb 20166 Mar 20245 Feb 2025
322maidservicedenver.netTucows Domains Inc.15 Feb 201319 Feb 201615 Feb 2017
323maidservicetwo.comeNom, Inc.19 Feb 201619 Feb 201619 Feb 2017
324maidservicesjohor.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Feb 201626 Feb 201626 Feb 2017
325maidservicebr.comNamesilo, LLC1 Mar 201613 Apr 20241 Mar 2025
326maidservicetoronto.com-25 May 202218 Jun 202325 May 2024
327maidservicebrooklyn.comGoDaddy.com, LLC27 Aug 202228 Aug 202327 Aug 2024
328maidserviceflagstaff.comName.com, Inc.8 Mar 20167 Feb 20178 Mar 2018
329maidserviceorlando.netGoDaddy.com, LLC9 Mar 201610 Mar 20179 Mar 2018
330maidservicenewyork.netName.com, Inc.9 Mar 20169 Mar 20169 Mar 2017
331maidservicenewyorkny.comName.com, Inc.9 Mar 20169 Mar 20169 Mar 2017
332maidservicehollywood.comGoDaddy.com, LLC9 Mar 20169 Mar 20169 Mar 2017
333maidservicesdallas.comGoDaddy.com, LLC13 May 201913 May 201913 May 2020
334maidservices.onlinePDR Ltd. d/b/a PublicDomainRegistry.com29 Jun 202331 Aug 202329 Jun 2024
335maidservicehome.comeNom, Inc.18 Mar 201630 Apr 202418 Mar 2024
336maidservicesvancouver.comeNom, Inc.23 Mar 201623 Mar 201623 Mar 2017
337maidservicebronx.comGoDaddy.com, LLC29 Mar 201628 Feb 201729 Mar 2018
338maidserviceftmyers.comeNom, Inc.1 Apr 201627 Mar 20171 Apr 2018
339maidservices.spaceNameCheap, Inc.2 Apr 20162 Apr 20162 Apr 2017
340maidserviceshelpinghands.comGoDaddy.com, LLC4 Apr 20164 Apr 20164 Apr 2017
341maidservicequotes.comGoDaddy.com, LLC4 Apr 20164 Apr 20164 Apr 2017
342maidserviceplano.comGoDaddy.com, LLC7 Apr 20168 Apr 20247 Apr 2025
343maidservicegreenville.comGoDaddy.com, LLC11 Apr 201611 Apr 201611 Apr 2017
344maidservicequeens.comGoDaddy.com, LLC6 Sep 20227 Sep 20236 Sep 2024
345maidservices.solutionsGoDaddy.com, LLC16 Apr 201631 May 201716 Apr 2018
346maidservicesugarland.comeNom, Inc.21 Apr 201621 Apr 201621 Apr 2017
347maidservicebirmingham.comGoDaddy.com, LLC5 Sep 20185 Sep 20185 Sep 2019
348maidservicesrus.comPDR Ltd. d/b/a PublicDomainRegistry.com4 May 20164 May 20164 May 2017
349maidservicerus.comGoDaddy.com, LLC16 Nov 202016 Nov 202016 Nov 2021
350maidservicepanamacity.comTucows Domains Inc.9 May 20119 May 20119 May 2017
351maidservicesfortmill.comGoDaddy.com, LLC17 May 201617 May 201617 May 2017
352maidservicenewportbeach.comGoDaddy.com, LLC17 May 201617 May 201617 May 2017
353maidservicesnw.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED13 Nov 202114 Nov 202213 Nov 2022
354maidservicewashingtondc.comFastDomain Inc.24 May 201624 May 201724 May 2018
355maidservicefallschurch.comFastDomain Inc.24 May 201624 May 201724 May 2018
356maidservicebowie.comFastDomain Inc.24 May 201624 May 201724 May 2018
357maidservicearlington.com-22 Nov 202118 Apr 202322 Nov 2023
358maidservicealexandriava.comFastDomain Inc.24 May 201624 May 201724 May 2018
359maidserviceinabox.comGoDaddy.com, LLC8 Jun 20168 Jun 20168 Jun 2017
360maidservicecompanyphiladelphia.comeNom, Inc.14 Jun 201614 Jun 201614 Jun 2017
361maidservicetoday.comCloudFlare, Inc.12 Dec 202212 Nov 202312 Dec 2024
362maidserviceformovingout.comGoDaddy.com, LLC15 Jun 201615 Jun 201615 Jun 2017
363maidserviceestimate.comGoDaddy.com, LLC15 Jun 201615 Jun 201615 Jun 2017
364maidservicecost.comGoDaddy.com, LLC15 Jun 201615 Jun 201615 Jun 2017
365maidservicespringvalley.comGoDaddy.com, LLC17 Jun 201617 Jun 201617 Jun 2017
366maidservicekewaunee.comGoDaddy.com, LLC17 Jun 201617 Jun 201617 Jun 2017
367maidservicesoceanside.comGoDaddy.com, LLC17 Jun 201617 Jun 201617 Jun 2017
368maidservicebluffton.comGoDaddy.com, LLC2 Jul 20162 Jul 20162 Jul 2017
369maidservicemall.comeNom, Inc.6 Jul 20167 Jun 20176 Jul 2018
370maidservicesleominster.comeNom, Inc.8 Jul 201620 Jun 20178 Jul 2018
371maidservicechicagoil.xyzNameCheap, Inc.16 Jun 201629 Jul 201616 Jun 2017
372maidservicejob.comGoDaddy.com, LLC13 Jul 201613 Jul 201613 Jul 2017
373maidservicessanjose.comDomain.com, LLC13 Jul 201613 Jul 201613 Jul 2017
374maidservicenyc.linkUniregistrar Corp22 May 201411 May 201622 May 2017
375maidservices.expertGoDaddy.com, LLC23 Jun 20147 Aug 202323 Jun 2024
376maidservicecareers.comGoDaddy.com, LLC17 Jul 201617 Jul 201717 Jul 2018
377maidservicesla.comDomain.com, LLC16 Jul 20161 Jul 202316 Jul 2024
378maidservicescaution.xyzNameCheap, Inc.14 Jul 201618 Jul 201714 Jul 2018
379maidservicestip.xyzNameCheap, Inc.14 Jul 20165 Aug 201614 Jul 2017
380maidservicesview.xyzNameCheap, Inc.14 Jul 201618 Jul 201714 Jul 2018
381maidserviceboston.biz1&1 Internet AG10 May 20147 Aug 20179 May 2018
382maidserviceapp.comGoDaddy.com, LLC14 Jan 201815 Jan 202414 Jan 2025
383maidservicehayward.com-20 Jul 201620 Jul 201620 Jul 2017
384maidservicebizop.infoWild West Domains, LLC22 Jul 20163 Aug 201722 Jul 2018
385maidservicejupiter.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
386maidservicealpharetta.com-26 Jul 201626 Jul 201626 Jul 2017
387maidservicenewyork.comGoDaddy.com, LLC18 Oct 201919 Oct 202318 Oct 2024
388maidserviceboston.comGoDaddy.com, LLC18 Oct 201919 Oct 202318 Oct 2024
389maidservicepittsburgh.comGoDaddy.com, LLC27 Jul 20161 Feb 202431 Jan 2025
390maidserviceindianapolis.comGoDaddy.com, LLC17 Jul 202017 Jul 202017 Jul 2021
391maidservicetucson.comNameCheap, Inc.25 Jun 20226 Sep 202325 Jun 2023
392maidservicesashburn.com-7 Aug 20167 Aug 20167 Aug 2018
393maidserviceltd.co.uk-11 Feb 200912 Jan 202411 Feb 2025
394maidserviceswinterpark.com-9 Aug 20169 Aug 20169 Aug 2017
395maidservicechamblee.comGoDaddy.com, LLC11 Aug 201628 Sep 202211 Aug 2024
396maidservice-bangkok.com-15 Aug 201615 Aug 201615 Aug 2017
397maidservicesbrooklyn.comGoDaddy.com, LLC27 Aug 202228 Aug 202327 Aug 2024
398maidservicesaustin.usGoDaddy.com, LLC16 Aug 201616 Aug 201715 Aug 2018
399maidservicebocaratonfl.comGoDaddy.com, LLC25 Mar 202225 Mar 202225 Mar 2023
400maidservicejupiterfl.comGoDaddy.com, LLC19 Aug 201620 Aug 202319 Aug 2024
401maidservicetx.comGoogle, Inc.20 May 202020 May 202020 May 2021
402maidservicesbyday.comGoDaddy.com, LLC26 Aug 201614 Nov 201626 Aug 2018
403maidserviceingrandprairie.com-1 Sep 20161 Sep 20161 Sep 2017
404maidserviceindestin.comFastDomain Inc.6 Sep 20169 Oct 20176 Sep 2017
405maidservicemilford.comGoDaddy.com, LLC6 Sep 20166 Sep 20166 Sep 2017
406maidserviceofrichmond.comGoDaddy.com, LLC19 Jul 20105 Mar 201219 Jul 2017
407maidservicesnj.comGoDaddy.com, LLC12 Jul 201113 Jul 201612 Jul 2017
408maidservices4u.comGoDaddy.com, LLC28 Mar 201429 Mar 202428 Mar 2025
409maidservicetulsa.comGoDaddy.com, LLC23 Feb 20236 May 202423 Feb 2024
410maidservicequote.comeNom, Inc.9 Oct 20138 Oct 20239 Oct 2024
411maidserviceroundrock.comFastDomain Inc.1 Aug 20141 Aug 20171 Aug 2018
412maidservicemckinney.comeNom, Inc.3 Mar 201125 Feb 20243 Mar 2025
413maidservicesgilbert.com-20 Sep 201220 Sep 201220 Sep 2017
414maidservicesanantoniotx.comGoDaddy.com, LLC2 Aug 20132 Aug 20162 Aug 2017
415maidservicefrisco.comGoDaddy.com, LLC14 May 201314 May 201714 May 2018
416maidservicebufordga.comGoDaddy.com, LLC13 Mar 20134 Mar 201513 Mar 2017
417maidservicedurham.comGoDaddy.com, LLC24 Jun 201119 Jun 201724 Jun 2018
418maidservicevienna.comGoDaddy.com, LLC5 Jan 20106 Jan 20245 Jan 2025
419maidservicecapecod.comPSI-USA, Inc. dba Domain Robot6 Apr 202126 May 20216 Apr 2022
420maidserviceforless.comNameCheap, Inc.20 Mar 20231 May 202420 Mar 2024
421maidservicesresource.comMarkMonitor Inc.15 Oct 200313 Sep 202315 Oct 2024
422maidservicedallas.comGoDaddy.com, LLC27 Apr 202328 Apr 202427 Apr 2025
423maidservicefranchise.comBrandsight, Inc.12 Oct 200614 Sep 202312 Oct 2024
424maidservicesdelhi.comGoDaddy.com, LLC11 Apr 20144 Feb 201711 Apr 2026
425maidservicemiami.comGoDaddy.com, LLC30 Dec 202131 Dec 202330 Dec 2024
426maidserviceloveland.comGoogle, Inc.24 Nov 200911 Apr 202424 Nov 2024
427maidservicenyc.comGoDaddy.com, LLC28 Apr 201329 Apr 202428 Apr 2025
428maidserviceraleigh.comGoDaddy.com, LLC28 Feb 20091 Mar 201528 Feb 2017
429maidserviceinaustin.comNameKing.com Inc.22 Oct 202022 Oct 202022 Oct 2021
430maidserviceboulderlongmont.comTucows Domains Inc.12 May 201116 May 201712 May 2017
431maidservicessanantonio.comSquarespace Domains LLC8 Sep 20238 Sep 20238 Sep 2024
432maidserviceinhouston.comGoDaddy.com, LLC15 Jul 201117 Jul 201715 Jul 2018
433maidserviceoflakenorman.comLaunchpad, Inc.16 May 20141 May 202316 May 2024
434maidservices-woodland-hills.comeNom, Inc.29 May 201319 May 201629 May 2017
435maidserviceplus.comTurnCommerce, Inc. DBA NameBright.com9 Feb 202212 Mar 20249 Feb 2024
436maidservicechicago.comDynadot, LLC7 Aug 20206 Feb 20247 Aug 2024
437maidserviceofphoenix.comGoDaddy.com, LLC8 Sep 20129 Sep 20168 Sep 2017
438maidservice-centraloregon.comGoDaddy.com, LLC14 Nov 201321 Aug 201514 Nov 2016
439maidservicedvisor.comMarkMonitor Inc.1 Aug 201230 Jun 20231 Aug 2024
440maidservicereviews.com-10 Dec 200717 Jan 202414 Jan 2025
441maidservicedc.comGoDaddy.com, LLC13 Oct 201214 Oct 201513 Oct 2016
442maidservice-austin.comGoDaddy.com, LLC12 Jun 201213 Jun 201612 Jun 2017
443maidservicesdownriver.comGoDaddy.com, LLC8 Feb 201413 Feb 20248 Feb 2025
444maidserviceokc.comGoDaddy.com, LLC25 Mar 201426 Mar 201625 Mar 2017
445maidservice4u.comGoDaddy.com, LLC14 Aug 202226 Oct 202314 Aug 2023
446maidservicesboston.comDynadot, LLC12 May 202113 May 202112 May 2022
447maidservicehelp.comGoDaddy.com, LLC13 Jan 200820 Oct 201613 Jan 2018
448maidserviceinnyc.comGoDaddy.com, LLC10 Nov 201112 Oct 201510 Nov 2016
449maidservicesminneapolis.comGoDaddy.com, LLC7 Dec 20078 Dec 20227 Dec 2024
450maidserviceshoustontx.comTucows Domains Inc.15 Oct 201319 Oct 201715 Oct 2017
451maidserviceinkaty.comGoDaddy.com, LLC22 Aug 201122 Aug 202322 Aug 2024
452maidserviceenterprises.comGoDaddy.com, LLC1 Dec 20093 Dec 20121 Dec 2017
453maidservices4hire.comFastDomain Inc.13 Feb 20149 Feb 201713 Feb 2018
454maidservice-bend.comGoDaddy.com, LLC14 Nov 201321 Aug 201514 Nov 2016
455maidservicebj.comXiamen ChinaSource Internet Service Co., Ltd.16 Jul 201116 Jul 202316 Jul 2024
456maidserviceofaustin.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Sep 201712 Sep 201712 Sep 2018
457maidservicekansas.comTucows Domains Inc.4 Sep 20116 Aug 20234 Sep 2024
458maidserviceestimates.comMoniker Online Services LLC9 Feb 20085 May 20179 Feb 2018
459maidserviceny.comGoDaddy.com, LLC2 Jan 20232 Jan 20232 Jan 2024
460maidserviceagencies.comGoDaddy.com, LLC19 Jul 201919 Jul 201919 Jul 2020
461maidservicerockville.comGoDaddy.com, LLC5 Jan 20106 Jan 20245 Jan 2025
462maidservicelocator.comGoDaddy.com, LLC24 Jul 200724 Jul 201724 Jul 2018
463maidservicegiftcard.comGoDaddy.com, LLC26 Jan 200627 Jan 202426 Jan 2025
464maidservicefairfax.comGoDaddy.com, LLC5 Jan 20106 Jan 20245 Jan 2025
465maidserviceus.comNetwork Solutions, LLC23 May 201111 May 201723 May 2018
466maidserviceatlanta.comNameKing.com Inc.17 May 202212 Jun 202317 May 2024
467maidservicehousecleaning.comTucows Domains Inc.2 Apr 20231 Apr 20242 Apr 2025
468maidserviceinsafetyharborfl.comGoDaddy.com, LLC23 Apr 200924 Apr 201623 Apr 2017
469maidservicesny.comNameCheap, Inc.18 Oct 202325 Oct 202318 Oct 2024
470maidserviceforyou.comGoDaddy.com, LLC20 Jun 201211 Sep 202220 Jun 2024
471maidservicesnyc.comGoDaddy.com, LLC5 Feb 20235 Feb 20235 Feb 2025
472maidservicesnewjersey.comDomain Name Root LLC22 Sep 201922 Sep 201922 Sep 2020
473maidserviceoptions.comName.com, Inc.12 Nov 201410 May 201712 Nov 2017
474maidserviceblog.comGoDaddy.com, LLC24 Aug 20192 Dec 201924 Aug 2021
475maidserviceadvice.comDropCatch.com 1348 LLC11 May 202325 Jun 202311 May 2024
476maidservicelasvegas.com-18 May 202317 Jul 202318 May 2024
477maidservicebethesda.comGoDaddy.com, LLC5 Jan 20106 Jan 20245 Jan 2025
478maidserviceinsanantonio.comWild West Domains, LLC24 Sep 200725 Sep 202324 Sep 2024
479maidservicescalifornia.comGoDaddy.com, LLC23 Jan 201223 Jan 201223 Jan 2017
480maidservicescottsdale.comGoDaddy.com, LLC13 May 202013 May 202013 May 2021
481maidservicesintampa.comeNom, Inc.14 Feb 201216 Jan 201714 Feb 2018
482maidservicesmanhattan.comGoDaddy.com, LLC14 Oct 20192 Mar 202414 Oct 2024
483maidserviceinnny.comGoDaddy.com, LLC19 Sep 20082 Mar 202419 Sep 2024
484maidservice411.com1&1 Internet AG14 Mar 200914 Mar 201714 Mar 2018
485maidservicesinc.comGoDaddy.com, LLC23 Dec 200424 Dec 202223 Dec 2024
486maidservicedirectories.comeNom, Inc.18 Apr 201320 Mar 201618 Apr 2017
487maidservicesnellville.comFastDomain Inc.1 May 20111 May 20161 May 2017
488maidserviceinclearwaterfl.com-11 Jul 202212 Jul 202311 Jul 2024
489maidservicespokane.comFastDomain Inc.3 Feb 201219 Jan 20243 Feb 2025
490maidservicesleavenworth.comeNom, Inc.23 Apr 201425 Mar 201523 Apr 2018
491maidservicephoenix.comNameKing.com Inc.21 Mar 20224 May 202421 Mar 2024
492maidservicekaufmantx.comregister.com, Inc.21 Oct 20102 Apr 201421 Oct 2018
493maidservicememphis.comGoDaddy.com, LLC24 Jul 200825 Jul 202324 Jul 2024
494maidservicelosangeles.com-10 May 202410 May 202410 May 2025
495maidserviceindy.comGoDaddy.com, LLC2 Jul 201225 May 20172 Jul 2018
496maidserviceoklahomacity.comGoDaddy.com, LLC11 Jul 201211 Jul 201611 Jul 2017
497maidservicesca.comNameCheap, Inc.13 Nov 202313 Nov 202313 Nov 2024
498maidservicedublin.comGoDaddy.com, LLC11 Jul 202122 Sep 202311 Jul 2023
499maidserviceinbrooklyn.comGoDaddy.com, LLC12 Apr 201313 Apr 201612 Apr 2017
500maidservicevirginia.comregister.com, Inc.9 Aug 20133 Jul 20179 Aug 2018
501maidservicecalls.comGoDaddy.com, LLC7 Jan 20118 Jan 20247 Jan 2025
502maidservicefortwayne.comGoDaddy.com, LLC1 Dec 20112 Dec 20231 Dec 2024
503maidserviceslongisland.comGoDaddy.com, LLC17 Apr 20127 Apr 201617 Apr 2017
504maidserviceutah.comUniregistrar Corp---
505maidserviceparkersburg.comGoDaddy.com, LLC25 Sep 201126 Sep 201525 Sep 2017
506maidservicesolutions.comGoDaddy.com, LLC1 Apr 201110 Jun 20191 Apr 2020
507maidserviceseattle.comGoDaddy.com, LLC11 Dec 20096 Sep 202211 Dec 2026
508maidservice247.comGoDaddy.com, LLC7 Sep 201224 Sep 20157 Sep 2016
509maidservicesfortwayne.comGoDaddy.com, LLC1 Dec 20112 Dec 20231 Dec 2024
510maidserviceplymouth.comFastDomain Inc.30 Apr 20101 Jun 201730 Apr 2018
511maidservicefranklintn.comGoDaddy.com, LLC14 Dec 201215 Dec 201514 Dec 2016
512maidserviceexperts.comGoDaddy.com, LLC20 Apr 201321 Apr 201720 Apr 2018
513maidservicepanama.com1&1 Internet AG2 Oct 20071 Feb 20162 Oct 2016
514maidservicesarasota.comGoDaddy.com, LLC26 Feb 201127 Feb 201626 Feb 2017
515maidservicesaintpaul.comGoDaddy.com, LLC7 Dec 20078 Dec 20227 Dec 2024
516maidservicemilfordoh.comTucows Domains Inc.1 Nov 20125 Nov 20201 Nov 2020
517maidservicedubai.comGoDaddy.com, LLC8 Oct 20179 Oct 20238 Oct 2024
518maidservicela.comGoDaddy.com, LLC23 Oct 200729 Sep 201423 Oct 2016
519maidservicelongisland.comGoDaddy.com, LLC17 Apr 20127 Apr 201617 Apr 2017
520maidserviceoffers.comGoDaddy.com, LLC23 Oct 201324 Oct 201523 Oct 2017
521maidservicesinnyc.comNamesilo, LLC2 Jul 202025 Jun 20232 Jul 2024
522maidservicegivesladyperfectlife.comGoDaddy.com, LLC10 Nov 201111 Nov 202310 Nov 2024
523maidserviceaustintx.comNameCheap, Inc.18 Apr 2020-18 Apr 2021
524maidservicenw.comGoDaddy.com, LLC25 Jul 20175 Aug 202325 Jul 2024
525maidservicemclean.comGoDaddy.com, LLC5 Jan 20106 Jan 20245 Jan 2025
526maidservicetampafl.comGoDaddy.com, LLC17 Apr 20121 Apr 202417 Apr 2025
527maidservicematters.comGoDaddy.com, LLC8 Jan 200915 Nov 20183 Oct 2019
528maidservicesofamerica.comregister.com, Inc.29 Mar 200128 Feb 202429 Mar 2025
529maidservicebethesdamd.comPDR Ltd. d/b/a PublicDomainRegistry.com20 May 201029 Mar 202320 May 2024
530maidservicefranchises.comBrandsight, Inc.12 Oct 200614 Sep 202312 Oct 2024
531maidservicefortworth.comGoDaddy.com, LLC24 Jul 200825 Jul 202324 Jul 2024
532maidservice-housecleaningsa.comNameCheap, Inc.1 May 20241 May 20241 May 2025
533maidserviceagency.comNameKing.com Inc.5 Oct 20208 Jan 20245 Oct 2024
534maidservicemurfreesboro.comDreamHost, LLC18 Feb 201220 Feb 201718 Feb 2018
535maidserviceyellowpages.comeNom, Inc.4 Jan 20086 Dec 20234 Jan 2025
536maidservicecalgary.comGoDaddy.com, LLC28 Aug 202223 Aug 202328 Aug 2024
537maidservicesbufordga.comTucows Domains Inc.12 Mar 201411 Feb 201712 Mar 2018
538maidservicephiladelphia.comGoDaddy.com, LLC2 Apr 20213 Apr 20242 Apr 2025
539maidservicemidland.comregister.com, Inc.3 Nov 20113 Nov 20113 Nov 2017
540maidserviceminneapolis.comGoDaddy.com, LLC7 Dec 20078 Dec 20227 Dec 2024
541maidservicenetworks.comNetwork Solutions, LLC15 Apr 20113 Apr 201715 Apr 2018
542maidserviceschedulingsoftware.comAmazon Registrar, Inc.6 Feb 20133 Jan 20246 Feb 2025
543maidservicenaples.comHongkong Domain Name Information Management Co., L…20 Nov 202230 Dec 202320 Nov 2023
544maidserviceowasso.comNameCheap, Inc.29 Aug 201317 Oct 202329 Aug 2024
545maidservicecorona.comGoDaddy.com, LLC13 Dec 20118 Dec 201613 Dec 2017
546maidserviceleesburgva.comPDR Ltd. d/b/a PublicDomainRegistry.com20 May 201029 Mar 202320 May 2024
547maidserviceminnesota.comGoDaddy.com, LLC22 Oct 201016 Dec 201715 Dec 2019
548maidservicenetwork.comGoDaddy.com, LLC28 Aug 200329 Aug 201528 Aug 2017
549maidservicesummerville.comeNom, Inc.19 Sep 201318 Sep 202319 Sep 2024
550maidserviceinfortworth.comDeluxe Small Business Sales, Inc. d/b/a Aplus.net10 Feb 20072 Aug 201710 Feb 2018
551maidservicecolumbiamd.com1&1 Internet AG2 Jul 201423 Aug 20162 Jul 2017
552maidserviceusa.comGoDaddy.com, LLC12 Mar 201113 Mar 202412 Mar 2025
553maidservicebaltimore.comGoDaddy.com, LLC24 Jul 200825 Jul 202324 Jul 2024
554maidservicesinny.comGoDaddy.com, LLC19 Sep 20082 Mar 202419 Sep 2024
555maidservicenj.comWild West Domains, LLC24 Oct 201212 Oct 201524 Oct 2016
556maidserviceinfo.comGoDaddy.com, LLC8 May 202323 Feb 20248 May 2025
557maidservicesnewyorkcity.comGoDaddy.com, LLC6 Aug 20106 Aug 20136 Aug 2016
558maidserviceshonolulu.comNetwork Solutions, LLC29 Oct 201227 Oct 201729 Oct 2018
559maidservicenashvilletn.comTucows Domains Inc.25 Jun 201029 Jun 201725 Jun 2017
560maidservicefl.comAtak Domain Hosting Internet d/b/a Atak Teknoloji22 Sep 202124 Sep 202122 Sep 2022
561maidservicestartup.comeNom, Inc.7 Aug 20146 Aug 20237 Aug 2024
562maidservicetexas.comNameCheap, Inc.20 Nov 202021 Oct 202320 Nov 2024
563maidservicenow.comGoDaddy.com, LLC23 Aug 201311 Dec 20231 Jan 2025
564maidserviceprofits.comGoDaddy.com, LLC9 Dec 200317 Oct 202316 Oct 2024
565maidservicesdirectory.comGoDaddy.com, LLC16 Jul 200717 Jul 201616 Jul 2018
566maidservicesoftware.comNameCheap, Inc.19 Nov 200625 Aug 202319 Nov 2024
567maidservicedenver.comGoDaddy.com, LLC4 Oct 202016 Dec 20234 Oct 2023
568maidservicearizona.comGoDaddy.com, LLC4 Aug 20149 Aug 20164 Aug 2016
569maidservicekansascity.comNameCheap, Inc.28 Nov 2019-28 Nov 2020
570maidservicefortcollins.comGoogle, Inc.12 Jan 201010 Apr 202412 Jan 2025
571maidservicejobs.comBrandsight, Inc.17 Jun 200020 May 202317 Jun 2024
572maidserviceorlando.comGoDaddy.com, LLC19 Jan 200719 Jan 202419 Jan 2025
573maidserviceincorporated.comGoDaddy.com, LLC27 Feb 201415 Sep 202227 Feb 2025
574maidservicesdubai.comDropCatch.com 433 LLC19 Apr 202420 Apr 202419 Apr 2025
575maidserviceamerica.comGoDaddy.com, LLC11 May 202011 May 202011 May 2021
576maidservicespugetsound.comDROPCATCH.COM 796 LLC5 Jul 20225 Aug 20235 Jul 2023
577maidserviceadvisor.comMarkMonitor Inc.1 Aug 201230 Jun 20231 Aug 2024
578maidservicebusinesshelp.comGoDaddy.com, LLC18 Oct 200819 Oct 201418 Oct 2016
579maidservicenearyou.comNetwork Solutions, LLC23 May 201111 May 201723 May 2018
580maidservicegreenvillesc.comWild West Domains, LLC14 Jul 201015 Jul 201614 Jul 2017
581maidserviceinmanhattanny.comGoDaddy.com, LLC9 May 201314 May 20159 May 2017
582maidservicemd.comGoDaddy.com, LLC13 Oct 201214 Oct 201513 Oct 2016
583maidservicemadisonwi.comCatalog.com22 May 201021 May 201722 May 2018
584maidserviceswichita.comName.com, Inc.16 Feb 201217 Mar 201616 Feb 2017
585maidserviceaustin.comGoDaddy.com, LLC1 Apr 20072 Apr 20241 Apr 2025
586maidserviceathensga.comTucows Domains Inc.20 Nov 201225 Nov 201720 Nov 2017
587maidservicemumbai.comXin Net Technology Corporation22 Feb 202127 May 202122 Feb 2022
588maidservicegainesvillega.comGoDaddy.com, LLC18 Mar 20134 Mar 201518 Mar 2017
589maidserviceathens.comTucows Domains Inc.2 Nov 20126 Nov 20172 Nov 2017
590maidservicetampa.comName.com, Inc.23 Jul 20201 Jul 202323 Jul 2024
591maidservice-jax.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Aug 20179 Aug 20179 Aug 2018
592maidserviceskansas.comTucows Domains Inc.4 Sep 20116 Aug 20234 Sep 2024
593maidserviceportland.comGoDaddy.com, LLC24 Jul 200814 Jun 201624 Jul 2017
594maidservicefortworthtx.comGoDaddy.com, LLC17 Feb 201418 Feb 201617 Feb 2017
595maidservicemanagementsoftware.comAmazon Registrar, Inc.6 Feb 20133 Jan 20246 Feb 2025
596maidservicevancouver.comGoDaddy.com, LLC26 Jan 200930 Jan 202426 Jan 2025
597maidservicepro.comGoDaddy.com, LLC2 Sep 202214 Nov 20232 Sep 2023
598maidservicehouston.comGoDaddy.com, LLC12 Sep 200225 Oct 202312 Sep 2024
599maidserviceok.comNameCheap, Inc.29 Aug 201317 Oct 202329 Aug 2024
600maidserviceprices.comGoDaddy.com, LLC11 Dec 20096 Sep 202211 Dec 2026
601maidservicerockfordil.comTucows Domains Inc.19 Nov 201222 Jun 201619 Nov 2016
602maidservicemtpleasant.comeNom, Inc.19 Sep 201318 Sep 202319 Sep 2024
603maidservicesofhouston.comGoDaddy.com, LLC22 Aug 201122 Aug 202322 Aug 2024
604maidservicegiftcards.comGoDaddy.com, LLC16 Dec 200517 Dec 202316 Dec 2024
605maidservicesnearyou.comNetwork Solutions, LLC23 May 201111 May 201723 May 2018
606maidservicecharleston.comeNom, Inc.19 Sep 201318 Sep 202319 Sep 2024
607maidservice-utah.comregister.com, Inc.14 Aug 20133 Jul 201714 Aug 2018
608maidservicesohio.comGoDaddy.com, LLC27 Feb 201428 Feb 202427 Feb 2025
609maidserviceva.comGoogle, Inc.26 Feb 201317 Jun 202326 Feb 2028
610maidservicesastoria.comGoDaddy.com, LLC25 Apr 20137 Apr 201625 Apr 2017
611maidserviceforsale.comGoDaddy.com, LLC9 Oct 200910 Oct 20239 Oct 2024
612maidservicemanhattan.comeNom, Inc.3 May 20104 May 20243 May 2024
613maidservicefinder.comGoDaddy.com, LLC20 Jan 201021 Jan 202320 Jan 2025
614maidserviceindallas.com-16 Sep 201616 Sep 201616 Sep 2017
615maidserviceprices.netGMO Internet Inc.27 Sep 201627 Feb 201727 Sep 2017
616maidserviceorlando.xyzGoDaddy.com, LLC4 Oct 20168 Dec 20164 Oct 2017
617maidserviceturkeycreek.comTucows Domains Inc.6 Oct 201610 Oct 20176 Oct 2017
618maidservicewesleychapel.comTucows Domains Inc.6 Oct 201610 Oct 20176 Oct 2017
619maidservicehouston.infoLimited Liability Company "Registrar of domain nam…24 Jan 201824 Jan 201824 Jan 2019
620maidservicescottsdale.infoGoDaddy.com, LLC23 Feb 201024 Feb 201723 Feb 2019
621maidservicenaples.infoGoDaddy.com, LLC19 Aug 201216 May 201619 Aug 2018
622maidservicelasvegas.mobiGoDaddy.com, LLC28 May 200829 May 201628 May 2017
623maidservicephoenix.netNameCheap, Inc.25 Feb 20225 Feb 202425 Feb 2025
624maidservicelasvegas.netWild West Domains, LLC8 Aug 202219 Sep 20238 Aug 2023
625maidservicehoustontx.netGoDaddy.com, LLC8 Feb 20129 Feb 20168 Feb 2017
626maidservicesnow.netDomainPeople, Inc.25 May 200820 May 202325 May 2024
627maidservicemiami.netGoDaddy.com, LLC26 Aug 201127 Aug 201626 Aug 2017
628maidserviceindianapolis.netGoDaddy.com, LLC2 Jul 20126 May 20162 Jul 2017
629maidservicedc.neteNom, Inc.8 Jan 20147 Dec 20148 Jan 2017
630maidservicelosangeles.netLaunchpad, Inc.7 Feb 20121 Feb 20247 Feb 2025
631maidserviceatlantaga.netGoDaddy.com, LLC16 Jul 202017 Jul 202316 Jul 2024
632maidserviceedmonton.netName.com, Inc.2 Oct 201010 Sep 20162 Oct 2017
633maidservicereston.netGoDaddy.com, LLC5 Jan 201023 Oct 20165 Jan 2019
634maidservicehouston.netGoDaddy.com, LLC24 Jul 201325 Jul 201724 Jul 2018
635maidservicenyc.netGoDaddy.com, LLC14 Sep 202215 Sep 202314 Sep 2024
636maidserviceshouston.netPSI-USA, Inc. dba Domain Robot13 Apr 201014 Apr 202413 Apr 2025
637maidservicehelp.netGoDaddy.com, LLC1 Apr 20112 Apr 20161 Apr 2017
638maidserviceatlanta.neteNom, Inc.6 Jan 20145 Dec 20146 Jan 2017
639maidservicesolutions.netGoDaddy.com, LLC1 Apr 20112 Apr 20161 Apr 2017
640maidserviceagencies.netGoDaddy.com, LLC1 Apr 20112 Apr 20161 Apr 2017
641maidserviceorangecounty.netTucows Domains Inc.28 May 20111 Jun 201728 May 2017
642maidserviceagency.netGoDaddy.com, LLC1 Apr 20112 Apr 20161 Apr 2017
643maidservicewilliamsville.comTucows Domains Inc.21 Oct 201625 Oct 201721 Oct 2017
644maidservicelancaster.comTucows Domains Inc.21 Oct 201625 Oct 201721 Oct 2017
645maidserviceindianapolis.orgGoDaddy.com, LLC3 Dec 20114 Dec 20173 Dec 2018
646maidservicedallas.orgHosting Concepts B.V. dba Openprovider2 Apr 20092 Apr 20242 Apr 2025
647maidservicephoenix.orgeNom, Inc.8 Jan 20149 Dec 20158 Jan 2017
648maidservices.orgGoDaddy.com, LLC19 Jun 201916 Aug 202319 Jun 2024
649maidservicechicago.orgFastDomain Inc.1 Mar 20125 Apr 20241 Mar 2025
650maidservicenaples.orgGoDaddy.com, LLC2 Sep 201110 Aug 20172 Sep 2019
651maidserviceslv.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
652maidservicein.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
653maidservicesolutions.xyzNameCheap, Inc.18 Sep 201518 May 201618 Sep 2017
654maidserviceatx.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
655maidservice-usa.xyzNameCheap, Inc.17 Sep 201525 Sep 201617 Sep 2017
656maidservicesdc.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
657maidserviceri.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
658maidservicespro.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
659maidservicefinder.xyzNameCheap, Inc.24 Sep 20151 Oct 201624 Sep 2017
660maidservicescentral.xyzNameCheap, Inc.1 Sep 201514 Oct 20161 Sep 2016
661maidserviceinc.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
662maidservicesforyou.xyzNameCheap, Inc.17 Sep 201526 Sep 201617 Sep 2017
663maidservicesottawa.comDomain.com, LLC25 Oct 201610 Oct 202325 Oct 2024
664maidserviceinottawa.comDomain.com, LLC25 Oct 201610 Oct 202325 Oct 2024
665maidserviceventura.comLaunchpad, Inc.25 Oct 201625 Dec 201625 Oct 2017
666maidserviceyoucantrust.comeNom, Inc.29 Oct 201628 Oct 202329 Oct 2024
667maidserviceuk.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
668maidservicemesa.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
669maidservicealbuquerquemaid.com-5 Nov 20165 Nov 20165 Nov 2017
670maidservices24x7.comregister.com, Inc.11 Nov 201611 Nov 201611 Nov 2017
671maidservicegrandrapids.comNamesilo, LLC13 Nov 201619 Dec 201713 Nov 2018
672maidservicesoncall.comGoDaddy.com, LLC18 Nov 201618 Nov 201618 Nov 2019
673maidservicetraining.orgWild West Domains, LLC22 Nov 20166 Jan 202422 Nov 2024
674maidservicetraining.infoWild West Domains, LLC22 Nov 20166 Jan 202422 Nov 2024
675maidservicetraining.comWild West Domains, LLC22 Nov 201623 Nov 202322 Nov 2024
676maidservicetraining.netWild West Domains, LLC22 Nov 201623 Nov 202322 Nov 2024
677maidservicenearme.info1&1 Internet AG2 Dec 201631 Jan 20172 Dec 2017
678maidserviceconsulting.orgWild West Domains, LLC6 Dec 201620 Jan 20246 Dec 2024
679maidservicecertification.comWild West Domains, LLC6 Dec 20167 Dec 20236 Dec 2024
680maidserviceconsulting.netWild West Domains, LLC6 Dec 20167 Dec 20236 Dec 2024
681maidserviceconsulting.infoWild West Domains, LLC6 Dec 201620 Jan 20246 Dec 2024
682maidservicecertification.orgWild West Domains, LLC6 Dec 201620 Jan 20246 Dec 2024
683maidservicecertification.infoWild West Domains, LLC6 Dec 201620 Jan 20246 Dec 2024
684maidservicecertification.netWild West Domains, LLC6 Dec 20167 Dec 20236 Dec 2024
685maidserviceconsulting.comWild West Domains, LLC6 Dec 20167 Dec 20236 Dec 2024
686maidserviceedmondok.neteNom, Inc.9 Dec 201625 Nov 20179 Dec 2018
687maidserviceedmondok.comeNom, Inc.9 Dec 201625 Nov 20179 Dec 2018
688maidserviceintexas.comeNom, Inc.12 Dec 201612 Dec 201612 Dec 2017
689maidserviceoc.comNetwork Solutions, LLC14 Dec 20165 Mar 201713 Dec 2017
690maidserviceforme.comTucows Domains Inc.13 Dec 201617 Dec 201813 Dec 2018
691maidservice4me.comTucows Domains Inc.13 Dec 201617 Dec 201813 Dec 2018
692maidservicesuae.comRealtime Register B.V.24 Feb 202429 Feb 202424 Feb 2025
693maidservicespittsburgh.comGoDaddy.com, LLC18 Jan 20171 Feb 202431 Jan 2025
694maidservicefinder.linkUniregistrar Corp18 Jan 201723 Jan 201718 Jan 2018
695maidservicedouglasville.comGoDaddy.com, LLC22 Jan 201722 Jan 201722 Jan 2018
696maidservicedallastx.comFastDomain Inc.31 Dec 201931 Dec 201931 Dec 2020
697maidservicesportland.comGoDaddy.com, LLC15 Jul 201915 Jul 201915 Jul 2020
698maidservicelongbeach.comGoDaddy.com, LLC1 Feb 20171 Feb 20171 Feb 2018
699maidservicelafayette.comGoDaddy.com, LLC5 Feb 20175 Feb 20175 Feb 2018
700maidserviceerie.comGoDaddy.com, LLC5 Feb 20175 Feb 20175 Feb 2019
701maidserviceincity.comNameCheap, Inc.8 Feb 20178 Feb 20178 Feb 2018
702maidservicebrookfield.comGoDaddy.com, LLC16 Feb 201716 Feb 201716 Feb 2019
703maidservicesoftexas.comGoDaddy.com, LLC19 Feb 201720 Feb 202419 Feb 2025
704maidservicesorlando.comNameCheap, Inc.1 May 20231 Apr 20241 May 2025
705maidservicescalgary.comNameCheap, Inc.22 Feb 201722 Feb 201722 Feb 2018
706maidservicesdenver.comGoDaddy.com, LLC22 Feb 20226 May 202322 Feb 2023
707maidservicereferralagency.comGoDaddy.com, LLC10 Mar 201710 Mar 201710 Mar 2019
708maidservicenewton.comTucows Domains Inc.16 Mar 201720 Mar 201816 Mar 2018
709maidserviceraleighnc.comTucows Domains Inc.22 Mar 201726 Mar 201822 Mar 2018
710maidservicealedotx.comGoDaddy.com, LLC30 Mar 201730 Mar 201730 Mar 2018
711maidservicestampa.netNameCheap, Inc.14 Apr 201714 Apr 201714 Apr 2018
712maidserviceclean.comGoDaddy.com, LLC20 Apr 201721 Apr 201820 Apr 2020
713maidservicenearme.netNameCheap, Inc.23 Apr 201723 Apr 201723 Apr 2018
714maidserviceseffner.comTucows Domains Inc.26 Apr 201730 Apr 201826 Apr 2018
715maidserviceplantcity.comTucows Domains Inc.26 Apr 201730 Apr 201826 Apr 2018
716maidservices9.comBigRock Solutions Ltd.1 May 20177 May 20241 May 2025
717maidserviceslosangeles.netDynadot, LLC15 Aug 201916 Aug 202315 Aug 2024
718maidservicesavannah.comGoDaddy.com, LLC4 May 20174 May 20234 May 2025
719maidservicegreensboronc.comregister.com, Inc.3 May 20173 May 20173 May 2018
720maidserviceomaha.comGoDaddy.com, LLC4 May 20175 May 20244 May 2025
721maidservicescochin.comGoDaddy.com, LLC10 May 201710 May 201710 May 2018
722maidservicesincochin.comGoDaddy.com, LLC10 May 201710 May 201710 May 2018
723maidserviceforestpark.comTucows Domains Inc.17 May 201721 May 201817 May 2018
724maidservicecicero.comTucows Domains Inc.17 May 201721 May 201817 May 2018
725maidservices411.comNameCheap, Inc.12 Apr 202313 Apr 202412 Apr 2025
726maidserviceindubai.comGoDaddy.com, LLC16 Sep 201916 Sep 201916 Sep 2020
727maidserviceindy.netGoDaddy.com, LLC25 May 201725 May 201725 May 2018
728maidserviceriverforest.comTucows Domains Inc.2 Jun 20176 Jun 20182 Jun 2018
729maidserviceskingwood.comGoDaddy.com, LLC3 Jun 20174 Jun 20233 Jun 2024
730maidservices.fyiGoDaddy.com, LLC10 Jun 201729 Sep 201710 Jun 2018
731maidserviceaurora.comGoDaddy.com, LLC13 Jun 201713 Jun 201713 Jun 2018
732maidservicesrutherford.comName.com, Inc.22 Jun 201722 Jun 201722 Jun 2018
733maidservicenewtonnc.comTucows Domains Inc.30 Jun 20174 Jul 201830 Jun 2018
734maidservicehickory.comTucows Domains Inc.30 Jun 20174 Jul 201830 Jun 2018
735maidservicesderry.comTucows Domains Inc.24 Jul 201728 Jul 201824 Jul 2018
736maidservicesma.comTucows Domains Inc.25 Jul 201724 Aug 201725 Jul 2019
737maidservicesnashua.comTucows Domains Inc.24 Jul 201728 Jul 201824 Jul 2018
738maidserviceswindham.comTucows Domains Inc.24 Jul 201728 Jul 201824 Jul 2018
739maidservicesmerrimack.comTucows Domains Inc.24 Jul 201728 Jul 201824 Jul 2018
740maidservicecornelius.comTucows Domains Inc.25 Jul 201729 Jul 201825 Jul 2018
741maidservicemorrisville.comTucows Domains Inc.25 Jul 201729 Jul 201825 Jul 2018
742maidservice-pittsburgh.comNameCheap, Inc.6 Aug 20176 Aug 20176 Aug 2018
743maidserviceplymouthma.comTucows Domains Inc.15 Aug 201719 Aug 201815 Aug 2018
744maidservicewestport.comTucows Domains Inc.15 Aug 201719 Aug 201815 Aug 2018
745maidservicemarion.comTucows Domains Inc.15 Aug 201719 Aug 201815 Aug 2018
746maidserviceforu.netGoDaddy.com, LLC20 Jul 201720 Jul 201720 Jul 2018
747maidserviceforu.comGoDaddy.com, LLC20 Jul 201720 Jul 201720 Jul 2018
748maidservicemojo.comGoDaddy.com, LLC22 Jul 201722 Jul 201722 Jul 2018
749maidservicemaids.comGoDaddy.com, LLC7 Feb 20171 Oct 202212 Jun 2024
750maidservicechicago.infoGoDaddy.com, LLC8 Feb 20179 Apr 20178 Feb 2018
751maidservicecompany.websiteDomain.com, LLC14 Aug 201719 Aug 201714 Aug 2018
752maidservicestpete.comGoDaddy.com, LLC5 Jul 20175 Jul 20175 Jul 2018
753maidservicesinmumbai.comNameCheap, Inc.30 Aug 201730 Aug 201730 Aug 2018
754maidservicesindelhi.comNameCheap, Inc.30 Aug 201730 Aug 201730 Aug 2018
755maidservicesrosenberg.comTucows Domains Inc.19 Sep 201723 Sep 201819 Sep 2018
756maidservicessugarland.comTucows Domains Inc.19 Sep 201723 Sep 201819 Sep 2018
757maidservicesrichmond.comEagle Eye Domains, LLC26 Apr 202126 Apr 202126 Apr 2022
758maidserviceschandler.comTucows Domains Inc.25 Sep 201729 Sep 201825 Sep 2018
759maidservicestanqueverde.comTucows Domains Inc.25 Sep 201729 Sep 201825 Sep 2018
760maidservicesmarana.comTucows Domains Inc.25 Sep 201729 Sep 201825 Sep 2018
761maidservicestempe.comTucows Domains Inc.25 Sep 201729 Sep 201825 Sep 2018
762maidservicesorovalley.comTucows Domains Inc.25 Sep 201729 Sep 201825 Sep 2018
763maidservicesscottsdale.comNetwork Solutions, LLC12 Dec 201812 Dec 201812 Dec 2019
764maidservicesjacksonville.comDynadot, LLC11 Oct 202012 Oct 202011 Oct 2021
765maidservicescatalinafoothills.comTucows Domains Inc.25 Sep 201729 Sep 201825 Sep 2018
766maidservicesmesa.comTucows Domains Inc.25 Sep 201729 Sep 201825 Sep 2018
767maidservicehotline.comNameCheap, Inc.28 Sep 201728 Sep 201728 Sep 2018
768maidservice-london.comNameCheap, Inc.7 Oct 20178 Oct 20177 Oct 2018
769maidservices.liveGoDaddy.com, LLC28 Nov 202210 Dec 202328 Nov 2024
770maidservicesite.comeNom, Inc.10 Oct 201710 Oct 201710 Oct 2018
771maidservice-houston.comGoDaddy.com, LLC22 Nov 202123 Nov 202322 Nov 2024
772maidservices.saleeNom, Inc.10 Oct 201710 Oct 201710 Oct 2018
773maidservices.rockseNom, Inc.10 Oct 201710 Oct 201710 Oct 2018
774maidservicenewbern.comregister.com, Inc.25 Oct 201725 Oct 201725 Oct 2018
775maidserviceshollis.comTucows Domains Inc.26 Oct 201730 Oct 201826 Oct 2018
776maidservicesauburndale.comTucows Domains Inc.9 Nov 201713 Nov 20189 Nov 2018
777maidserviceslakeland.comTucows Domains Inc.9 Nov 201713 Nov 20189 Nov 2018
778maidservicephuket.comHostinger, UAB4 Jan 20237 Jan 20244 Jan 2025
779maidservicemonticello.comName.com, Inc.18 Dec 201718 Dec 201718 Dec 2018
780maidservicevegas.comLaunchpad, Inc.3 May 202118 Apr 20243 May 2025
781maidserviceinglasgow.co.ukKey-Systems GmbH11 Feb 201711 Feb 201711 Feb 2018
782maidservicelondon.co.uk-26 Jul 20172 Aug 202326 Jul 2024
783maidservicesbeachwoodheights.comTucows Domains Inc.8 Jan 201812 Jan 20198 Jan 2019
784maidservices.co.uk-1 Jul 20231 Jul 20231 Jul 2024
785maidservicecost.onlineNameCheap, Inc.31 Jan 201831 Jan 201831 Jan 2019
786maidservicesbarnhills.comTucows Domains Inc.8 Feb 201812 Feb 20198 Feb 2019
787maidservicesbrookside.comTucows Domains Inc.8 Feb 201812 Feb 20198 Feb 2019
788maidservicesofca.comNetwork Solutions, LLC8 Feb 20188 Feb 20188 Feb 2019
789maidservicescelman.comTucows Domains Inc.9 Feb 201813 Feb 20199 Feb 2019
790maidservicescarborough.comTucows Domains Inc.9 Mar 201813 Mar 20199 Mar 2019
791maidservicegreektown.comTucows Domains Inc.9 Mar 201813 Mar 20199 Mar 2019
792maidservicemarkham.comTucows Domains Inc.9 Mar 201813 Mar 20199 Mar 2019
793maidservicesouthlake.comNamesilo, LLC18 Mar 201819 Mar 201818 Mar 2019
794maidservicecoppell.comDropCatch.com 1455 LLC28 May 202331 May 202328 May 2024
795maidservices-dallas.comNameCheap, Inc.18 Mar 201818 Mar 201818 Mar 2019
796maidservicenearmenow.infoGoDaddy.com, LLC28 Mar 201828 Mar 201828 Mar 2019
797maidservicesjaipur.comBigRock Solutions Ltd.19 Apr 201819 Apr 201819 Apr 2019
798maidservicesdilworth.comTucows Domains Inc.4 May 20188 May 20194 May 2019
799maidserviceworcester.comTucows Domains Inc.20 May 201824 May 202120 May 2021
800maidservicesphoenix.comGoDaddy.com, LLC26 Aug 201926 Aug 201926 Aug 2020
801maidserviceirving.comGoDaddy.com, LLC12 Jul 201812 Jul 201812 Jul 2019
802maidservicesgreenvillesc.comGoDaddy.com, LLC15 Jul 201815 Jul 201815 Jul 2019
803maidservicedesmoines.comGoDaddy.com, LLC3 Aug 201813 Oct 20223 Aug 2024
804maidserviceames.comGoDaddy.com, LLC3 Aug 201813 Oct 20223 Aug 2024
805maidservicewestdesmoines.comGoDaddy.com, LLC3 Aug 201813 Oct 20223 Aug 2024
806maidservicepolkcity.comGoDaddy.com, LLC3 Aug 201813 Oct 20223 Aug 2024
807maidserviceiowacity.comGoDaddy.com, LLC3 Aug 201813 Oct 20223 Aug 2024
808maidserviceclive.comGoDaddy.com, LLC3 Aug 201813 Oct 20223 Aug 2024
809maidserviceankeny.comGoDaddy.com, LLC3 Aug 20184 Aug 20223 Aug 2024
810maidservicejohnston.comGoDaddy.com, LLC3 Aug 201813 Oct 20223 Aug 2024
811maidservicenorthridge.comGoDaddy.com, LLC14 Sep 201814 Sep 201814 Sep 2019
812maidservicehumble.comGoDaddy.com, LLC25 Sep 201825 Sep 201825 Sep 2019
813maidservicechester.comGoDaddy.com, LLC30 Dec 201930 Dec 201930 Dec 2020
814maidserviceglenallen.comGoDaddy.com, LLC30 Dec 201930 Dec 201930 Dec 2020
815maidserviceprovider.comGoDaddy.com, LLC10 Mar 202111 Mar 202410 Mar 2025
816maidservices4you.comNetwork Solutions, LLC11 Nov 201811 Nov 201811 Nov 2019
817maidservicenyc.proNameCheap, Inc.14 Nov 201822 Feb 202414 Nov 2024
818maidserviceassociation.comNamesilo, LLC27 Nov 201828 Nov 202327 Nov 2024
819maidservicesjacksonvillenc.comregister.com, Inc.30 Nov 201830 Nov 201830 Nov 2019
820maidservicesnewbernnc.comregister.com, Inc.1 Dec 20181 Dec 20181 Dec 2019
821maidservicesofarkansas.comGoDaddy.com, LLC11 Dec 201811 Dec 201811 Dec 2020
822maidserviceshop.comeNom, Inc.11 Dec 201811 Dec 201811 Dec 2019
823maidserviceofnewyork.comGoogle, Inc.22 May 202022 May 202022 May 2021
824maidservicemorriscounty.comGoDaddy.com, LLC18 Dec 201818 Dec 201818 Dec 2019
825maidservicecypress.comGoDaddy.com, LLC20 Dec 201821 Dec 202220 Dec 2024
826maidserviceexpert.comGoDaddy.com, LLC22 Dec 201822 Dec 201822 Dec 2019
827maidservicemarketingexpert.comGoDaddy.com, LLC22 Dec 201822 Dec 201822 Dec 2019
828maidservicesofnewyork.comGoogle, Inc.22 May 202022 May 202022 May 2021
829maidservicelubbock.comDomain.com, LLC30 Dec 201830 Dec 201830 Dec 2019
830maidservicecleaners.comGoDaddy.com, LLC1 Jan 20191 Jan 20191 Jan 2021
831maidservicekc.comGoDaddy.com, LLC1 Jan 20191 Jan 20191 Jan 2021
832maidservicesofmanhattan.comGoogle, Inc.8 Jan 20198 Jan 20248 Jan 2025
833maidservicesofnyc.comGoogle, Inc.8 Jan 20198 Jan 20248 Jan 2025
834maidservicesofny.comGoogle, Inc.8 Jan 20198 Jan 20248 Jan 2025
835maidservicemaranaaz.comGoogle, Inc.9 Jan 20199 Jan 20199 Jan 2020
836maidserviceorovalleyaz.comGoogle, Inc.9 Jan 20199 Jan 20199 Jan 2020
837maidservicestucson.comGoDaddy.com, LLC6 Apr 20206 Apr 20206 Apr 2021
838maidserviceorovalley.comGoogle, Inc.9 Jan 20199 Jan 20199 Jan 2020
839maidservicetucson.netGoogle, Inc.9 Jan 20199 Jan 20199 Jan 2020
840maidservicescallusnow.comNameCheap, Inc.17 Jan 201917 Jan 201917 Jan 2020
841maidservicescallnow.comNameCheap, Inc.17 Jan 201917 Jan 201917 Jan 2020
842maidservicescallustoday.comNameCheap, Inc.17 Jan 201917 Jan 201917 Jan 2020
843maidserviceoforlando.comDropCatch.com 984 LLC8 Apr 20228 Apr 20248 Apr 2025
844maidservicesdirectcalls.comNamesilo, LLC22 Jan 201923 Jan 201922 Jan 2020
845maidservicedirectcalls.comNameCheap, Inc.24 Jan 201924 Jan 201924 Jan 2020
846maidservicesandiego.netNameCheap, Inc.30 Jan 201930 Jan 201930 Jan 2020
847maidserviceglendale.comGoDaddy.com, LLC4 Feb 20194 Feb 20194 Feb 2020
848maidservicecall.com1API GmbH5 Feb 201911 Jan 20245 Feb 2025
849maidservicedfw.comGoDaddy.com, LLC21 Feb 201922 Feb 202321 Feb 2025
850maidservicecourses.comNameCheap, Inc.30 Mar 201930 Mar 201930 Mar 2020
851maidservicesabudhabi.comGoDaddy.com, LLC3 Apr 20193 Apr 20193 Apr 2020
852maidserviceri.comGoDaddy.com, LLC1 May 20191 May 20191 May 2020
853maidservicerhodeisland.comGoDaddy.com, LLC1 May 20191 May 20191 May 2020
854maidservicelkn.comGoDaddy.com, LLC8 Mar 20248 Mar 20248 Mar 2025
855maidservicesllc.comGoogle, Inc.17 May 201918 May 202317 May 2024
856maidservicesindubai.comGoDaddy.com, LLC18 May 201918 May 201918 May 2020
857maidservicein.comGoogle, Inc.17 May 201917 May 201917 May 2020
858maidservicetucson.cleaningGoogle, Inc.2 Jun 20192 Jul 20202 Jun 2020
859maidservicenearme.companyGoogle, Inc.2 Jun 20197 Jun 20192 Jun 2020
860maidservicewebsites.comNamesilo, LLC4 Jun 20194 Jun 20204 Jun 2020
861maidserviceis.comDomain.com, LLC5 Jun 20195 Jun 20195 Jun 2021
862maidservicebiz.comDomain.com, LLC5 Jun 20195 Jun 20195 Jun 2021
863maidservicesplus.comNamesilo, LLC10 Jul 201913 Aug 202310 Jul 2023
864maidservicenear.comGoDaddy.com, LLC29 Jul 201929 Jul 201929 Jul 2020
865maidservicesinhouston.comGoDaddy.com, LLC6 Aug 20196 Aug 20196 Aug 2020
866maidservicesinchicago.comGoDaddy.com, LLC6 Aug 20196 Aug 20196 Aug 2020
867maidservicesforyou.comAutomattic Inc.21 Aug 201921 Aug 201921 Aug 2020
868maidservicetampaflorida.comGoDaddy.com, LLC25 Oct 201725 Oct 201825 Oct 2019
869maidservicearlingtontx.comGoDaddy.com, LLC14 Sep 201914 Sep 201914 Sep 2020
870maidservicesmaroc.comGandi SAS16 Sep 201916 Sep 201916 Sep 2020
871maidserviceinsingapore.comGoDaddy.com, LLC16 Sep 201916 Sep 201916 Sep 2020
872maidserviceaustin.netNamesilo, LLC9 Oct 201910 Oct 20239 Oct 2024
873maidserviceoshawa.comeNom, Inc.4 Nov 20194 Nov 20194 Nov 2020
874maidservicelocustgroveva.comGoDaddy.com, LLC11 Nov 201911 Nov 201911 Nov 2020
875maidserviceszone.comNamesilo, LLC15 Nov 201916 Nov 201915 Nov 2020
876maidservicedxb.comGoDaddy.com, LLC7 Aug 201712 Aug 20237 Aug 2024
877maidservicemorriscountynj.comGoDaddy.com, LLC17 Dec 201918 Dec 202317 Dec 2024
878maidserviceinc.comGoDaddy.com, LLC26 May 202326 May 202326 May 2024
879maidserviceinchennai.comGoDaddy.com, LLC30 Dec 201930 Dec 201930 Dec 2020
880maidservicesinchennai.comGoDaddy.com, LLC30 Dec 201930 Dec 201930 Dec 2020
881maidservicedirect.comNameCheap, Inc.8 Jan 20209 Dec 20238 Jan 2025
882maidserviceplease.comNameCheap, Inc.11 Jan 2020-11 Jan 2021
883maidservicehamiltonny.comGoDaddy.com, LLC24 Jan 202024 Jan 202024 Jan 2021
884maidservices.frInfomaniak Network SA17 May 202115 May 202217 May 2023
885maidservicenaplesfl.comGoDaddy.com, LLC9 Feb 202022 Apr 20249 Feb 2024
886maidservicescompanie.comGoogle, Inc.25 Feb 202025 Feb 202025 Feb 2021
887maidservices.proGoDaddy.com, LLC12 Aug 202112 Aug 202112 Aug 2022
888maidservicesbydes.comGoDaddy.com, LLC9 Mar 20209 Mar 20209 Mar 2021
889maidservicehub.comGoDaddy.com, LLC4 Jan 20244 Jan 20244 Jan 2025
890maidservicecoronavirus.comGoDaddy.com, LLC21 Mar 202021 Mar 202021 Mar 2021
891maidservicesoflouisville.comGoogle, Inc.9 Dec 202010 Dec 20209 Dec 2021
892maidservices4less.comGoDaddy.com, LLC14 Apr 202014 Apr 202014 Apr 2021
893maidservicecafe.comGoDaddy.com, LLC15 May 202013 Feb 202315 May 2025
894maidservicesnationwide.infoNameCheap, Inc.23 Nov 201923 Jan 202023 Nov 2020
895maidservicespace.infoGoDaddy.com, LLC15 Jan 202015 Mar 202015 Jan 2021
896maidserviceshop.infoGoDaddy.com, LLC9 Dec 20198 Feb 20209 Dec 2020
897maidservices.todayGoDaddy.com, LLC19 Jan 202424 Jan 202419 Jan 2025
898maidservicesanjoseca.comNameCheap, Inc.9 Jun 2020-9 Jun 2021
899maidservicezw.comGoDaddy.com, LLC9 Jun 20209 Jun 20209 Jun 2021
900maidservicenearmesanfrancisco.comNameCheap, Inc.16 Jun 2020-16 Jun 2021
901maidservicemaui.comAmazon Registrar, Inc.27 Jun 202027 Jun 202027 Jun 2021
902maidservicesindia.comHostinger, UAB2 Nov 20233 Feb 20242 Nov 2024
903maidserviceatlantaga.infoGoDaddy.com, LLC16 Jul 202030 Aug 202316 Jul 2024
904maidserviceatlantaga.comGoDaddy.com, LLC16 Jul 202017 Jul 202316 Jul 2024
905maidservicecolumbusga.comGoDaddy.com, LLC16 Jul 202017 Jul 202316 Jul 2024
906maidserviceindubai.xyzNameCheap, Inc.8 Dec 201916 Dec 20198 Dec 2020
907maidservice24.comGoDaddy.com, LLC5 Aug 20205 Aug 20205 Aug 2021
908maidservicebrunswickga.comGoDaddy.com, LLC6 Aug 20206 Aug 20206 Aug 2021
909maidservicegreater.infoFabulous.com Pty Ltd.17 Aug 202017 Aug 202017 Aug 2021
910maidservicecheyenne.com1&1 Internet AG19 Aug 202019 Aug 202019 Aug 2021
911maidservicechino.comDynadot, LLC22 Aug 202023 Aug 202322 Aug 2024
912maidservicechinohills.comDynadot, LLC22 Aug 202023 Aug 202322 Aug 2024
913maidserviceealrate.infoGoDaddy.com, LLC25 Aug 202025 Aug 202025 Aug 2021
914maidservicecompany.comGoDaddy.com, LLC8 Sep 202031 Aug 20238 Sep 2024
915maidservicechat.comGoDaddy.com, LLC10 Sep 202011 Sep 202310 Sep 2024
916maidserviceseo.comNameCheap, Inc.27 Dec 202327 Dec 202327 Dec 2024
917maidservicepalmbeach.comGoDaddy.com, LLC1 Oct 20201 Oct 20201 Oct 2021
918maidservicegroup.comGoDaddy.com, LLC8 Oct 20208 Oct 20208 Oct 2021
919maidservicemontreal.comNameKing.com Inc.13 May 202313 May 202313 May 2024
920maidserviceniagara.comWix.com Ltd.17 Sep 202028 Oct 202317 Sep 2023
921maidservicestaffing.comGoDaddy.com, LLC21 Nov 202031 Oct 202221 Nov 2025
922maidservicestexas.comGoDaddy.com, LLC23 Nov 202023 Nov 202023 Nov 2021
923maidservicenearlewes.comGoDaddy.com, LLC14 Dec 202014 Dec 202014 Dec 2021
924maidservicenearoceanview.comGoDaddy.com, LLC14 Dec 202014 Dec 202014 Dec 2021
925maidservicenearmillville.comGoDaddy.com, LLC14 Dec 202014 Dec 202014 Dec 2021
926maidserviceinbrickell.comGoDaddy.com, LLC29 Dec 202029 Dec 202029 Dec 2021
927maidservicesnearme.comGoDaddy.com, LLC12 Jan 202117 Jan 202312 Jan 2025
928maidserviceinfohelp.siteGoDaddy.com, LLC19 Jan 202119 Jan 202119 Jan 2022
929maidservicesinjaipur.comGoDaddy.com, LLC12 Apr 202327 Apr 202412 Apr 2025
930maidservicesummervillesc.com1&1 Internet AG27 Jan 202127 Jan 202127 Jan 2022
931maidserviceinjacksonville.comGoDaddy.com, LLC3 Feb 20213 Feb 20213 Feb 2022
932maidserviceproviders.comGoDaddy.com, LLC25 Feb 202126 Feb 202425 Feb 2025
933maidservicetrain.comNameCheap, Inc.4 Mar 20212 Feb 20224 Mar 2023
934maidservicewebsite.comWild West Domains, LLC23 Mar 20213 Apr 202423 Mar 2025
935maidservicesofamerica.onlineregister.com, Inc.31 Mar 202131 Mar 202131 Mar 2022
936maidservices-cleaning-forseniors.website1API GmbH27 Apr 202127 Apr 202127 Apr 2022
937maidservices-cleaningforseniors.website1API GmbH27 Apr 202127 Apr 202127 Apr 2022
938maidservicescleaningforseniors.website1API GmbH27 Apr 202127 Apr 202127 Apr 2022
939maidservicescleaning-forseniors.website1API GmbH27 Apr 202127 Apr 202127 Apr 2022
940maidservicestartupguide.bizGoDaddy.com, LLC3 May 20213 May 20213 May 2022
941maidservicephiladelphiapa.xyzNamesilo, LLC15 May 202115 May 202115 May 2022
942maidservicesanangelotx.comGoDaddy.com, LLC14 May 202115 May 202314 May 2025
943maidservicesmumbai.comHosting Concepts B.V. dba Openprovider17 May 202127 Jun 202317 May 2023
944maidservicetallahassee.comGoDaddy.com, LLC19 May 202120 May 202319 May 2025
945maidservicesuknet.comKey-Systems GmbH1 Jun 202116 Aug 20231 Jun 2024
946maidservicesuk.comKey-Systems GmbH2 Jun 20212 Jun 20212 Jun 2022
947maidserviceuk.com-9 Aug 20238 Oct 20239 Aug 2024
948maidserviceguide.siteDOTSERVE INC.6 Jul 202131 Aug 20236 Jul 2024
949maidservicesofalbuquerque.comLaunchpad, Inc.15 Jul 202122 Dec 202315 Jul 2024
950maidservicesarlington.comGoDaddy.com, LLC22 Jul 202124 Jul 202322 Jul 2024
951maidservicesofiowacity.comLaunchpad, Inc.7 Aug 202127 Dec 20237 Aug 2024
952maidservices.usHosting Concepts B.V. dba Openprovider8 Jul 202329 Dec 20238 Jul 2024
953maidservicemcallen.comLaunchpad, Inc.24 Aug 20215 Jan 202424 Aug 2024
954maidservicessc.comGoDaddy.com, LLC26 Aug 202126 Aug 202126 Aug 2022
955maidservicecentre.comNameCheap, Inc.4 Sep 202116 Nov 20234 Sep 2023
956maidservicesofwichita.comLaunchpad, Inc.11 Sep 202127 Aug 202311 Sep 2024
957maidservicenrh.comNameCheap, Inc.15 Sep 202116 Aug 202315 Sep 2024
958maidservicetribeca.comDreamHost, LLC17 Oct 202121 Oct 202317 Oct 2024
959maidservicestatenisland.comGoDaddy.com, LLC16 Oct 202117 Oct 202316 Oct 2024
960maidservicewilliamsburg.comGoDaddy.com, LLC17 Oct 202117 Oct 202317 Oct 2024
961maidserviceswestchester.comGoDaddy.com, LLC17 Oct 202117 Oct 202317 Oct 2024
962maidserviceedmonton.comGoogle, Inc.21 Oct 202121 Oct 202121 Oct 2022
963maidservicewellington.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
964maidservicecoopercity.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
965maidservicepompanobeach.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
966maidserviceftlauderdale.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
967maidservicehallandale.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
968maidservicebrickell.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
969maidservicepembrokepines.comGoDaddy.com, LLC24 Oct 202125 Oct 202324 Oct 2024
970maidservicelincoln.comTucows Domains Inc.26 Oct 202129 Dec 202326 Oct 2024
971maidservicesaenet.comKey-Systems GmbH29 Oct 202129 Oct 202129 Oct 2022
972maidserviceswebae.comKey-Systems GmbH29 Oct 202129 Oct 202129 Oct 2022
973maidservice-boyntonbeach.comGoDaddy.com, LLC31 Oct 20211 Nov 202331 Oct 2024
974maidservicesstamford.comGoDaddy.com, LLC16 Nov 202116 Nov 202316 Nov 2024
975maidservicebethany.comGoDaddy.com, LLC16 Nov 202116 Nov 202316 Nov 2024
976maidservicefairfield.comGoDaddy.com, LLC16 Nov 202116 Nov 202316 Nov 2024
977maidservicekillingworth.comGoDaddy.com, LLC16 Nov 202116 Nov 202316 Nov 2024
978maidservicewindsor.comGoDaddy.com, LLC16 Nov 202116 Nov 202316 Nov 2024
979maidservicegreenwich.comGoDaddy.com, LLC16 Nov 202116 Nov 202316 Nov 2024
980maidservicesnationwide.comGMO Internet Inc.29 Nov 20219 Jan 202329 Nov 2022
981maidservicenews.comGoDaddy.com, LLC30 Nov 202110 Feb 202430 Nov 2023
982maidservicesnow.comGoDaddy.com, LLC15 Dec 202116 Dec 202315 Dec 2024
983maidservicedelhi.comGoDaddy.com, LLC18 Dec 202118 Dec 202118 Dec 2022
984maidservice1.xyzGMO Internet Inc.8 Dec 202313 Dec 20238 Dec 2024
985maidserviceindhaka.comNameCheap, Inc.22 Apr 202423 Apr 202422 Apr 2025
986maidservicebrighton.comGoDaddy.com, LLC21 Dec 202122 Dec 202321 Dec 2024
987maidservicesdeserthotsprings.comGoDaddy.com, LLC27 Dec 202127 Dec 202127 Dec 2022
988maidserviceth.comDynadot, LLC5 Jan 20225 Jan 20225 Jan 2023
989maidservicecenter.com1&1 Internet AG10 Feb 202210 Feb 202210 Feb 2025
990maidservicescantonohio.comGoDaddy.com, LLC25 Feb 202226 Feb 202425 Feb 2025
991maidservicegurgaon.onlineGoDaddy.com, LLC3 Mar 202214 Apr 20233 Mar 2023
992maidservicegrandprairietx.netCloudFlare, Inc.30 May 202316 Apr 202430 May 2025
993maidservicemiamibeach.comBeijing Lanhai Jiye Technology Co., Ltd7 Mar 20228 Apr 20237 Mar 2023
994maidserviceukweb.comKey-Systems GmbH14 Mar 202228 May 202314 Mar 2024
995maidservicemakeover.com1&1 Internet AG14 Mar 202219 Apr 202314 Mar 2023
996maidserviceinhomesas.comGoogle, Inc.21 Mar 202220 Apr 202321 Mar 2023
997maidserviceswebuk.comKey-Systems GmbH21 Mar 202226 Apr 202321 Mar 2024
998maidservicescan.comKey-Systems GmbH6 Apr 202226 May 20236 Apr 2024
999maidserviceswebca.comKey-Systems GmbH6 Apr 202211 May 20236 Apr 2024
1000maidservicesaus.comKey-Systems GmbH11 Apr 202230 Apr 202411 Apr 2024

Displaying 1,000 out of 1,319 domains starting with the keyword "MAIDSERVICE". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=maidservice

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now